From 05d9f2dc22454d77067f51f10914ee94a5725751 Mon Sep 17 00:00:00 2001 From: knative-automation Date: Tue, 23 May 2023 14:52:08 -0400 Subject: [PATCH] upgrade to latest dependencies (#1110) bumping knative.dev/pkg db8a353...52ff2ac:%0A > 52ff2ac drop dynamic client wrappers (# 2744)%0A > a170a07 Eventing TLS: validate that Destination.CACerts is a PEM encoded cert (# 2743)%0A > dfb4bf0 Drop dynamic wrapper injection code generation (# 2742)%0Abumping knative.dev/networking 77975a1...a44b093:%0A > a44b093 upgrade to latest dependencies (# 808)%0A > 7c2f7ac upgrade to latest dependencies (# 807)%0A > 33636d9 Backward compatibility for InternalEncryption (# 806) Signed-off-by: Knative Automation --- go.mod | 4 +- go.sum | 8 +- pkg/client/istio/injection/client/client.go | 1103 - .../destinationrule/destinationrule.go | 64 - .../filtered/destinationrule.go | 71 - .../v1beta1/gateway/filtered/gateway.go | 71 - .../networking/v1beta1/gateway/gateway.go | 64 - .../proxyconfig/filtered/proxyconfig.go | 71 - .../v1beta1/proxyconfig/proxyconfig.go | 64 - .../serviceentry/filtered/serviceentry.go | 71 - .../v1beta1/serviceentry/serviceentry.go | 64 - .../v1beta1/sidecar/filtered/sidecar.go | 71 - .../networking/v1beta1/sidecar/sidecar.go | 64 - .../virtualservice/filtered/virtualservice.go | 71 - .../v1beta1/virtualservice/virtualservice.go | 64 - .../workloadentry/filtered/workloadentry.go | 71 - .../v1beta1/workloadentry/workloadentry.go | 64 - .../workloadgroup/filtered/workloadgroup.go | 71 - .../v1beta1/workloadgroup/workloadgroup.go | 64 - vendor/golang.org/x/text/cases/cases.go | 162 - vendor/golang.org/x/text/cases/context.go | 376 - vendor/golang.org/x/text/cases/fold.go | 34 - vendor/golang.org/x/text/cases/icu.go | 62 - vendor/golang.org/x/text/cases/info.go | 82 - vendor/golang.org/x/text/cases/map.go | 816 - .../golang.org/x/text/cases/tables10.0.0.go | 2256 -- .../golang.org/x/text/cases/tables11.0.0.go | 2317 -- .../golang.org/x/text/cases/tables12.0.0.go | 2360 -- .../golang.org/x/text/cases/tables13.0.0.go | 2400 -- vendor/golang.org/x/text/cases/tables9.0.0.go | 2216 -- vendor/golang.org/x/text/cases/trieval.go | 217 - vendor/golang.org/x/text/internal/internal.go | 49 - .../x/text/internal/language/common.go | 16 - .../x/text/internal/language/compact.go | 29 - .../text/internal/language/compact/compact.go | 61 - .../internal/language/compact/language.go | 260 - .../text/internal/language/compact/parents.go | 120 - .../text/internal/language/compact/tables.go | 1015 - .../x/text/internal/language/compact/tags.go | 91 - .../x/text/internal/language/compose.go | 167 - .../x/text/internal/language/coverage.go | 28 - .../x/text/internal/language/language.go | 627 - .../x/text/internal/language/lookup.go | 412 - .../x/text/internal/language/match.go | 226 - .../x/text/internal/language/parse.go | 608 - .../x/text/internal/language/tables.go | 3472 --- .../x/text/internal/language/tags.go | 48 - vendor/golang.org/x/text/internal/match.go | 67 - vendor/golang.org/x/text/internal/tag/tag.go | 100 - vendor/golang.org/x/text/language/coverage.go | 187 - vendor/golang.org/x/text/language/doc.go | 98 - vendor/golang.org/x/text/language/language.go | 605 - vendor/golang.org/x/text/language/match.go | 735 - vendor/golang.org/x/text/language/parse.go | 256 - vendor/golang.org/x/text/language/tables.go | 298 - vendor/golang.org/x/text/language/tags.go | 145 - .../pkg/client/injection/client/client.go | 829 - .../v1alpha1/certificate/certificate.go | 64 - .../networking/v1alpha1/ingress/ingress.go | 64 - .../serverlessservice/serverlessservice.go | 64 - .../networking/pkg/config/config.go | 4 + .../pkg/apis/duck/v1/destination.go | 23 + .../client/injection/kube/client/client.go | 18293 ---------------- .../injection/kube/client/client_expansion.go | 160 - .../mutatingwebhookconfiguration.go | 58 - .../validatingwebhookconfiguration.go | 58 - .../informers/core/v1/endpoints/endpoints.go | 64 - .../kube/informers/core/v1/pod/pod.go | 64 - .../core/v1/secret/filtered/secret.go | 71 - .../kube/informers/core/v1/secret/secret.go | 64 - .../kube/informers/core/v1/service/service.go | 64 - .../codegen/cmd/injection-gen/args/args.go | 4 +- .../cmd/injection-gen/generators/client.go | 583 +- .../generators/filtered_informer.go | 117 - .../cmd/injection-gen/generators/informer.go | 125 +- .../cmd/injection-gen/generators/packages.go | 43 +- .../clients/dynamicclient/dynamicclient.go | 49 - .../informers/core/v1/secret/secret.go | 54 - vendor/modules.txt | 11 +- 79 files changed, 51 insertions(+), 46092 deletions(-) delete mode 100644 vendor/golang.org/x/text/cases/cases.go delete mode 100644 vendor/golang.org/x/text/cases/context.go delete mode 100644 vendor/golang.org/x/text/cases/fold.go delete mode 100644 vendor/golang.org/x/text/cases/icu.go delete mode 100644 vendor/golang.org/x/text/cases/info.go delete mode 100644 vendor/golang.org/x/text/cases/map.go delete mode 100644 vendor/golang.org/x/text/cases/tables10.0.0.go delete mode 100644 vendor/golang.org/x/text/cases/tables11.0.0.go delete mode 100644 vendor/golang.org/x/text/cases/tables12.0.0.go delete mode 100644 vendor/golang.org/x/text/cases/tables13.0.0.go delete mode 100644 vendor/golang.org/x/text/cases/tables9.0.0.go delete mode 100644 vendor/golang.org/x/text/cases/trieval.go delete mode 100644 vendor/golang.org/x/text/internal/internal.go delete mode 100644 vendor/golang.org/x/text/internal/language/common.go delete mode 100644 vendor/golang.org/x/text/internal/language/compact.go delete mode 100644 vendor/golang.org/x/text/internal/language/compact/compact.go delete mode 100644 vendor/golang.org/x/text/internal/language/compact/language.go delete mode 100644 vendor/golang.org/x/text/internal/language/compact/parents.go delete mode 100644 vendor/golang.org/x/text/internal/language/compact/tables.go delete mode 100644 vendor/golang.org/x/text/internal/language/compact/tags.go delete mode 100644 vendor/golang.org/x/text/internal/language/compose.go delete mode 100644 vendor/golang.org/x/text/internal/language/coverage.go delete mode 100644 vendor/golang.org/x/text/internal/language/language.go delete mode 100644 vendor/golang.org/x/text/internal/language/lookup.go delete mode 100644 vendor/golang.org/x/text/internal/language/match.go delete mode 100644 vendor/golang.org/x/text/internal/language/parse.go delete mode 100644 vendor/golang.org/x/text/internal/language/tables.go delete mode 100644 vendor/golang.org/x/text/internal/language/tags.go delete mode 100644 vendor/golang.org/x/text/internal/match.go delete mode 100644 vendor/golang.org/x/text/internal/tag/tag.go delete mode 100644 vendor/golang.org/x/text/language/coverage.go delete mode 100644 vendor/golang.org/x/text/language/doc.go delete mode 100644 vendor/golang.org/x/text/language/language.go delete mode 100644 vendor/golang.org/x/text/language/match.go delete mode 100644 vendor/golang.org/x/text/language/parse.go delete mode 100644 vendor/golang.org/x/text/language/tables.go delete mode 100644 vendor/golang.org/x/text/language/tags.go delete mode 100644 vendor/knative.dev/pkg/client/injection/kube/client/client_expansion.go delete mode 100644 vendor/knative.dev/pkg/injection/clients/dynamicclient/dynamicclient.go diff --git a/go.mod b/go.mod index fcc626fba9..bcd373a704 100644 --- a/go.mod +++ b/go.mod @@ -21,8 +21,8 @@ require ( k8s.io/apimachinery v0.26.0 k8s.io/client-go v0.26.0 knative.dev/hack v0.0.0-20230501013555-7d81248b4638 - knative.dev/networking v0.0.0-20230504184058-77975a12b2ee - knative.dev/pkg v0.0.0-20230502134655-db8a35330281 + knative.dev/networking v0.0.0-20230519194114-a44b093b6809 + knative.dev/pkg v0.0.0-20230519200515-52ff2acf870d ) require ( diff --git a/go.sum b/go.sum index 653481b903..4464505213 100644 --- a/go.sum +++ b/go.sum @@ -879,10 +879,10 @@ k8s.io/utils v0.0.0-20221108210102-8e77b1f39fe2 h1:GfD9OzL11kvZN5iArC6oTS7RTj7oJ k8s.io/utils v0.0.0-20221108210102-8e77b1f39fe2/go.mod h1:OLgZIPagt7ERELqWJFomSt595RzquPNLL48iOWgYOg0= knative.dev/hack v0.0.0-20230501013555-7d81248b4638 h1:9IuXHdwp5jNmIg+0LVTQr8o4u0FYD99uCfynM9tS0XY= knative.dev/hack v0.0.0-20230501013555-7d81248b4638/go.mod h1:yk2OjGDsbEnQjfxdm0/HJKS2WqTLEFg/N6nUs6Rqx3Q= -knative.dev/networking v0.0.0-20230504184058-77975a12b2ee h1:d2dytSnwikNVtttk/lTjn7t6A9447DkUXADHR+zLOdU= -knative.dev/networking v0.0.0-20230504184058-77975a12b2ee/go.mod h1:OG9AEepHd3dofzrkzb0IelqN5uzu10RjbSdhl5UruSE= -knative.dev/pkg v0.0.0-20230502134655-db8a35330281 h1:9mN8O5XO68DKlkzEhFAShUx+O/I+TQR71vmTvYt8oF4= -knative.dev/pkg v0.0.0-20230502134655-db8a35330281/go.mod h1:2qWPP9Gjh9Q7ETti+WRHnBnGCSCq+6q7m3p/nmUQviE= +knative.dev/networking v0.0.0-20230519194114-a44b093b6809 h1:VVhmtWC2eXl93mz2jKkGyDWM9wIOYvFYNQsp3tpHnsE= +knative.dev/networking v0.0.0-20230519194114-a44b093b6809/go.mod h1:Y0OGdDIPKUGY5WFoKBR5KKCLsnAHbYEbzfXeWs2rYJw= +knative.dev/pkg v0.0.0-20230519200515-52ff2acf870d h1:7SnDEbArYmc8swy5LUB0o+YnoRHL6/BXKYy4HeHlDmM= +knative.dev/pkg v0.0.0-20230519200515-52ff2acf870d/go.mod h1:WLTHHHc/dhrDmhx03nm5F8AeqpNx3RQGggMI2N0/oks= rsc.io/binaryregexp v0.2.0/go.mod h1:qTv7/COck+e2FymRvadv62gMdZztPaShugOCi3I+8D8= rsc.io/quote/v3 v3.1.0/go.mod h1:yEA65RcK8LyAZtP9Kv3t0HmxON59tX3rD+tICJqUlj0= rsc.io/sampler v1.3.0/go.mod h1:T1hPZKmBbMNahiBKFy5HrXp6adAjACjK9JXDnKaTXpA= diff --git a/pkg/client/istio/injection/client/client.go b/pkg/client/istio/injection/client/client.go index 8824d85e72..73cbd3a0ee 100644 --- a/pkg/client/istio/injection/client/client.go +++ b/pkg/client/istio/injection/client/client.go @@ -20,24 +20,10 @@ package client import ( context "context" - json "encoding/json" - errors "errors" - fmt "fmt" - v1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - unstructured "k8s.io/apimachinery/pkg/apis/meta/v1/unstructured" - runtime "k8s.io/apimachinery/pkg/runtime" - schema "k8s.io/apimachinery/pkg/runtime/schema" - types "k8s.io/apimachinery/pkg/types" - watch "k8s.io/apimachinery/pkg/watch" - discovery "k8s.io/client-go/discovery" - dynamic "k8s.io/client-go/dynamic" rest "k8s.io/client-go/rest" versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" - typednetworkingv1beta1 "knative.dev/net-istio/pkg/client/istio/clientset/versioned/typed/networking/v1beta1" injection "knative.dev/pkg/injection" - dynamicclient "knative.dev/pkg/injection/clients/dynamicclient" logging "knative.dev/pkg/logging" ) @@ -46,7 +32,6 @@ func init() { injection.Default.RegisterClientFetcher(func(ctx context.Context) interface{} { return Get(ctx) }) - injection.Dynamic.RegisterDynamicClient(withClientFromDynamic) } // Key is used as the key for associating information with a context.Context. @@ -56,10 +41,6 @@ func withClientFromConfig(ctx context.Context, cfg *rest.Config) context.Context return context.WithValue(ctx, Key{}, versioned.NewForConfigOrDie(cfg)) } -func withClientFromDynamic(ctx context.Context) context.Context { - return context.WithValue(ctx, Key{}, &wrapClient{dyn: dynamicclient.Get(ctx)}) -} - // Get extracts the versioned.Interface client from the context. func Get(ctx context.Context) versioned.Interface { untyped := ctx.Value(Key{}) @@ -74,1087 +55,3 @@ func Get(ctx context.Context) versioned.Interface { } return untyped.(versioned.Interface) } - -type wrapClient struct { - dyn dynamic.Interface -} - -var _ versioned.Interface = (*wrapClient)(nil) - -func (w *wrapClient) Discovery() discovery.DiscoveryInterface { - panic("Discovery called on dynamic client!") -} - -func convert(from interface{}, to runtime.Object) error { - bs, err := json.Marshal(from) - if err != nil { - return fmt.Errorf("Marshal() = %w", err) - } - if err := json.Unmarshal(bs, to); err != nil { - return fmt.Errorf("Unmarshal() = %w", err) - } - return nil -} - -// NetworkingV1beta1 retrieves the NetworkingV1beta1Client -func (w *wrapClient) NetworkingV1beta1() typednetworkingv1beta1.NetworkingV1beta1Interface { - return &wrapNetworkingV1beta1{ - dyn: w.dyn, - } -} - -type wrapNetworkingV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapNetworkingV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapNetworkingV1beta1) DestinationRules(namespace string) typednetworkingv1beta1.DestinationRuleInterface { - return &wrapNetworkingV1beta1DestinationRuleImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.istio.io", - Version: "v1beta1", - Resource: "destinationrules", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1beta1DestinationRuleImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1beta1.DestinationRuleInterface = (*wrapNetworkingV1beta1DestinationRuleImpl)(nil) - -func (w *wrapNetworkingV1beta1DestinationRuleImpl) Create(ctx context.Context, in *v1beta1.DestinationRule, opts v1.CreateOptions) (*v1beta1.DestinationRule, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "DestinationRule", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.DestinationRule{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1DestinationRuleImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1beta1DestinationRuleImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1beta1DestinationRuleImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1beta1.DestinationRule, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1beta1.DestinationRule{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1DestinationRuleImpl) List(ctx context.Context, opts v1.ListOptions) (*v1beta1.DestinationRuleList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1beta1.DestinationRuleList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1DestinationRuleImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1beta1.DestinationRule, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1beta1.DestinationRule{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1DestinationRuleImpl) Update(ctx context.Context, in *v1beta1.DestinationRule, opts v1.UpdateOptions) (*v1beta1.DestinationRule, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "DestinationRule", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.DestinationRule{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1DestinationRuleImpl) UpdateStatus(ctx context.Context, in *v1beta1.DestinationRule, opts v1.UpdateOptions) (*v1beta1.DestinationRule, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "DestinationRule", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.DestinationRule{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1DestinationRuleImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1beta1) Gateways(namespace string) typednetworkingv1beta1.GatewayInterface { - return &wrapNetworkingV1beta1GatewayImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.istio.io", - Version: "v1beta1", - Resource: "gateways", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1beta1GatewayImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1beta1.GatewayInterface = (*wrapNetworkingV1beta1GatewayImpl)(nil) - -func (w *wrapNetworkingV1beta1GatewayImpl) Create(ctx context.Context, in *v1beta1.Gateway, opts v1.CreateOptions) (*v1beta1.Gateway, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "Gateway", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.Gateway{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1GatewayImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1beta1GatewayImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1beta1GatewayImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1beta1.Gateway, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1beta1.Gateway{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1GatewayImpl) List(ctx context.Context, opts v1.ListOptions) (*v1beta1.GatewayList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1beta1.GatewayList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1GatewayImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1beta1.Gateway, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1beta1.Gateway{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1GatewayImpl) Update(ctx context.Context, in *v1beta1.Gateway, opts v1.UpdateOptions) (*v1beta1.Gateway, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "Gateway", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.Gateway{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1GatewayImpl) UpdateStatus(ctx context.Context, in *v1beta1.Gateway, opts v1.UpdateOptions) (*v1beta1.Gateway, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "Gateway", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.Gateway{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1GatewayImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1beta1) ProxyConfigs(namespace string) typednetworkingv1beta1.ProxyConfigInterface { - return &wrapNetworkingV1beta1ProxyConfigImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.istio.io", - Version: "v1beta1", - Resource: "proxyconfigs", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1beta1ProxyConfigImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1beta1.ProxyConfigInterface = (*wrapNetworkingV1beta1ProxyConfigImpl)(nil) - -func (w *wrapNetworkingV1beta1ProxyConfigImpl) Create(ctx context.Context, in *v1beta1.ProxyConfig, opts v1.CreateOptions) (*v1beta1.ProxyConfig, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "ProxyConfig", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.ProxyConfig{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1ProxyConfigImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1beta1ProxyConfigImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1beta1ProxyConfigImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1beta1.ProxyConfig, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1beta1.ProxyConfig{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1ProxyConfigImpl) List(ctx context.Context, opts v1.ListOptions) (*v1beta1.ProxyConfigList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1beta1.ProxyConfigList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1ProxyConfigImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1beta1.ProxyConfig, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1beta1.ProxyConfig{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1ProxyConfigImpl) Update(ctx context.Context, in *v1beta1.ProxyConfig, opts v1.UpdateOptions) (*v1beta1.ProxyConfig, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "ProxyConfig", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.ProxyConfig{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1ProxyConfigImpl) UpdateStatus(ctx context.Context, in *v1beta1.ProxyConfig, opts v1.UpdateOptions) (*v1beta1.ProxyConfig, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "ProxyConfig", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.ProxyConfig{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1ProxyConfigImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1beta1) ServiceEntries(namespace string) typednetworkingv1beta1.ServiceEntryInterface { - return &wrapNetworkingV1beta1ServiceEntryImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.istio.io", - Version: "v1beta1", - Resource: "serviceentries", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1beta1ServiceEntryImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1beta1.ServiceEntryInterface = (*wrapNetworkingV1beta1ServiceEntryImpl)(nil) - -func (w *wrapNetworkingV1beta1ServiceEntryImpl) Create(ctx context.Context, in *v1beta1.ServiceEntry, opts v1.CreateOptions) (*v1beta1.ServiceEntry, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "ServiceEntry", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.ServiceEntry{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1ServiceEntryImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1beta1ServiceEntryImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1beta1ServiceEntryImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1beta1.ServiceEntry, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1beta1.ServiceEntry{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1ServiceEntryImpl) List(ctx context.Context, opts v1.ListOptions) (*v1beta1.ServiceEntryList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1beta1.ServiceEntryList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1ServiceEntryImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1beta1.ServiceEntry, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1beta1.ServiceEntry{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1ServiceEntryImpl) Update(ctx context.Context, in *v1beta1.ServiceEntry, opts v1.UpdateOptions) (*v1beta1.ServiceEntry, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "ServiceEntry", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.ServiceEntry{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1ServiceEntryImpl) UpdateStatus(ctx context.Context, in *v1beta1.ServiceEntry, opts v1.UpdateOptions) (*v1beta1.ServiceEntry, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "ServiceEntry", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.ServiceEntry{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1ServiceEntryImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1beta1) Sidecars(namespace string) typednetworkingv1beta1.SidecarInterface { - return &wrapNetworkingV1beta1SidecarImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.istio.io", - Version: "v1beta1", - Resource: "sidecars", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1beta1SidecarImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1beta1.SidecarInterface = (*wrapNetworkingV1beta1SidecarImpl)(nil) - -func (w *wrapNetworkingV1beta1SidecarImpl) Create(ctx context.Context, in *v1beta1.Sidecar, opts v1.CreateOptions) (*v1beta1.Sidecar, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "Sidecar", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.Sidecar{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1SidecarImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1beta1SidecarImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1beta1SidecarImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1beta1.Sidecar, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1beta1.Sidecar{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1SidecarImpl) List(ctx context.Context, opts v1.ListOptions) (*v1beta1.SidecarList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1beta1.SidecarList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1SidecarImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1beta1.Sidecar, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1beta1.Sidecar{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1SidecarImpl) Update(ctx context.Context, in *v1beta1.Sidecar, opts v1.UpdateOptions) (*v1beta1.Sidecar, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "Sidecar", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.Sidecar{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1SidecarImpl) UpdateStatus(ctx context.Context, in *v1beta1.Sidecar, opts v1.UpdateOptions) (*v1beta1.Sidecar, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "Sidecar", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.Sidecar{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1SidecarImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1beta1) VirtualServices(namespace string) typednetworkingv1beta1.VirtualServiceInterface { - return &wrapNetworkingV1beta1VirtualServiceImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.istio.io", - Version: "v1beta1", - Resource: "virtualservices", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1beta1VirtualServiceImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1beta1.VirtualServiceInterface = (*wrapNetworkingV1beta1VirtualServiceImpl)(nil) - -func (w *wrapNetworkingV1beta1VirtualServiceImpl) Create(ctx context.Context, in *v1beta1.VirtualService, opts v1.CreateOptions) (*v1beta1.VirtualService, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "VirtualService", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.VirtualService{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1VirtualServiceImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1beta1VirtualServiceImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1beta1VirtualServiceImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1beta1.VirtualService, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1beta1.VirtualService{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1VirtualServiceImpl) List(ctx context.Context, opts v1.ListOptions) (*v1beta1.VirtualServiceList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1beta1.VirtualServiceList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1VirtualServiceImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1beta1.VirtualService, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1beta1.VirtualService{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1VirtualServiceImpl) Update(ctx context.Context, in *v1beta1.VirtualService, opts v1.UpdateOptions) (*v1beta1.VirtualService, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "VirtualService", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.VirtualService{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1VirtualServiceImpl) UpdateStatus(ctx context.Context, in *v1beta1.VirtualService, opts v1.UpdateOptions) (*v1beta1.VirtualService, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "VirtualService", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.VirtualService{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1VirtualServiceImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1beta1) WorkloadEntries(namespace string) typednetworkingv1beta1.WorkloadEntryInterface { - return &wrapNetworkingV1beta1WorkloadEntryImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.istio.io", - Version: "v1beta1", - Resource: "workloadentries", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1beta1WorkloadEntryImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1beta1.WorkloadEntryInterface = (*wrapNetworkingV1beta1WorkloadEntryImpl)(nil) - -func (w *wrapNetworkingV1beta1WorkloadEntryImpl) Create(ctx context.Context, in *v1beta1.WorkloadEntry, opts v1.CreateOptions) (*v1beta1.WorkloadEntry, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "WorkloadEntry", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.WorkloadEntry{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1WorkloadEntryImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1beta1WorkloadEntryImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1beta1WorkloadEntryImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1beta1.WorkloadEntry, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1beta1.WorkloadEntry{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1WorkloadEntryImpl) List(ctx context.Context, opts v1.ListOptions) (*v1beta1.WorkloadEntryList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1beta1.WorkloadEntryList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1WorkloadEntryImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1beta1.WorkloadEntry, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1beta1.WorkloadEntry{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1WorkloadEntryImpl) Update(ctx context.Context, in *v1beta1.WorkloadEntry, opts v1.UpdateOptions) (*v1beta1.WorkloadEntry, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "WorkloadEntry", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.WorkloadEntry{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1WorkloadEntryImpl) UpdateStatus(ctx context.Context, in *v1beta1.WorkloadEntry, opts v1.UpdateOptions) (*v1beta1.WorkloadEntry, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "WorkloadEntry", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.WorkloadEntry{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1WorkloadEntryImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1beta1) WorkloadGroups(namespace string) typednetworkingv1beta1.WorkloadGroupInterface { - return &wrapNetworkingV1beta1WorkloadGroupImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.istio.io", - Version: "v1beta1", - Resource: "workloadgroups", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1beta1WorkloadGroupImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1beta1.WorkloadGroupInterface = (*wrapNetworkingV1beta1WorkloadGroupImpl)(nil) - -func (w *wrapNetworkingV1beta1WorkloadGroupImpl) Create(ctx context.Context, in *v1beta1.WorkloadGroup, opts v1.CreateOptions) (*v1beta1.WorkloadGroup, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "WorkloadGroup", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.WorkloadGroup{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1WorkloadGroupImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1beta1WorkloadGroupImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1beta1WorkloadGroupImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1beta1.WorkloadGroup, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1beta1.WorkloadGroup{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1WorkloadGroupImpl) List(ctx context.Context, opts v1.ListOptions) (*v1beta1.WorkloadGroupList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1beta1.WorkloadGroupList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1WorkloadGroupImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1beta1.WorkloadGroup, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1beta1.WorkloadGroup{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1WorkloadGroupImpl) Update(ctx context.Context, in *v1beta1.WorkloadGroup, opts v1.UpdateOptions) (*v1beta1.WorkloadGroup, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "WorkloadGroup", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.WorkloadGroup{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1WorkloadGroupImpl) UpdateStatus(ctx context.Context, in *v1beta1.WorkloadGroup, opts v1.UpdateOptions) (*v1beta1.WorkloadGroup, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.istio.io", - Version: "v1beta1", - Kind: "WorkloadGroup", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1beta1.WorkloadGroup{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1WorkloadGroupImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/destinationrule/destinationrule.go b/pkg/client/istio/injection/informers/networking/v1beta1/destinationrule/destinationrule.go index 89ea0d1fe7..7e9bb75236 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/destinationrule/destinationrule.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/destinationrule/destinationrule.go @@ -21,15 +21,8 @@ package destinationrule import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" factory "knative.dev/net-istio/pkg/client/istio/injection/informers/factory" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1beta1.DestinationRuleInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1beta1.DestinationRuleInformer { } return untyped.(v1beta1.DestinationRuleInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - resourceVersion string -} - -var _ v1beta1.DestinationRuleInformer = (*wrapper)(nil) -var _ networkingv1beta1.DestinationRuleLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.DestinationRule{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.DestinationRuleLister { - return w -} - -func (w *wrapper) DestinationRules(namespace string) networkingv1beta1.DestinationRuleNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.DestinationRule, err error) { - lo, err := w.client.NetworkingV1beta1().DestinationRules(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.DestinationRule, error) { - return w.client.NetworkingV1beta1().DestinationRules(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/destinationrule/filtered/destinationrule.go b/pkg/client/istio/injection/informers/networking/v1beta1/destinationrule/filtered/destinationrule.go index 1b72a64eda..85d14341c1 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/destinationrule/filtered/destinationrule.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/destinationrule/filtered/destinationrule.go @@ -21,15 +21,8 @@ package filtered import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" filtered "knative.dev/net-istio/pkg/client/istio/injection/informers/factory/filtered" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterFilteredInformers(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -62,20 +54,6 @@ func withInformer(ctx context.Context) (context.Context, []controller.Informer) return ctx, infs } -func withDynamicInformer(ctx context.Context) context.Context { - untyped := ctx.Value(filtered.LabelKey{}) - if untyped == nil { - logging.FromContext(ctx).Panic( - "Unable to fetch labelkey from context.") - } - labelSelectors := untyped.([]string) - for _, selector := range labelSelectors { - inf := &wrapper{client: client.Get(ctx), selector: selector} - ctx = context.WithValue(ctx, Key{Selector: selector}, inf) - } - return ctx -} - // Get extracts the typed informer from the context. func Get(ctx context.Context, selector string) v1beta1.DestinationRuleInformer { untyped := ctx.Value(Key{Selector: selector}) @@ -85,52 +63,3 @@ func Get(ctx context.Context, selector string) v1beta1.DestinationRuleInformer { } return untyped.(v1beta1.DestinationRuleInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - selector string -} - -var _ v1beta1.DestinationRuleInformer = (*wrapper)(nil) -var _ networkingv1beta1.DestinationRuleLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.DestinationRule{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.DestinationRuleLister { - return w -} - -func (w *wrapper) DestinationRules(namespace string) networkingv1beta1.DestinationRuleNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, selector: w.selector} -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.DestinationRule, err error) { - reqs, err := labels.ParseToRequirements(w.selector) - if err != nil { - return nil, err - } - selector = selector.Add(reqs...) - lo, err := w.client.NetworkingV1beta1().DestinationRules(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.DestinationRule, error) { - // TODO(mattmoor): Check that the fetched object matches the selector. - return w.client.NetworkingV1beta1().DestinationRules(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/gateway/filtered/gateway.go b/pkg/client/istio/injection/informers/networking/v1beta1/gateway/filtered/gateway.go index 3f5bb13964..2e6f6adf54 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/gateway/filtered/gateway.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/gateway/filtered/gateway.go @@ -21,15 +21,8 @@ package filtered import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" filtered "knative.dev/net-istio/pkg/client/istio/injection/informers/factory/filtered" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterFilteredInformers(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -62,20 +54,6 @@ func withInformer(ctx context.Context) (context.Context, []controller.Informer) return ctx, infs } -func withDynamicInformer(ctx context.Context) context.Context { - untyped := ctx.Value(filtered.LabelKey{}) - if untyped == nil { - logging.FromContext(ctx).Panic( - "Unable to fetch labelkey from context.") - } - labelSelectors := untyped.([]string) - for _, selector := range labelSelectors { - inf := &wrapper{client: client.Get(ctx), selector: selector} - ctx = context.WithValue(ctx, Key{Selector: selector}, inf) - } - return ctx -} - // Get extracts the typed informer from the context. func Get(ctx context.Context, selector string) v1beta1.GatewayInformer { untyped := ctx.Value(Key{Selector: selector}) @@ -85,52 +63,3 @@ func Get(ctx context.Context, selector string) v1beta1.GatewayInformer { } return untyped.(v1beta1.GatewayInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - selector string -} - -var _ v1beta1.GatewayInformer = (*wrapper)(nil) -var _ networkingv1beta1.GatewayLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.Gateway{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.GatewayLister { - return w -} - -func (w *wrapper) Gateways(namespace string) networkingv1beta1.GatewayNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, selector: w.selector} -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.Gateway, err error) { - reqs, err := labels.ParseToRequirements(w.selector) - if err != nil { - return nil, err - } - selector = selector.Add(reqs...) - lo, err := w.client.NetworkingV1beta1().Gateways(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.Gateway, error) { - // TODO(mattmoor): Check that the fetched object matches the selector. - return w.client.NetworkingV1beta1().Gateways(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/gateway/gateway.go b/pkg/client/istio/injection/informers/networking/v1beta1/gateway/gateway.go index 4615902fa9..d1ab456a45 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/gateway/gateway.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/gateway/gateway.go @@ -21,15 +21,8 @@ package gateway import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" factory "knative.dev/net-istio/pkg/client/istio/injection/informers/factory" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1beta1.GatewayInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1beta1.GatewayInformer { } return untyped.(v1beta1.GatewayInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - resourceVersion string -} - -var _ v1beta1.GatewayInformer = (*wrapper)(nil) -var _ networkingv1beta1.GatewayLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.Gateway{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.GatewayLister { - return w -} - -func (w *wrapper) Gateways(namespace string) networkingv1beta1.GatewayNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.Gateway, err error) { - lo, err := w.client.NetworkingV1beta1().Gateways(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.Gateway, error) { - return w.client.NetworkingV1beta1().Gateways(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/proxyconfig/filtered/proxyconfig.go b/pkg/client/istio/injection/informers/networking/v1beta1/proxyconfig/filtered/proxyconfig.go index a90c95d82d..bf09709fd7 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/proxyconfig/filtered/proxyconfig.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/proxyconfig/filtered/proxyconfig.go @@ -21,15 +21,8 @@ package filtered import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" filtered "knative.dev/net-istio/pkg/client/istio/injection/informers/factory/filtered" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterFilteredInformers(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -62,20 +54,6 @@ func withInformer(ctx context.Context) (context.Context, []controller.Informer) return ctx, infs } -func withDynamicInformer(ctx context.Context) context.Context { - untyped := ctx.Value(filtered.LabelKey{}) - if untyped == nil { - logging.FromContext(ctx).Panic( - "Unable to fetch labelkey from context.") - } - labelSelectors := untyped.([]string) - for _, selector := range labelSelectors { - inf := &wrapper{client: client.Get(ctx), selector: selector} - ctx = context.WithValue(ctx, Key{Selector: selector}, inf) - } - return ctx -} - // Get extracts the typed informer from the context. func Get(ctx context.Context, selector string) v1beta1.ProxyConfigInformer { untyped := ctx.Value(Key{Selector: selector}) @@ -85,52 +63,3 @@ func Get(ctx context.Context, selector string) v1beta1.ProxyConfigInformer { } return untyped.(v1beta1.ProxyConfigInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - selector string -} - -var _ v1beta1.ProxyConfigInformer = (*wrapper)(nil) -var _ networkingv1beta1.ProxyConfigLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.ProxyConfig{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.ProxyConfigLister { - return w -} - -func (w *wrapper) ProxyConfigs(namespace string) networkingv1beta1.ProxyConfigNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, selector: w.selector} -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.ProxyConfig, err error) { - reqs, err := labels.ParseToRequirements(w.selector) - if err != nil { - return nil, err - } - selector = selector.Add(reqs...) - lo, err := w.client.NetworkingV1beta1().ProxyConfigs(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.ProxyConfig, error) { - // TODO(mattmoor): Check that the fetched object matches the selector. - return w.client.NetworkingV1beta1().ProxyConfigs(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/proxyconfig/proxyconfig.go b/pkg/client/istio/injection/informers/networking/v1beta1/proxyconfig/proxyconfig.go index 7c461f5ac1..efa46a7081 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/proxyconfig/proxyconfig.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/proxyconfig/proxyconfig.go @@ -21,15 +21,8 @@ package proxyconfig import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" factory "knative.dev/net-istio/pkg/client/istio/injection/informers/factory" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1beta1.ProxyConfigInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1beta1.ProxyConfigInformer { } return untyped.(v1beta1.ProxyConfigInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - resourceVersion string -} - -var _ v1beta1.ProxyConfigInformer = (*wrapper)(nil) -var _ networkingv1beta1.ProxyConfigLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.ProxyConfig{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.ProxyConfigLister { - return w -} - -func (w *wrapper) ProxyConfigs(namespace string) networkingv1beta1.ProxyConfigNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.ProxyConfig, err error) { - lo, err := w.client.NetworkingV1beta1().ProxyConfigs(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.ProxyConfig, error) { - return w.client.NetworkingV1beta1().ProxyConfigs(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/serviceentry/filtered/serviceentry.go b/pkg/client/istio/injection/informers/networking/v1beta1/serviceentry/filtered/serviceentry.go index 4c2d530c1c..4c1aa5f2be 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/serviceentry/filtered/serviceentry.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/serviceentry/filtered/serviceentry.go @@ -21,15 +21,8 @@ package filtered import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" filtered "knative.dev/net-istio/pkg/client/istio/injection/informers/factory/filtered" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterFilteredInformers(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -62,20 +54,6 @@ func withInformer(ctx context.Context) (context.Context, []controller.Informer) return ctx, infs } -func withDynamicInformer(ctx context.Context) context.Context { - untyped := ctx.Value(filtered.LabelKey{}) - if untyped == nil { - logging.FromContext(ctx).Panic( - "Unable to fetch labelkey from context.") - } - labelSelectors := untyped.([]string) - for _, selector := range labelSelectors { - inf := &wrapper{client: client.Get(ctx), selector: selector} - ctx = context.WithValue(ctx, Key{Selector: selector}, inf) - } - return ctx -} - // Get extracts the typed informer from the context. func Get(ctx context.Context, selector string) v1beta1.ServiceEntryInformer { untyped := ctx.Value(Key{Selector: selector}) @@ -85,52 +63,3 @@ func Get(ctx context.Context, selector string) v1beta1.ServiceEntryInformer { } return untyped.(v1beta1.ServiceEntryInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - selector string -} - -var _ v1beta1.ServiceEntryInformer = (*wrapper)(nil) -var _ networkingv1beta1.ServiceEntryLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.ServiceEntry{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.ServiceEntryLister { - return w -} - -func (w *wrapper) ServiceEntries(namespace string) networkingv1beta1.ServiceEntryNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, selector: w.selector} -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.ServiceEntry, err error) { - reqs, err := labels.ParseToRequirements(w.selector) - if err != nil { - return nil, err - } - selector = selector.Add(reqs...) - lo, err := w.client.NetworkingV1beta1().ServiceEntries(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.ServiceEntry, error) { - // TODO(mattmoor): Check that the fetched object matches the selector. - return w.client.NetworkingV1beta1().ServiceEntries(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/serviceentry/serviceentry.go b/pkg/client/istio/injection/informers/networking/v1beta1/serviceentry/serviceentry.go index fa8bfc2936..ac18dcf868 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/serviceentry/serviceentry.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/serviceentry/serviceentry.go @@ -21,15 +21,8 @@ package serviceentry import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" factory "knative.dev/net-istio/pkg/client/istio/injection/informers/factory" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1beta1.ServiceEntryInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1beta1.ServiceEntryInformer { } return untyped.(v1beta1.ServiceEntryInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - resourceVersion string -} - -var _ v1beta1.ServiceEntryInformer = (*wrapper)(nil) -var _ networkingv1beta1.ServiceEntryLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.ServiceEntry{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.ServiceEntryLister { - return w -} - -func (w *wrapper) ServiceEntries(namespace string) networkingv1beta1.ServiceEntryNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.ServiceEntry, err error) { - lo, err := w.client.NetworkingV1beta1().ServiceEntries(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.ServiceEntry, error) { - return w.client.NetworkingV1beta1().ServiceEntries(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/sidecar/filtered/sidecar.go b/pkg/client/istio/injection/informers/networking/v1beta1/sidecar/filtered/sidecar.go index 6f265d41f9..5b09beff3f 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/sidecar/filtered/sidecar.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/sidecar/filtered/sidecar.go @@ -21,15 +21,8 @@ package filtered import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" filtered "knative.dev/net-istio/pkg/client/istio/injection/informers/factory/filtered" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterFilteredInformers(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -62,20 +54,6 @@ func withInformer(ctx context.Context) (context.Context, []controller.Informer) return ctx, infs } -func withDynamicInformer(ctx context.Context) context.Context { - untyped := ctx.Value(filtered.LabelKey{}) - if untyped == nil { - logging.FromContext(ctx).Panic( - "Unable to fetch labelkey from context.") - } - labelSelectors := untyped.([]string) - for _, selector := range labelSelectors { - inf := &wrapper{client: client.Get(ctx), selector: selector} - ctx = context.WithValue(ctx, Key{Selector: selector}, inf) - } - return ctx -} - // Get extracts the typed informer from the context. func Get(ctx context.Context, selector string) v1beta1.SidecarInformer { untyped := ctx.Value(Key{Selector: selector}) @@ -85,52 +63,3 @@ func Get(ctx context.Context, selector string) v1beta1.SidecarInformer { } return untyped.(v1beta1.SidecarInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - selector string -} - -var _ v1beta1.SidecarInformer = (*wrapper)(nil) -var _ networkingv1beta1.SidecarLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.Sidecar{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.SidecarLister { - return w -} - -func (w *wrapper) Sidecars(namespace string) networkingv1beta1.SidecarNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, selector: w.selector} -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.Sidecar, err error) { - reqs, err := labels.ParseToRequirements(w.selector) - if err != nil { - return nil, err - } - selector = selector.Add(reqs...) - lo, err := w.client.NetworkingV1beta1().Sidecars(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.Sidecar, error) { - // TODO(mattmoor): Check that the fetched object matches the selector. - return w.client.NetworkingV1beta1().Sidecars(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/sidecar/sidecar.go b/pkg/client/istio/injection/informers/networking/v1beta1/sidecar/sidecar.go index 0cdb1240e9..805e6cf8af 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/sidecar/sidecar.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/sidecar/sidecar.go @@ -21,15 +21,8 @@ package sidecar import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" factory "knative.dev/net-istio/pkg/client/istio/injection/informers/factory" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1beta1.SidecarInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1beta1.SidecarInformer { } return untyped.(v1beta1.SidecarInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - resourceVersion string -} - -var _ v1beta1.SidecarInformer = (*wrapper)(nil) -var _ networkingv1beta1.SidecarLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.Sidecar{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.SidecarLister { - return w -} - -func (w *wrapper) Sidecars(namespace string) networkingv1beta1.SidecarNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.Sidecar, err error) { - lo, err := w.client.NetworkingV1beta1().Sidecars(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.Sidecar, error) { - return w.client.NetworkingV1beta1().Sidecars(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/virtualservice/filtered/virtualservice.go b/pkg/client/istio/injection/informers/networking/v1beta1/virtualservice/filtered/virtualservice.go index 0208d6ce1b..6a87eff0db 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/virtualservice/filtered/virtualservice.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/virtualservice/filtered/virtualservice.go @@ -21,15 +21,8 @@ package filtered import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" filtered "knative.dev/net-istio/pkg/client/istio/injection/informers/factory/filtered" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterFilteredInformers(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -62,20 +54,6 @@ func withInformer(ctx context.Context) (context.Context, []controller.Informer) return ctx, infs } -func withDynamicInformer(ctx context.Context) context.Context { - untyped := ctx.Value(filtered.LabelKey{}) - if untyped == nil { - logging.FromContext(ctx).Panic( - "Unable to fetch labelkey from context.") - } - labelSelectors := untyped.([]string) - for _, selector := range labelSelectors { - inf := &wrapper{client: client.Get(ctx), selector: selector} - ctx = context.WithValue(ctx, Key{Selector: selector}, inf) - } - return ctx -} - // Get extracts the typed informer from the context. func Get(ctx context.Context, selector string) v1beta1.VirtualServiceInformer { untyped := ctx.Value(Key{Selector: selector}) @@ -85,52 +63,3 @@ func Get(ctx context.Context, selector string) v1beta1.VirtualServiceInformer { } return untyped.(v1beta1.VirtualServiceInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - selector string -} - -var _ v1beta1.VirtualServiceInformer = (*wrapper)(nil) -var _ networkingv1beta1.VirtualServiceLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.VirtualService{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.VirtualServiceLister { - return w -} - -func (w *wrapper) VirtualServices(namespace string) networkingv1beta1.VirtualServiceNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, selector: w.selector} -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.VirtualService, err error) { - reqs, err := labels.ParseToRequirements(w.selector) - if err != nil { - return nil, err - } - selector = selector.Add(reqs...) - lo, err := w.client.NetworkingV1beta1().VirtualServices(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.VirtualService, error) { - // TODO(mattmoor): Check that the fetched object matches the selector. - return w.client.NetworkingV1beta1().VirtualServices(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/virtualservice/virtualservice.go b/pkg/client/istio/injection/informers/networking/v1beta1/virtualservice/virtualservice.go index c11af7f6e5..00db201dcd 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/virtualservice/virtualservice.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/virtualservice/virtualservice.go @@ -21,15 +21,8 @@ package virtualservice import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" factory "knative.dev/net-istio/pkg/client/istio/injection/informers/factory" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1beta1.VirtualServiceInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1beta1.VirtualServiceInformer { } return untyped.(v1beta1.VirtualServiceInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - resourceVersion string -} - -var _ v1beta1.VirtualServiceInformer = (*wrapper)(nil) -var _ networkingv1beta1.VirtualServiceLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.VirtualService{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.VirtualServiceLister { - return w -} - -func (w *wrapper) VirtualServices(namespace string) networkingv1beta1.VirtualServiceNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.VirtualService, err error) { - lo, err := w.client.NetworkingV1beta1().VirtualServices(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.VirtualService, error) { - return w.client.NetworkingV1beta1().VirtualServices(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/workloadentry/filtered/workloadentry.go b/pkg/client/istio/injection/informers/networking/v1beta1/workloadentry/filtered/workloadentry.go index 7ad4dc4452..1eaf0011e9 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/workloadentry/filtered/workloadentry.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/workloadentry/filtered/workloadentry.go @@ -21,15 +21,8 @@ package filtered import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" filtered "knative.dev/net-istio/pkg/client/istio/injection/informers/factory/filtered" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterFilteredInformers(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -62,20 +54,6 @@ func withInformer(ctx context.Context) (context.Context, []controller.Informer) return ctx, infs } -func withDynamicInformer(ctx context.Context) context.Context { - untyped := ctx.Value(filtered.LabelKey{}) - if untyped == nil { - logging.FromContext(ctx).Panic( - "Unable to fetch labelkey from context.") - } - labelSelectors := untyped.([]string) - for _, selector := range labelSelectors { - inf := &wrapper{client: client.Get(ctx), selector: selector} - ctx = context.WithValue(ctx, Key{Selector: selector}, inf) - } - return ctx -} - // Get extracts the typed informer from the context. func Get(ctx context.Context, selector string) v1beta1.WorkloadEntryInformer { untyped := ctx.Value(Key{Selector: selector}) @@ -85,52 +63,3 @@ func Get(ctx context.Context, selector string) v1beta1.WorkloadEntryInformer { } return untyped.(v1beta1.WorkloadEntryInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - selector string -} - -var _ v1beta1.WorkloadEntryInformer = (*wrapper)(nil) -var _ networkingv1beta1.WorkloadEntryLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.WorkloadEntry{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.WorkloadEntryLister { - return w -} - -func (w *wrapper) WorkloadEntries(namespace string) networkingv1beta1.WorkloadEntryNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, selector: w.selector} -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.WorkloadEntry, err error) { - reqs, err := labels.ParseToRequirements(w.selector) - if err != nil { - return nil, err - } - selector = selector.Add(reqs...) - lo, err := w.client.NetworkingV1beta1().WorkloadEntries(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.WorkloadEntry, error) { - // TODO(mattmoor): Check that the fetched object matches the selector. - return w.client.NetworkingV1beta1().WorkloadEntries(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/workloadentry/workloadentry.go b/pkg/client/istio/injection/informers/networking/v1beta1/workloadentry/workloadentry.go index 39ad6b79cf..16cddcc608 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/workloadentry/workloadentry.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/workloadentry/workloadentry.go @@ -21,15 +21,8 @@ package workloadentry import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" factory "knative.dev/net-istio/pkg/client/istio/injection/informers/factory" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1beta1.WorkloadEntryInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1beta1.WorkloadEntryInformer { } return untyped.(v1beta1.WorkloadEntryInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - resourceVersion string -} - -var _ v1beta1.WorkloadEntryInformer = (*wrapper)(nil) -var _ networkingv1beta1.WorkloadEntryLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.WorkloadEntry{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.WorkloadEntryLister { - return w -} - -func (w *wrapper) WorkloadEntries(namespace string) networkingv1beta1.WorkloadEntryNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.WorkloadEntry, err error) { - lo, err := w.client.NetworkingV1beta1().WorkloadEntries(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.WorkloadEntry, error) { - return w.client.NetworkingV1beta1().WorkloadEntries(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/workloadgroup/filtered/workloadgroup.go b/pkg/client/istio/injection/informers/networking/v1beta1/workloadgroup/filtered/workloadgroup.go index b6627cfc59..ec66d3e5f3 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/workloadgroup/filtered/workloadgroup.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/workloadgroup/filtered/workloadgroup.go @@ -21,15 +21,8 @@ package filtered import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" filtered "knative.dev/net-istio/pkg/client/istio/injection/informers/factory/filtered" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterFilteredInformers(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -62,20 +54,6 @@ func withInformer(ctx context.Context) (context.Context, []controller.Informer) return ctx, infs } -func withDynamicInformer(ctx context.Context) context.Context { - untyped := ctx.Value(filtered.LabelKey{}) - if untyped == nil { - logging.FromContext(ctx).Panic( - "Unable to fetch labelkey from context.") - } - labelSelectors := untyped.([]string) - for _, selector := range labelSelectors { - inf := &wrapper{client: client.Get(ctx), selector: selector} - ctx = context.WithValue(ctx, Key{Selector: selector}, inf) - } - return ctx -} - // Get extracts the typed informer from the context. func Get(ctx context.Context, selector string) v1beta1.WorkloadGroupInformer { untyped := ctx.Value(Key{Selector: selector}) @@ -85,52 +63,3 @@ func Get(ctx context.Context, selector string) v1beta1.WorkloadGroupInformer { } return untyped.(v1beta1.WorkloadGroupInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - selector string -} - -var _ v1beta1.WorkloadGroupInformer = (*wrapper)(nil) -var _ networkingv1beta1.WorkloadGroupLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.WorkloadGroup{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.WorkloadGroupLister { - return w -} - -func (w *wrapper) WorkloadGroups(namespace string) networkingv1beta1.WorkloadGroupNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, selector: w.selector} -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.WorkloadGroup, err error) { - reqs, err := labels.ParseToRequirements(w.selector) - if err != nil { - return nil, err - } - selector = selector.Add(reqs...) - lo, err := w.client.NetworkingV1beta1().WorkloadGroups(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.WorkloadGroup, error) { - // TODO(mattmoor): Check that the fetched object matches the selector. - return w.client.NetworkingV1beta1().WorkloadGroups(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) -} diff --git a/pkg/client/istio/injection/informers/networking/v1beta1/workloadgroup/workloadgroup.go b/pkg/client/istio/injection/informers/networking/v1beta1/workloadgroup/workloadgroup.go index c12abf8b2d..8dd5d14562 100644 --- a/pkg/client/istio/injection/informers/networking/v1beta1/workloadgroup/workloadgroup.go +++ b/pkg/client/istio/injection/informers/networking/v1beta1/workloadgroup/workloadgroup.go @@ -21,15 +21,8 @@ package workloadgroup import ( context "context" - apisnetworkingv1beta1 "istio.io/client-go/pkg/apis/networking/v1beta1" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - versioned "knative.dev/net-istio/pkg/client/istio/clientset/versioned" v1beta1 "knative.dev/net-istio/pkg/client/istio/informers/externalversions/networking/v1beta1" - client "knative.dev/net-istio/pkg/client/istio/injection/client" factory "knative.dev/net-istio/pkg/client/istio/injection/informers/factory" - networkingv1beta1 "knative.dev/net-istio/pkg/client/istio/listers/networking/v1beta1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1beta1.WorkloadGroupInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1beta1.WorkloadGroupInformer { } return untyped.(v1beta1.WorkloadGroupInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - resourceVersion string -} - -var _ v1beta1.WorkloadGroupInformer = (*wrapper)(nil) -var _ networkingv1beta1.WorkloadGroupLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1beta1.WorkloadGroup{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1beta1.WorkloadGroupLister { - return w -} - -func (w *wrapper) WorkloadGroups(namespace string) networkingv1beta1.WorkloadGroupNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1beta1.WorkloadGroup, err error) { - lo, err := w.client.NetworkingV1beta1().WorkloadGroups(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1beta1.WorkloadGroup, error) { - return w.client.NetworkingV1beta1().WorkloadGroups(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/vendor/golang.org/x/text/cases/cases.go b/vendor/golang.org/x/text/cases/cases.go deleted file mode 100644 index 752cdf0316..0000000000 --- a/vendor/golang.org/x/text/cases/cases.go +++ /dev/null @@ -1,162 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_trieval.go - -// Package cases provides general and language-specific case mappers. -package cases // import "golang.org/x/text/cases" - -import ( - "golang.org/x/text/language" - "golang.org/x/text/transform" -) - -// References: -// - Unicode Reference Manual Chapter 3.13, 4.2, and 5.18. -// - https://www.unicode.org/reports/tr29/ -// - https://www.unicode.org/Public/6.3.0/ucd/CaseFolding.txt -// - https://www.unicode.org/Public/6.3.0/ucd/SpecialCasing.txt -// - https://www.unicode.org/Public/6.3.0/ucd/DerivedCoreProperties.txt -// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakProperty.txt -// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakTest.txt -// - http://userguide.icu-project.org/transforms/casemappings - -// TODO: -// - Case folding -// - Wide and Narrow? -// - Segmenter option for title casing. -// - ASCII fast paths -// - Encode Soft-Dotted property within trie somehow. - -// A Caser transforms given input to a certain case. It implements -// transform.Transformer. -// -// A Caser may be stateful and should therefore not be shared between -// goroutines. -type Caser struct { - t transform.SpanningTransformer -} - -// Bytes returns a new byte slice with the result of converting b to the case -// form implemented by c. -func (c Caser) Bytes(b []byte) []byte { - b, _, _ = transform.Bytes(c.t, b) - return b -} - -// String returns a string with the result of transforming s to the case form -// implemented by c. -func (c Caser) String(s string) string { - s, _, _ = transform.String(c.t, s) - return s -} - -// Reset resets the Caser to be reused for new input after a previous call to -// Transform. -func (c Caser) Reset() { c.t.Reset() } - -// Transform implements the transform.Transformer interface and transforms the -// given input to the case form implemented by c. -func (c Caser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - return c.t.Transform(dst, src, atEOF) -} - -// Span implements the transform.SpanningTransformer interface. -func (c Caser) Span(src []byte, atEOF bool) (n int, err error) { - return c.t.Span(src, atEOF) -} - -// Upper returns a Caser for language-specific uppercasing. -func Upper(t language.Tag, opts ...Option) Caser { - return Caser{makeUpper(t, getOpts(opts...))} -} - -// Lower returns a Caser for language-specific lowercasing. -func Lower(t language.Tag, opts ...Option) Caser { - return Caser{makeLower(t, getOpts(opts...))} -} - -// Title returns a Caser for language-specific title casing. It uses an -// approximation of the default Unicode Word Break algorithm. -func Title(t language.Tag, opts ...Option) Caser { - return Caser{makeTitle(t, getOpts(opts...))} -} - -// Fold returns a Caser that implements Unicode case folding. The returned Caser -// is stateless and safe to use concurrently by multiple goroutines. -// -// Case folding does not normalize the input and may not preserve a normal form. -// Use the collate or search package for more convenient and linguistically -// sound comparisons. Use golang.org/x/text/secure/precis for string comparisons -// where security aspects are a concern. -func Fold(opts ...Option) Caser { - return Caser{makeFold(getOpts(opts...))} -} - -// An Option is used to modify the behavior of a Caser. -type Option func(o options) options - -// TODO: consider these options to take a boolean as well, like FinalSigma. -// The advantage of using this approach is that other providers of a lower-case -// algorithm could set different defaults by prefixing a user-provided slice -// of options with their own. This is handy, for instance, for the precis -// package which would override the default to not handle the Greek final sigma. - -var ( - // NoLower disables the lowercasing of non-leading letters for a title - // caser. - NoLower Option = noLower - - // Compact omits mappings in case folding for characters that would grow the - // input. (Unimplemented.) - Compact Option = compact -) - -// TODO: option to preserve a normal form, if applicable? - -type options struct { - noLower bool - simple bool - - // TODO: segmenter, max ignorable, alternative versions, etc. - - ignoreFinalSigma bool -} - -func getOpts(o ...Option) (res options) { - for _, f := range o { - res = f(res) - } - return -} - -func noLower(o options) options { - o.noLower = true - return o -} - -func compact(o options) options { - o.simple = true - return o -} - -// HandleFinalSigma specifies whether the special handling of Greek final sigma -// should be enabled. Unicode prescribes handling the Greek final sigma for all -// locales, but standards like IDNA and PRECIS override this default. -func HandleFinalSigma(enable bool) Option { - if enable { - return handleFinalSigma - } - return ignoreFinalSigma -} - -func ignoreFinalSigma(o options) options { - o.ignoreFinalSigma = true - return o -} - -func handleFinalSigma(o options) options { - o.ignoreFinalSigma = false - return o -} diff --git a/vendor/golang.org/x/text/cases/context.go b/vendor/golang.org/x/text/cases/context.go deleted file mode 100644 index e9aa9e1936..0000000000 --- a/vendor/golang.org/x/text/cases/context.go +++ /dev/null @@ -1,376 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package cases - -import "golang.org/x/text/transform" - -// A context is used for iterating over source bytes, fetching case info and -// writing to a destination buffer. -// -// Casing operations may need more than one rune of context to decide how a rune -// should be cased. Casing implementations should call checkpoint on context -// whenever it is known to be safe to return the runes processed so far. -// -// It is recommended for implementations to not allow for more than 30 case -// ignorables as lookahead (analogous to the limit in norm) and to use state if -// unbounded lookahead is needed for cased runes. -type context struct { - dst, src []byte - atEOF bool - - pDst int // pDst points past the last written rune in dst. - pSrc int // pSrc points to the start of the currently scanned rune. - - // checkpoints safe to return in Transform, where nDst <= pDst and nSrc <= pSrc. - nDst, nSrc int - err error - - sz int // size of current rune - info info // case information of currently scanned rune - - // State preserved across calls to Transform. - isMidWord bool // false if next cased letter needs to be title-cased. -} - -func (c *context) Reset() { - c.isMidWord = false -} - -// ret returns the return values for the Transform method. It checks whether -// there were insufficient bytes in src to complete and introduces an error -// accordingly, if necessary. -func (c *context) ret() (nDst, nSrc int, err error) { - if c.err != nil || c.nSrc == len(c.src) { - return c.nDst, c.nSrc, c.err - } - // This point is only reached by mappers if there was no short destination - // buffer. This means that the source buffer was exhausted and that c.sz was - // set to 0 by next. - if c.atEOF && c.pSrc == len(c.src) { - return c.pDst, c.pSrc, nil - } - return c.nDst, c.nSrc, transform.ErrShortSrc -} - -// retSpan returns the return values for the Span method. It checks whether -// there were insufficient bytes in src to complete and introduces an error -// accordingly, if necessary. -func (c *context) retSpan() (n int, err error) { - _, nSrc, err := c.ret() - return nSrc, err -} - -// checkpoint sets the return value buffer points for Transform to the current -// positions. -func (c *context) checkpoint() { - if c.err == nil { - c.nDst, c.nSrc = c.pDst, c.pSrc+c.sz - } -} - -// unreadRune causes the last rune read by next to be reread on the next -// invocation of next. Only one unreadRune may be called after a call to next. -func (c *context) unreadRune() { - c.sz = 0 -} - -func (c *context) next() bool { - c.pSrc += c.sz - if c.pSrc == len(c.src) || c.err != nil { - c.info, c.sz = 0, 0 - return false - } - v, sz := trie.lookup(c.src[c.pSrc:]) - c.info, c.sz = info(v), sz - if c.sz == 0 { - if c.atEOF { - // A zero size means we have an incomplete rune. If we are atEOF, - // this means it is an illegal rune, which we will consume one - // byte at a time. - c.sz = 1 - } else { - c.err = transform.ErrShortSrc - return false - } - } - return true -} - -// writeBytes adds bytes to dst. -func (c *context) writeBytes(b []byte) bool { - if len(c.dst)-c.pDst < len(b) { - c.err = transform.ErrShortDst - return false - } - // This loop is faster than using copy. - for _, ch := range b { - c.dst[c.pDst] = ch - c.pDst++ - } - return true -} - -// writeString writes the given string to dst. -func (c *context) writeString(s string) bool { - if len(c.dst)-c.pDst < len(s) { - c.err = transform.ErrShortDst - return false - } - // This loop is faster than using copy. - for i := 0; i < len(s); i++ { - c.dst[c.pDst] = s[i] - c.pDst++ - } - return true -} - -// copy writes the current rune to dst. -func (c *context) copy() bool { - return c.writeBytes(c.src[c.pSrc : c.pSrc+c.sz]) -} - -// copyXOR copies the current rune to dst and modifies it by applying the XOR -// pattern of the case info. It is the responsibility of the caller to ensure -// that this is a rune with a XOR pattern defined. -func (c *context) copyXOR() bool { - if !c.copy() { - return false - } - if c.info&xorIndexBit == 0 { - // Fast path for 6-bit XOR pattern, which covers most cases. - c.dst[c.pDst-1] ^= byte(c.info >> xorShift) - } else { - // Interpret XOR bits as an index. - // TODO: test performance for unrolling this loop. Verify that we have - // at least two bytes and at most three. - idx := c.info >> xorShift - for p := c.pDst - 1; ; p-- { - c.dst[p] ^= xorData[idx] - idx-- - if xorData[idx] == 0 { - break - } - } - } - return true -} - -// hasPrefix returns true if src[pSrc:] starts with the given string. -func (c *context) hasPrefix(s string) bool { - b := c.src[c.pSrc:] - if len(b) < len(s) { - return false - } - for i, c := range b[:len(s)] { - if c != s[i] { - return false - } - } - return true -} - -// caseType returns an info with only the case bits, normalized to either -// cLower, cUpper, cTitle or cUncased. -func (c *context) caseType() info { - cm := c.info & 0x7 - if cm < 4 { - return cm - } - if cm >= cXORCase { - // xor the last bit of the rune with the case type bits. - b := c.src[c.pSrc+c.sz-1] - return info(b&1) ^ cm&0x3 - } - if cm == cIgnorableCased { - return cLower - } - return cUncased -} - -// lower writes the lowercase version of the current rune to dst. -func lower(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cLower { - return c.copy() - } - if c.info&exceptionBit == 0 { - return c.copyXOR() - } - e := exceptions[c.info>>exceptionShift:] - offset := 2 + e[0]&lengthMask // size of header + fold string - if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { - return c.writeString(e[offset : offset+nLower]) - } - return c.copy() -} - -func isLower(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cLower { - return true - } - if c.info&exceptionBit == 0 { - c.err = transform.ErrEndOfSpan - return false - } - e := exceptions[c.info>>exceptionShift:] - if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { - c.err = transform.ErrEndOfSpan - return false - } - return true -} - -// upper writes the uppercase version of the current rune to dst. -func upper(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cUpper { - return c.copy() - } - if c.info&exceptionBit == 0 { - return c.copyXOR() - } - e := exceptions[c.info>>exceptionShift:] - offset := 2 + e[0]&lengthMask // size of header + fold string - // Get length of first special case mapping. - n := (e[1] >> lengthBits) & lengthMask - if ct == cTitle { - // The first special case mapping is for lower. Set n to the second. - if n == noChange { - n = 0 - } - n, e = e[1]&lengthMask, e[n:] - } - if n != noChange { - return c.writeString(e[offset : offset+n]) - } - return c.copy() -} - -// isUpper writes the isUppercase version of the current rune to dst. -func isUpper(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cUpper { - return true - } - if c.info&exceptionBit == 0 { - c.err = transform.ErrEndOfSpan - return false - } - e := exceptions[c.info>>exceptionShift:] - // Get length of first special case mapping. - n := (e[1] >> lengthBits) & lengthMask - if ct == cTitle { - n = e[1] & lengthMask - } - if n != noChange { - c.err = transform.ErrEndOfSpan - return false - } - return true -} - -// title writes the title case version of the current rune to dst. -func title(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cTitle { - return c.copy() - } - if c.info&exceptionBit == 0 { - if ct == cLower { - return c.copyXOR() - } - return c.copy() - } - // Get the exception data. - e := exceptions[c.info>>exceptionShift:] - offset := 2 + e[0]&lengthMask // size of header + fold string - - nFirst := (e[1] >> lengthBits) & lengthMask - if nTitle := e[1] & lengthMask; nTitle != noChange { - if nFirst != noChange { - e = e[nFirst:] - } - return c.writeString(e[offset : offset+nTitle]) - } - if ct == cLower && nFirst != noChange { - // Use the uppercase version instead. - return c.writeString(e[offset : offset+nFirst]) - } - // Already in correct case. - return c.copy() -} - -// isTitle reports whether the current rune is in title case. -func isTitle(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cTitle { - return true - } - if c.info&exceptionBit == 0 { - if ct == cLower { - c.err = transform.ErrEndOfSpan - return false - } - return true - } - // Get the exception data. - e := exceptions[c.info>>exceptionShift:] - if nTitle := e[1] & lengthMask; nTitle != noChange { - c.err = transform.ErrEndOfSpan - return false - } - nFirst := (e[1] >> lengthBits) & lengthMask - if ct == cLower && nFirst != noChange { - c.err = transform.ErrEndOfSpan - return false - } - return true -} - -// foldFull writes the foldFull version of the current rune to dst. -func foldFull(c *context) bool { - if c.info&hasMappingMask == 0 { - return c.copy() - } - ct := c.caseType() - if c.info&exceptionBit == 0 { - if ct != cLower || c.info&inverseFoldBit != 0 { - return c.copyXOR() - } - return c.copy() - } - e := exceptions[c.info>>exceptionShift:] - n := e[0] & lengthMask - if n == 0 { - if ct == cLower { - return c.copy() - } - n = (e[1] >> lengthBits) & lengthMask - } - return c.writeString(e[2 : 2+n]) -} - -// isFoldFull reports whether the current run is mapped to foldFull -func isFoldFull(c *context) bool { - if c.info&hasMappingMask == 0 { - return true - } - ct := c.caseType() - if c.info&exceptionBit == 0 { - if ct != cLower || c.info&inverseFoldBit != 0 { - c.err = transform.ErrEndOfSpan - return false - } - return true - } - e := exceptions[c.info>>exceptionShift:] - n := e[0] & lengthMask - if n == 0 && ct == cLower { - return true - } - c.err = transform.ErrEndOfSpan - return false -} diff --git a/vendor/golang.org/x/text/cases/fold.go b/vendor/golang.org/x/text/cases/fold.go deleted file mode 100644 index 85cc434fac..0000000000 --- a/vendor/golang.org/x/text/cases/fold.go +++ /dev/null @@ -1,34 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package cases - -import "golang.org/x/text/transform" - -type caseFolder struct{ transform.NopResetter } - -// caseFolder implements the Transformer interface for doing case folding. -func (t *caseFolder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - for c.next() { - foldFull(&c) - c.checkpoint() - } - return c.ret() -} - -func (t *caseFolder) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && isFoldFull(&c) { - c.checkpoint() - } - return c.retSpan() -} - -func makeFold(o options) transform.SpanningTransformer { - // TODO: Special case folding, through option Language, Special/Turkic, or - // both. - // TODO: Implement Compact options. - return &caseFolder{} -} diff --git a/vendor/golang.org/x/text/cases/icu.go b/vendor/golang.org/x/text/cases/icu.go deleted file mode 100644 index 2dc84b39ef..0000000000 --- a/vendor/golang.org/x/text/cases/icu.go +++ /dev/null @@ -1,62 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build icu -// +build icu - -package cases - -// Ideally these functions would be defined in a test file, but go test doesn't -// allow CGO in tests. The build tag should ensure either way that these -// functions will not end up in the package. - -// TODO: Ensure that the correct ICU version is set. - -/* -#cgo LDFLAGS: -licui18n.57 -licuuc.57 -#include -#include -#include -#include -#include -*/ -import "C" - -import "unsafe" - -func doICU(tag, caser, input string) string { - err := C.UErrorCode(0) - loc := C.CString(tag) - cm := C.ucasemap_open(loc, C.uint32_t(0), &err) - - buf := make([]byte, len(input)*4) - dst := (*C.char)(unsafe.Pointer(&buf[0])) - src := C.CString(input) - - cn := C.int32_t(0) - - switch caser { - case "fold": - cn = C.ucasemap_utf8FoldCase(cm, - dst, C.int32_t(len(buf)), - src, C.int32_t(len(input)), - &err) - case "lower": - cn = C.ucasemap_utf8ToLower(cm, - dst, C.int32_t(len(buf)), - src, C.int32_t(len(input)), - &err) - case "upper": - cn = C.ucasemap_utf8ToUpper(cm, - dst, C.int32_t(len(buf)), - src, C.int32_t(len(input)), - &err) - case "title": - cn = C.ucasemap_utf8ToTitle(cm, - dst, C.int32_t(len(buf)), - src, C.int32_t(len(input)), - &err) - } - return string(buf[:cn]) -} diff --git a/vendor/golang.org/x/text/cases/info.go b/vendor/golang.org/x/text/cases/info.go deleted file mode 100644 index 87a7c3e955..0000000000 --- a/vendor/golang.org/x/text/cases/info.go +++ /dev/null @@ -1,82 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package cases - -func (c info) cccVal() info { - if c&exceptionBit != 0 { - return info(exceptions[c>>exceptionShift]) & cccMask - } - return c & cccMask -} - -func (c info) cccType() info { - ccc := c.cccVal() - if ccc <= cccZero { - return cccZero - } - return ccc -} - -// TODO: Implement full Unicode breaking algorithm: -// 1) Implement breaking in separate package. -// 2) Use the breaker here. -// 3) Compare table size and performance of using the more generic breaker. -// -// Note that we can extend the current algorithm to be much more accurate. This -// only makes sense, though, if the performance and/or space penalty of using -// the generic breaker is big. Extra data will only be needed for non-cased -// runes, which means there are sufficient bits left in the caseType. -// ICU prohibits breaking in such cases as well. - -// For the purpose of title casing we use an approximation of the Unicode Word -// Breaking algorithm defined in Annex #29: -// https://www.unicode.org/reports/tr29/#Default_Grapheme_Cluster_Table. -// -// For our approximation, we group the Word Break types into the following -// categories, with associated rules: -// -// 1) Letter: -// ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend, Format_FE, ZWJ. -// Rule: Never break between consecutive runes of this category. -// -// 2) Mid: -// MidLetter, MidNumLet, Single_Quote. -// (Cf. case-ignorable: MidLetter, MidNumLet, Single_Quote or cat is Mn, -// Me, Cf, Lm or Sk). -// Rule: Don't break between Letter and Mid, but break between two Mids. -// -// 3) Break: -// Any other category: NewLine, MidNum, CR, LF, Double_Quote, Katakana, and -// Other. -// These categories should always result in a break between two cased letters. -// Rule: Always break. -// -// Note 1: the Katakana and MidNum categories can, in esoteric cases, result in -// preventing a break between two cased letters. For now we will ignore this -// (e.g. [ALetter] [ExtendNumLet] [Katakana] [ExtendNumLet] [ALetter] and -// [ALetter] [Numeric] [MidNum] [Numeric] [ALetter].) -// -// Note 2: the rule for Mid is very approximate, but works in most cases. To -// improve, we could store the categories in the trie value and use a FA to -// manage breaks. See TODO comment above. -// -// Note 3: according to the spec, it is possible for the Extend category to -// introduce breaks between other categories grouped in Letter. However, this -// is undesirable for our purposes. ICU prevents breaks in such cases as well. - -// isBreak returns whether this rune should introduce a break. -func (c info) isBreak() bool { - return c.cccVal() == cccBreak -} - -// isLetter returns whether the rune is of break type ALetter, Hebrew_Letter, -// Numeric, ExtendNumLet, or Extend. -func (c info) isLetter() bool { - ccc := c.cccVal() - if ccc == cccZero { - return !c.isCaseIgnorable() - } - return ccc != cccBreak -} diff --git a/vendor/golang.org/x/text/cases/map.go b/vendor/golang.org/x/text/cases/map.go deleted file mode 100644 index 0f7c6a14bb..0000000000 --- a/vendor/golang.org/x/text/cases/map.go +++ /dev/null @@ -1,816 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package cases - -// This file contains the definitions of case mappings for all supported -// languages. The rules for the language-specific tailorings were taken and -// modified from the CLDR transform definitions in common/transforms. - -import ( - "strings" - "unicode" - "unicode/utf8" - - "golang.org/x/text/internal" - "golang.org/x/text/language" - "golang.org/x/text/transform" - "golang.org/x/text/unicode/norm" -) - -// A mapFunc takes a context set to the current rune and writes the mapped -// version to the same context. It may advance the context to the next rune. It -// returns whether a checkpoint is possible: whether the pDst bytes written to -// dst so far won't need changing as we see more source bytes. -type mapFunc func(*context) bool - -// A spanFunc takes a context set to the current rune and returns whether this -// rune would be altered when written to the output. It may advance the context -// to the next rune. It returns whether a checkpoint is possible. -type spanFunc func(*context) bool - -// maxIgnorable defines the maximum number of ignorables to consider for -// lookahead operations. -const maxIgnorable = 30 - -// supported lists the language tags for which we have tailorings. -const supported = "und af az el lt nl tr" - -func init() { - tags := []language.Tag{} - for _, s := range strings.Split(supported, " ") { - tags = append(tags, language.MustParse(s)) - } - matcher = internal.NewInheritanceMatcher(tags) - Supported = language.NewCoverage(tags) -} - -var ( - matcher *internal.InheritanceMatcher - - Supported language.Coverage - - // We keep the following lists separate, instead of having a single per- - // language struct, to give the compiler a chance to remove unused code. - - // Some uppercase mappers are stateless, so we can precompute the - // Transformers and save a bit on runtime allocations. - upperFunc = []struct { - upper mapFunc - span spanFunc - }{ - {nil, nil}, // und - {nil, nil}, // af - {aztrUpper(upper), isUpper}, // az - {elUpper, noSpan}, // el - {ltUpper(upper), noSpan}, // lt - {nil, nil}, // nl - {aztrUpper(upper), isUpper}, // tr - } - - undUpper transform.SpanningTransformer = &undUpperCaser{} - undLower transform.SpanningTransformer = &undLowerCaser{} - undLowerIgnoreSigma transform.SpanningTransformer = &undLowerIgnoreSigmaCaser{} - - lowerFunc = []mapFunc{ - nil, // und - nil, // af - aztrLower, // az - nil, // el - ltLower, // lt - nil, // nl - aztrLower, // tr - } - - titleInfos = []struct { - title mapFunc - lower mapFunc - titleSpan spanFunc - rewrite func(*context) - }{ - {title, lower, isTitle, nil}, // und - {title, lower, isTitle, afnlRewrite}, // af - {aztrUpper(title), aztrLower, isTitle, nil}, // az - {title, lower, isTitle, nil}, // el - {ltUpper(title), ltLower, noSpan, nil}, // lt - {nlTitle, lower, nlTitleSpan, afnlRewrite}, // nl - {aztrUpper(title), aztrLower, isTitle, nil}, // tr - } -) - -func makeUpper(t language.Tag, o options) transform.SpanningTransformer { - _, i, _ := matcher.Match(t) - f := upperFunc[i].upper - if f == nil { - return undUpper - } - return &simpleCaser{f: f, span: upperFunc[i].span} -} - -func makeLower(t language.Tag, o options) transform.SpanningTransformer { - _, i, _ := matcher.Match(t) - f := lowerFunc[i] - if f == nil { - if o.ignoreFinalSigma { - return undLowerIgnoreSigma - } - return undLower - } - if o.ignoreFinalSigma { - return &simpleCaser{f: f, span: isLower} - } - return &lowerCaser{ - first: f, - midWord: finalSigma(f), - } -} - -func makeTitle(t language.Tag, o options) transform.SpanningTransformer { - _, i, _ := matcher.Match(t) - x := &titleInfos[i] - lower := x.lower - if o.noLower { - lower = (*context).copy - } else if !o.ignoreFinalSigma { - lower = finalSigma(lower) - } - return &titleCaser{ - title: x.title, - lower: lower, - titleSpan: x.titleSpan, - rewrite: x.rewrite, - } -} - -func noSpan(c *context) bool { - c.err = transform.ErrEndOfSpan - return false -} - -// TODO: consider a similar special case for the fast majority lower case. This -// is a bit more involved so will require some more precise benchmarking to -// justify it. - -type undUpperCaser struct{ transform.NopResetter } - -// undUpperCaser implements the Transformer interface for doing an upper case -// mapping for the root locale (und). It eliminates the need for an allocation -// as it prevents escaping by not using function pointers. -func (t undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - for c.next() { - upper(&c) - c.checkpoint() - } - return c.ret() -} - -func (t undUpperCaser) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && isUpper(&c) { - c.checkpoint() - } - return c.retSpan() -} - -// undLowerIgnoreSigmaCaser implements the Transformer interface for doing -// a lower case mapping for the root locale (und) ignoring final sigma -// handling. This casing algorithm is used in some performance-critical packages -// like secure/precis and x/net/http/idna, which warrants its special-casing. -type undLowerIgnoreSigmaCaser struct{ transform.NopResetter } - -func (t undLowerIgnoreSigmaCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - for c.next() && lower(&c) { - c.checkpoint() - } - return c.ret() - -} - -// Span implements a generic lower-casing. This is possible as isLower works -// for all lowercasing variants. All lowercase variants only vary in how they -// transform a non-lowercase letter. They will never change an already lowercase -// letter. In addition, there is no state. -func (t undLowerIgnoreSigmaCaser) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && isLower(&c) { - c.checkpoint() - } - return c.retSpan() -} - -type simpleCaser struct { - context - f mapFunc - span spanFunc -} - -// simpleCaser implements the Transformer interface for doing a case operation -// on a rune-by-rune basis. -func (t *simpleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - for c.next() && t.f(&c) { - c.checkpoint() - } - return c.ret() -} - -func (t *simpleCaser) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && t.span(&c) { - c.checkpoint() - } - return c.retSpan() -} - -// undLowerCaser implements the Transformer interface for doing a lower case -// mapping for the root locale (und) ignoring final sigma handling. This casing -// algorithm is used in some performance-critical packages like secure/precis -// and x/net/http/idna, which warrants its special-casing. -type undLowerCaser struct{ transform.NopResetter } - -func (t undLowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - - for isInterWord := true; c.next(); { - if isInterWord { - if c.info.isCased() { - if !lower(&c) { - break - } - isInterWord = false - } else if !c.copy() { - break - } - } else { - if c.info.isNotCasedAndNotCaseIgnorable() { - if !c.copy() { - break - } - isInterWord = true - } else if !c.hasPrefix("Σ") { - if !lower(&c) { - break - } - } else if !finalSigmaBody(&c) { - break - } - } - c.checkpoint() - } - return c.ret() -} - -func (t undLowerCaser) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && isLower(&c) { - c.checkpoint() - } - return c.retSpan() -} - -// lowerCaser implements the Transformer interface. The default Unicode lower -// casing requires different treatment for the first and subsequent characters -// of a word, most notably to handle the Greek final Sigma. -type lowerCaser struct { - undLowerIgnoreSigmaCaser - - context - - first, midWord mapFunc -} - -func (t *lowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - t.context = context{dst: dst, src: src, atEOF: atEOF} - c := &t.context - - for isInterWord := true; c.next(); { - if isInterWord { - if c.info.isCased() { - if !t.first(c) { - break - } - isInterWord = false - } else if !c.copy() { - break - } - } else { - if c.info.isNotCasedAndNotCaseIgnorable() { - if !c.copy() { - break - } - isInterWord = true - } else if !t.midWord(c) { - break - } - } - c.checkpoint() - } - return c.ret() -} - -// titleCaser implements the Transformer interface. Title casing algorithms -// distinguish between the first letter of a word and subsequent letters of the -// same word. It uses state to avoid requiring a potentially infinite lookahead. -type titleCaser struct { - context - - // rune mappings used by the actual casing algorithms. - title mapFunc - lower mapFunc - titleSpan spanFunc - - rewrite func(*context) -} - -// Transform implements the standard Unicode title case algorithm as defined in -// Chapter 3 of The Unicode Standard: -// toTitlecase(X): Find the word boundaries in X according to Unicode Standard -// Annex #29, "Unicode Text Segmentation." For each word boundary, find the -// first cased character F following the word boundary. If F exists, map F to -// Titlecase_Mapping(F); then map all characters C between F and the following -// word boundary to Lowercase_Mapping(C). -func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - t.context = context{dst: dst, src: src, atEOF: atEOF, isMidWord: t.isMidWord} - c := &t.context - - if !c.next() { - return c.ret() - } - - for { - p := c.info - if t.rewrite != nil { - t.rewrite(c) - } - - wasMid := p.isMid() - // Break out of this loop on failure to ensure we do not modify the - // state incorrectly. - if p.isCased() { - if !c.isMidWord { - if !t.title(c) { - break - } - c.isMidWord = true - } else if !t.lower(c) { - break - } - } else if !c.copy() { - break - } else if p.isBreak() { - c.isMidWord = false - } - - // As we save the state of the transformer, it is safe to call - // checkpoint after any successful write. - if !(c.isMidWord && wasMid) { - c.checkpoint() - } - - if !c.next() { - break - } - if wasMid && c.info.isMid() { - c.isMidWord = false - } - } - return c.ret() -} - -func (t *titleCaser) Span(src []byte, atEOF bool) (n int, err error) { - t.context = context{src: src, atEOF: atEOF, isMidWord: t.isMidWord} - c := &t.context - - if !c.next() { - return c.retSpan() - } - - for { - p := c.info - if t.rewrite != nil { - t.rewrite(c) - } - - wasMid := p.isMid() - // Break out of this loop on failure to ensure we do not modify the - // state incorrectly. - if p.isCased() { - if !c.isMidWord { - if !t.titleSpan(c) { - break - } - c.isMidWord = true - } else if !isLower(c) { - break - } - } else if p.isBreak() { - c.isMidWord = false - } - // As we save the state of the transformer, it is safe to call - // checkpoint after any successful write. - if !(c.isMidWord && wasMid) { - c.checkpoint() - } - - if !c.next() { - break - } - if wasMid && c.info.isMid() { - c.isMidWord = false - } - } - return c.retSpan() -} - -// finalSigma adds Greek final Sigma handing to another casing function. It -// determines whether a lowercased sigma should be σ or ς, by looking ahead for -// case-ignorables and a cased letters. -func finalSigma(f mapFunc) mapFunc { - return func(c *context) bool { - if !c.hasPrefix("Σ") { - return f(c) - } - return finalSigmaBody(c) - } -} - -func finalSigmaBody(c *context) bool { - // Current rune must be ∑. - - // ::NFD(); - // # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA - // Σ } [:case-ignorable:]* [:cased:] → σ; - // [:cased:] [:case-ignorable:]* { Σ → ς; - // ::Any-Lower; - // ::NFC(); - - p := c.pDst - c.writeString("ς") - - // TODO: we should do this here, but right now this will never have an - // effect as this is called when the prefix is Sigma, whereas Dutch and - // Afrikaans only test for an apostrophe. - // - // if t.rewrite != nil { - // t.rewrite(c) - // } - - // We need to do one more iteration after maxIgnorable, as a cased - // letter is not an ignorable and may modify the result. - wasMid := false - for i := 0; i < maxIgnorable+1; i++ { - if !c.next() { - return false - } - if !c.info.isCaseIgnorable() { - // All Midword runes are also case ignorable, so we are - // guaranteed to have a letter or word break here. As we are - // unreading the run, there is no need to unset c.isMidWord; - // the title caser will handle this. - if c.info.isCased() { - // p+1 is guaranteed to be in bounds: if writing ς was - // successful, p+1 will contain the second byte of ς. If not, - // this function will have returned after c.next returned false. - c.dst[p+1]++ // ς → σ - } - c.unreadRune() - return true - } - // A case ignorable may also introduce a word break, so we may need - // to continue searching even after detecting a break. - isMid := c.info.isMid() - if (wasMid && isMid) || c.info.isBreak() { - c.isMidWord = false - } - wasMid = isMid - c.copy() - } - return true -} - -// finalSigmaSpan would be the same as isLower. - -// elUpper implements Greek upper casing, which entails removing a predefined -// set of non-blocked modifiers. Note that these accents should not be removed -// for title casing! -// Example: "Οδός" -> "ΟΔΟΣ". -func elUpper(c *context) bool { - // From CLDR: - // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Above:]]*? { [\u0313\u0314\u0301\u0300\u0306\u0342\u0308\u0304] → ; - // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Iota_Subscript:]]*? { \u0345 → ; - - r, _ := utf8.DecodeRune(c.src[c.pSrc:]) - oldPDst := c.pDst - if !upper(c) { - return false - } - if !unicode.Is(unicode.Greek, r) { - return true - } - i := 0 - // Take the properties of the uppercased rune that is already written to the - // destination. This saves us the trouble of having to uppercase the - // decomposed rune again. - if b := norm.NFD.Properties(c.dst[oldPDst:]).Decomposition(); b != nil { - // Restore the destination position and process the decomposed rune. - r, sz := utf8.DecodeRune(b) - if r <= 0xFF { // See A.6.1 - return true - } - c.pDst = oldPDst - // Insert the first rune and ignore the modifiers. See A.6.2. - c.writeBytes(b[:sz]) - i = len(b[sz:]) / 2 // Greek modifiers are always of length 2. - } - - for ; i < maxIgnorable && c.next(); i++ { - switch r, _ := utf8.DecodeRune(c.src[c.pSrc:]); r { - // Above and Iota Subscript - case 0x0300, // U+0300 COMBINING GRAVE ACCENT - 0x0301, // U+0301 COMBINING ACUTE ACCENT - 0x0304, // U+0304 COMBINING MACRON - 0x0306, // U+0306 COMBINING BREVE - 0x0308, // U+0308 COMBINING DIAERESIS - 0x0313, // U+0313 COMBINING COMMA ABOVE - 0x0314, // U+0314 COMBINING REVERSED COMMA ABOVE - 0x0342, // U+0342 COMBINING GREEK PERISPOMENI - 0x0345: // U+0345 COMBINING GREEK YPOGEGRAMMENI - // No-op. Gobble the modifier. - - default: - switch v, _ := trie.lookup(c.src[c.pSrc:]); info(v).cccType() { - case cccZero: - c.unreadRune() - return true - - // We don't need to test for IotaSubscript as the only rune that - // qualifies (U+0345) was already excluded in the switch statement - // above. See A.4. - - case cccAbove: - return c.copy() - default: - // Some other modifier. We're still allowed to gobble Greek - // modifiers after this. - c.copy() - } - } - } - return i == maxIgnorable -} - -// TODO: implement elUpperSpan (low-priority: complex and infrequent). - -func ltLower(c *context) bool { - // From CLDR: - // # Introduce an explicit dot above when lowercasing capital I's and J's - // # whenever there are more accents above. - // # (of the accents used in Lithuanian: grave, acute, tilde above, and ogonek) - // # 0049; 0069 0307; 0049; 0049; lt More_Above; # LATIN CAPITAL LETTER I - // # 004A; 006A 0307; 004A; 004A; lt More_Above; # LATIN CAPITAL LETTER J - // # 012E; 012F 0307; 012E; 012E; lt More_Above; # LATIN CAPITAL LETTER I WITH OGONEK - // # 00CC; 0069 0307 0300; 00CC; 00CC; lt; # LATIN CAPITAL LETTER I WITH GRAVE - // # 00CD; 0069 0307 0301; 00CD; 00CD; lt; # LATIN CAPITAL LETTER I WITH ACUTE - // # 0128; 0069 0307 0303; 0128; 0128; lt; # LATIN CAPITAL LETTER I WITH TILDE - // ::NFD(); - // I } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0307; - // J } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → j \u0307; - // I \u0328 (Į) } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0328 \u0307; - // I \u0300 (Ì) → i \u0307 \u0300; - // I \u0301 (Í) → i \u0307 \u0301; - // I \u0303 (Ĩ) → i \u0307 \u0303; - // ::Any-Lower(); - // ::NFC(); - - i := 0 - if r := c.src[c.pSrc]; r < utf8.RuneSelf { - lower(c) - if r != 'I' && r != 'J' { - return true - } - } else { - p := norm.NFD.Properties(c.src[c.pSrc:]) - if d := p.Decomposition(); len(d) >= 3 && (d[0] == 'I' || d[0] == 'J') { - // UTF-8 optimization: the decomposition will only have an above - // modifier if the last rune of the decomposition is in [U+300-U+311]. - // In all other cases, a decomposition starting with I is always - // an I followed by modifiers that are not cased themselves. See A.2. - if d[1] == 0xCC && d[2] <= 0x91 { // A.2.4. - if !c.writeBytes(d[:1]) { - return false - } - c.dst[c.pDst-1] += 'a' - 'A' // lower - - // Assumption: modifier never changes on lowercase. See A.1. - // Assumption: all modifiers added have CCC = Above. See A.2.3. - return c.writeString("\u0307") && c.writeBytes(d[1:]) - } - // In all other cases the additional modifiers will have a CCC - // that is less than 230 (Above). We will insert the U+0307, if - // needed, after these modifiers so that a string in FCD form - // will remain so. See A.2.2. - lower(c) - i = 1 - } else { - return lower(c) - } - } - - for ; i < maxIgnorable && c.next(); i++ { - switch c.info.cccType() { - case cccZero: - c.unreadRune() - return true - case cccAbove: - return c.writeString("\u0307") && c.copy() // See A.1. - default: - c.copy() // See A.1. - } - } - return i == maxIgnorable -} - -// ltLowerSpan would be the same as isLower. - -func ltUpper(f mapFunc) mapFunc { - return func(c *context) bool { - // Unicode: - // 0307; 0307; ; ; lt After_Soft_Dotted; # COMBINING DOT ABOVE - // - // From CLDR: - // # Remove \u0307 following soft-dotteds (i, j, and the like), with possible - // # intervening non-230 marks. - // ::NFD(); - // [:Soft_Dotted:] [^[:ccc=Not_Reordered:][:ccc=Above:]]* { \u0307 → ; - // ::Any-Upper(); - // ::NFC(); - - // TODO: See A.5. A soft-dotted rune never has an exception. This would - // allow us to overload the exception bit and encode this property in - // info. Need to measure performance impact of this. - r, _ := utf8.DecodeRune(c.src[c.pSrc:]) - oldPDst := c.pDst - if !f(c) { - return false - } - if !unicode.Is(unicode.Soft_Dotted, r) { - return true - } - - // We don't need to do an NFD normalization, as a soft-dotted rune never - // contains U+0307. See A.3. - - i := 0 - for ; i < maxIgnorable && c.next(); i++ { - switch c.info.cccType() { - case cccZero: - c.unreadRune() - return true - case cccAbove: - if c.hasPrefix("\u0307") { - // We don't do a full NFC, but rather combine runes for - // some of the common cases. (Returning NFC or - // preserving normal form is neither a requirement nor - // a possibility anyway). - if !c.next() { - return false - } - if c.dst[oldPDst] == 'I' && c.pDst == oldPDst+1 && c.src[c.pSrc] == 0xcc { - s := "" - switch c.src[c.pSrc+1] { - case 0x80: // U+0300 COMBINING GRAVE ACCENT - s = "\u00cc" // U+00CC LATIN CAPITAL LETTER I WITH GRAVE - case 0x81: // U+0301 COMBINING ACUTE ACCENT - s = "\u00cd" // U+00CD LATIN CAPITAL LETTER I WITH ACUTE - case 0x83: // U+0303 COMBINING TILDE - s = "\u0128" // U+0128 LATIN CAPITAL LETTER I WITH TILDE - case 0x88: // U+0308 COMBINING DIAERESIS - s = "\u00cf" // U+00CF LATIN CAPITAL LETTER I WITH DIAERESIS - default: - } - if s != "" { - c.pDst = oldPDst - return c.writeString(s) - } - } - } - return c.copy() - default: - c.copy() - } - } - return i == maxIgnorable - } -} - -// TODO: implement ltUpperSpan (low priority: complex and infrequent). - -func aztrUpper(f mapFunc) mapFunc { - return func(c *context) bool { - // i→İ; - if c.src[c.pSrc] == 'i' { - return c.writeString("İ") - } - return f(c) - } -} - -func aztrLower(c *context) (done bool) { - // From CLDR: - // # I and i-dotless; I-dot and i are case pairs in Turkish and Azeri - // # 0130; 0069; 0130; 0130; tr; # LATIN CAPITAL LETTER I WITH DOT ABOVE - // İ→i; - // # When lowercasing, remove dot_above in the sequence I + dot_above, which will turn into i. - // # This matches the behavior of the canonically equivalent I-dot_above - // # 0307; ; 0307; 0307; tr After_I; # COMBINING DOT ABOVE - // # When lowercasing, unless an I is before a dot_above, it turns into a dotless i. - // # 0049; 0131; 0049; 0049; tr Not_Before_Dot; # LATIN CAPITAL LETTER I - // I([^[:ccc=Not_Reordered:][:ccc=Above:]]*)\u0307 → i$1 ; - // I→ı ; - // ::Any-Lower(); - if c.hasPrefix("\u0130") { // İ - return c.writeString("i") - } - if c.src[c.pSrc] != 'I' { - return lower(c) - } - - // We ignore the lower-case I for now, but insert it later when we know - // which form we need. - start := c.pSrc + c.sz - - i := 0 -Loop: - // We check for up to n ignorables before \u0307. As \u0307 is an - // ignorable as well, n is maxIgnorable-1. - for ; i < maxIgnorable && c.next(); i++ { - switch c.info.cccType() { - case cccAbove: - if c.hasPrefix("\u0307") { - return c.writeString("i") && c.writeBytes(c.src[start:c.pSrc]) // ignore U+0307 - } - done = true - break Loop - case cccZero: - c.unreadRune() - done = true - break Loop - default: - // We'll write this rune after we know which starter to use. - } - } - if i == maxIgnorable { - done = true - } - return c.writeString("ı") && c.writeBytes(c.src[start:c.pSrc+c.sz]) && done -} - -// aztrLowerSpan would be the same as isLower. - -func nlTitle(c *context) bool { - // From CLDR: - // # Special titlecasing for Dutch initial "ij". - // ::Any-Title(); - // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) - // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; - if c.src[c.pSrc] != 'I' && c.src[c.pSrc] != 'i' { - return title(c) - } - - if !c.writeString("I") || !c.next() { - return false - } - if c.src[c.pSrc] == 'j' || c.src[c.pSrc] == 'J' { - return c.writeString("J") - } - c.unreadRune() - return true -} - -func nlTitleSpan(c *context) bool { - // From CLDR: - // # Special titlecasing for Dutch initial "ij". - // ::Any-Title(); - // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) - // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; - if c.src[c.pSrc] != 'I' { - return isTitle(c) - } - if !c.next() || c.src[c.pSrc] == 'j' { - return false - } - if c.src[c.pSrc] != 'J' { - c.unreadRune() - } - return true -} - -// Not part of CLDR, but see https://unicode.org/cldr/trac/ticket/7078. -func afnlRewrite(c *context) { - if c.hasPrefix("'") || c.hasPrefix("’") { - c.isMidWord = true - } -} diff --git a/vendor/golang.org/x/text/cases/tables10.0.0.go b/vendor/golang.org/x/text/cases/tables10.0.0.go deleted file mode 100644 index ca9923105e..0000000000 --- a/vendor/golang.org/x/text/cases/tables10.0.0.go +++ /dev/null @@ -1,2256 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -//go:build go1.10 && !go1.13 -// +build go1.10,!go1.13 - -package cases - -// UnicodeVersion is the Unicode version from which the tables in this package are derived. -const UnicodeVersion = "10.0.0" - -var xorData string = "" + // Size: 185 bytes - "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + - "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + - "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + - "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + - "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + - "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + - "\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" + - "\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" + - "\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22" - -var exceptions string = "" + // Size: 2068 bytes - "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + - "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + - "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + - "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + - "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + - "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + - "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + - "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x12\x12вВВ\x12\x12дД" + - "Д\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" + - "\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" + - "ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" + - "ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + - "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + - "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + - "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + - "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + - "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + - "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + - "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + - "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" + - "\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" + - "ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" + - "̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" + - "ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" + - "\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" + - "\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" + - "\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFF" + - "Ff\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12" + - "stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄ" + - "ԽՄխ" - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// caseTrie. Total size: 11892 bytes (11.61 KiB). Checksum: c6f15484b7653775. -type caseTrie struct{} - -func newCaseTrie(i int) *caseTrie { - return &caseTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { - switch { - case n < 18: - return uint16(caseValues[n<<6+uint32(b)]) - default: - n -= 18 - return uint16(sparse.lookup(n, b)) - } -} - -// caseValues: 20 blocks, 1280 entries, 2560 bytes -// The third block is the zero block. -var caseValues = [1280]uint16{ - // Block 0x0, offset 0x0 - 0x27: 0x0054, - 0x2e: 0x0054, - 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, - 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, - // Block 0x1, offset 0x40 - 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, - 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, - 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, - 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, - 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, - 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, - 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, - 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, - 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, - 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, - 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, - 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, - 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, - 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, - 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, - 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, - 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, - 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, - 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, - 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, - // Block 0x4, offset 0x100 - 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, - 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, - 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, - 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, - 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, - 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, - 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, - 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, - 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, - 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, - 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, - // Block 0x5, offset 0x140 - 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, - 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, - 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, - 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, - 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, - 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, - 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, - 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, - 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, - 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, - 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, - // Block 0x6, offset 0x180 - 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, - 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, - 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, - 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, - 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, - 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, - 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, - 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, - 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, - 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, - 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, - 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, - 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, - 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, - 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, - 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, - 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, - 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, - 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, - 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, - 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, - // Block 0x8, offset 0x200 - 0x204: 0x0004, 0x205: 0x0004, - 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, - 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, - 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, - 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, - 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, - 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, - 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, - 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, - 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, - 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, - // Block 0x9, offset 0x240 - 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, - 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, - 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, - 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, - 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, - 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, - 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, - 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, - 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, - 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, - 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, - // Block 0xa, offset 0x280 - 0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812, - 0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813, - 0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x239a, 0x291: 0x0812, - 0x292: 0x247a, 0x293: 0x0812, 0x294: 0x25ba, 0x295: 0x0812, 0x296: 0x26fa, 0x297: 0x0812, - 0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813, - 0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812, - 0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813, - 0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813, - 0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152, - 0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52, - 0x2bc: 0x4d52, 0x2bd: 0x4d52, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x283a, 0x2c1: 0x292a, 0x2c2: 0x2a1a, 0x2c3: 0x2b0a, 0x2c4: 0x2bfa, 0x2c5: 0x2cea, - 0x2c6: 0x2dda, 0x2c7: 0x2eca, 0x2c8: 0x2fb9, 0x2c9: 0x30a9, 0x2ca: 0x3199, 0x2cb: 0x3289, - 0x2cc: 0x3379, 0x2cd: 0x3469, 0x2ce: 0x3559, 0x2cf: 0x3649, 0x2d0: 0x373a, 0x2d1: 0x382a, - 0x2d2: 0x391a, 0x2d3: 0x3a0a, 0x2d4: 0x3afa, 0x2d5: 0x3bea, 0x2d6: 0x3cda, 0x2d7: 0x3dca, - 0x2d8: 0x3eb9, 0x2d9: 0x3fa9, 0x2da: 0x4099, 0x2db: 0x4189, 0x2dc: 0x4279, 0x2dd: 0x4369, - 0x2de: 0x4459, 0x2df: 0x4549, 0x2e0: 0x463a, 0x2e1: 0x472a, 0x2e2: 0x481a, 0x2e3: 0x490a, - 0x2e4: 0x49fa, 0x2e5: 0x4aea, 0x2e6: 0x4bda, 0x2e7: 0x4cca, 0x2e8: 0x4db9, 0x2e9: 0x4ea9, - 0x2ea: 0x4f99, 0x2eb: 0x5089, 0x2ec: 0x5179, 0x2ed: 0x5269, 0x2ee: 0x5359, 0x2ef: 0x5449, - 0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x553a, 0x2f3: 0x564a, 0x2f4: 0x571a, - 0x2f6: 0x57fa, 0x2f7: 0x58da, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53, - 0x2fc: 0x5a19, 0x2fd: 0x0004, 0x2fe: 0x5aea, 0x2ff: 0x0004, - // Block 0xc, offset 0x300 - 0x300: 0x0004, 0x301: 0x0004, 0x302: 0x5b6a, 0x303: 0x5c7a, 0x304: 0x5d4a, - 0x306: 0x5e2a, 0x307: 0x5f0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153, - 0x30c: 0x6049, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812, - 0x312: 0x611a, 0x313: 0x625a, 0x316: 0x639a, 0x317: 0x647a, - 0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004, - 0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x65ba, 0x323: 0x66fa, - 0x324: 0x683a, 0x325: 0x0912, 0x326: 0x691a, 0x327: 0x69fa, 0x328: 0x0813, 0x329: 0x0813, - 0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004, - 0x332: 0x6b3a, 0x333: 0x6c4a, 0x334: 0x6d1a, - 0x336: 0x6dfa, 0x337: 0x6eda, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53, - 0x33c: 0x7019, 0x33d: 0x0004, 0x33e: 0x0004, - // Block 0xd, offset 0x340 - 0x342: 0x0013, - 0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013, - 0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013, - 0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013, - 0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013, - 0x364: 0x0013, 0x366: 0x70eb, 0x368: 0x0013, - 0x36a: 0x714b, 0x36b: 0x718b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012, - 0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010, - 0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012, - 0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013, - // Block 0xe, offset 0x380 - 0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13, - 0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13, - 0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052, - 0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352, - 0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12, - 0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12, - 0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552, - 0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552, - 0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952, - 0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952, - 0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952, - 0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0x71eb, 0x3e3: 0x8853, - 0x3e4: 0x724b, 0x3e5: 0x72aa, 0x3e6: 0x730a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313, - 0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0x736b, 0x3ee: 0x73cb, 0x3ef: 0x742b, - 0x3f0: 0x748b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313, - 0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012, - 0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0x74eb, 0x3ff: 0x754b, - // Block 0x10, offset 0x400 - 0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112, - 0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0014, 0x40a: 0x0014, 0x40b: 0x0713, - 0x40c: 0x0712, 0x40d: 0x75ab, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112, - 0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112, - 0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112, - 0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112, - 0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112, - 0x42a: 0x760b, 0x42b: 0x766b, 0x42c: 0x76cb, 0x42d: 0x772b, 0x42e: 0x778b, - 0x430: 0x77eb, 0x431: 0x784b, 0x432: 0x78ab, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112, - 0x436: 0x0113, 0x437: 0x0112, - // Block 0x11, offset 0x440 - 0x440: 0x790a, 0x441: 0x798a, 0x442: 0x7a0a, 0x443: 0x7a8a, 0x444: 0x7b3a, 0x445: 0x7bea, - 0x446: 0x7c6a, - 0x453: 0x7cea, 0x454: 0x7dca, 0x455: 0x7eaa, 0x456: 0x7f8a, 0x457: 0x806a, - 0x45d: 0x0010, - 0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010, - 0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010, - 0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010, - 0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010, - 0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010, - 0x47c: 0x0010, 0x47e: 0x0010, - // Block 0x12, offset 0x480 - 0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213, - 0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613, - 0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213, - 0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13, - 0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213, - 0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212, - 0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12, - 0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212, - 0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612, - 0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212, - 0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212, - // Block 0x13, offset 0x4c0 - 0x4c2: 0x0010, - 0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010, - 0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010, - 0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010, - 0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010, - 0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, - 0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010, - 0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, - 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, - 0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, - 0x4fc: 0x0010, 0x4fe: 0x0010, -} - -// caseIndex: 25 blocks, 1600 entries, 3200 bytes -// Block 0 is the zero block. -var caseIndex = [1600]uint16{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02, - 0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, - 0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20, - 0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, - 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, - 0xf0: 0x14, 0xf3: 0x16, - // Block 0x4, offset 0x100 - 0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30, - 0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38, - 0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40, - 0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48, - // Block 0x5, offset 0x140 - 0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23, - 0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, - 0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23, - 0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, - 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, - 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, - 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, - 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a, - // Block 0x6, offset 0x180 - 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a, - 0x192: 0x7b, 0x193: 0x0c, - 0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, - 0x1b8: 0x82, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87, - // Block 0x8, offset 0x200 - 0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23, - 0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23, - 0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23, - 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91, - 0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, - 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, - 0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23, - 0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23, - // Block 0x9, offset 0x240 - 0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23, - 0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23, - 0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23, - 0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23, - 0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23, - 0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23, - 0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23, - 0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23, - // Block 0xa, offset 0x280 - 0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23, - 0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23, - 0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23, - 0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2, - // Block 0xb, offset 0x2c0 - 0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, - 0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, - 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, - // Block 0xc, offset 0x300 - 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, - 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, - 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, - 0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3, - 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, - 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, - 0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, - // Block 0xd, offset 0x340 - 0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda, - 0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf, - 0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5, - 0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea, - 0x362: 0xeb, 0x363: 0xec, - 0x368: 0xed, 0x369: 0xee, 0x36a: 0xef, 0x36b: 0xf0, - 0x370: 0xf1, 0x371: 0xf2, 0x372: 0xf3, 0x374: 0xf4, 0x375: 0xf5, - // Block 0xe, offset 0x380 - 0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23, - 0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf6, - 0x390: 0x23, 0x391: 0xf7, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf8, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23, - 0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23, - 0x3d0: 0xf7, - // Block 0x10, offset 0x400 - 0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23, - 0x418: 0x23, 0x419: 0xf9, - // Block 0x11, offset 0x440 - 0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23, - 0x468: 0xf0, 0x469: 0xfa, 0x46b: 0xfb, 0x46c: 0xfc, 0x46d: 0xfd, 0x46e: 0xfe, - 0x47c: 0x23, 0x47d: 0xff, 0x47e: 0x100, 0x47f: 0x101, - // Block 0x12, offset 0x480 - 0x4b0: 0x23, 0x4b1: 0x102, 0x4b2: 0x103, - // Block 0x13, offset 0x4c0 - 0x4c5: 0x104, 0x4c6: 0x105, - 0x4c9: 0x106, - 0x4d0: 0x107, 0x4d1: 0x108, 0x4d2: 0x109, 0x4d3: 0x10a, 0x4d4: 0x10b, 0x4d5: 0x10c, 0x4d6: 0x10d, 0x4d7: 0x10e, - 0x4d8: 0x10f, 0x4d9: 0x110, 0x4da: 0x111, 0x4db: 0x112, 0x4dc: 0x113, 0x4dd: 0x114, 0x4de: 0x115, 0x4df: 0x116, - 0x4e8: 0x117, 0x4e9: 0x118, 0x4ea: 0x119, - // Block 0x14, offset 0x500 - 0x500: 0x11a, - 0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x11b, 0x524: 0x10, 0x525: 0x11c, - 0x538: 0x11d, 0x539: 0x11, 0x53a: 0x11e, - // Block 0x15, offset 0x540 - 0x544: 0x11f, 0x545: 0x120, 0x546: 0x121, - 0x54f: 0x122, - // Block 0x16, offset 0x580 - 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, - 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, - // Block 0x17, offset 0x5c0 - 0x5c0: 0x123, 0x5c1: 0x124, 0x5c4: 0x124, 0x5c5: 0x124, 0x5c6: 0x124, 0x5c7: 0x125, - // Block 0x18, offset 0x600 - 0x620: 0x15, -} - -// sparseOffsets: 277 entries, 554 bytes -var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x54, 0x64, 0x6b, 0x70, 0x7e, 0x7f, 0x8d, 0x9c, 0xa6, 0xa9, 0xaf, 0xb7, 0xba, 0xbc, 0xca, 0xd0, 0xde, 0xe9, 0xf5, 0x100, 0x10c, 0x116, 0x122, 0x12d, 0x139, 0x145, 0x14d, 0x155, 0x15f, 0x16a, 0x176, 0x17d, 0x188, 0x18d, 0x195, 0x198, 0x19d, 0x1a1, 0x1a5, 0x1ac, 0x1b5, 0x1bd, 0x1be, 0x1c7, 0x1ce, 0x1d6, 0x1dc, 0x1e2, 0x1e7, 0x1eb, 0x1ee, 0x1f0, 0x1f3, 0x1f8, 0x1f9, 0x1fb, 0x1fd, 0x1ff, 0x206, 0x20b, 0x20f, 0x218, 0x21b, 0x21e, 0x224, 0x225, 0x230, 0x231, 0x232, 0x237, 0x244, 0x24c, 0x254, 0x25d, 0x266, 0x26f, 0x274, 0x277, 0x280, 0x28d, 0x28f, 0x296, 0x298, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x326, 0x32d, 0x331, 0x33a, 0x33b, 0x343, 0x347, 0x34c, 0x354, 0x35a, 0x360, 0x36a, 0x36f, 0x378, 0x37e, 0x385, 0x389, 0x391, 0x393, 0x395, 0x398, 0x39a, 0x39c, 0x39d, 0x39e, 0x3a0, 0x3a2, 0x3a8, 0x3ad, 0x3af, 0x3b5, 0x3b8, 0x3ba, 0x3c0, 0x3c5, 0x3c7, 0x3c8, 0x3c9, 0x3ca, 0x3cc, 0x3ce, 0x3d0, 0x3d3, 0x3d5, 0x3d8, 0x3e0, 0x3e3, 0x3e7, 0x3ef, 0x3f1, 0x3f2, 0x3f3, 0x3f5, 0x3fb, 0x3fd, 0x3fe, 0x400, 0x402, 0x404, 0x411, 0x412, 0x413, 0x417, 0x419, 0x41a, 0x41b, 0x41c, 0x41d, 0x421, 0x425, 0x42b, 0x42d, 0x434, 0x437, 0x43b, 0x441, 0x44a, 0x450, 0x456, 0x460, 0x46a, 0x46c, 0x473, 0x479, 0x47f, 0x485, 0x488, 0x48e, 0x491, 0x499, 0x49a, 0x4a1, 0x4a2, 0x4a5, 0x4af, 0x4b5, 0x4bb, 0x4bc, 0x4c2, 0x4c5, 0x4cd, 0x4d4, 0x4db, 0x4dc, 0x4dd, 0x4de, 0x4df, 0x4e1, 0x4e3, 0x4e5, 0x4e9, 0x4ea, 0x4ec, 0x4ed, 0x4ee, 0x4f0, 0x4f5, 0x4fa, 0x4fe, 0x4ff, 0x502, 0x506, 0x511, 0x515, 0x51d, 0x522, 0x526, 0x529, 0x52d, 0x530, 0x533, 0x538, 0x53c, 0x540, 0x544, 0x548, 0x54a, 0x54c, 0x54f, 0x554, 0x556, 0x55b, 0x564, 0x569, 0x56a, 0x56d, 0x56e, 0x56f, 0x571, 0x572, 0x573} - -// sparseValues: 1395 entries, 5580 bytes -var sparseValues = [1395]valueRange{ - // Block 0x0, offset 0x0 - {value: 0x0004, lo: 0xa8, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xaa}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0004, lo: 0xaf, hi: 0xaf}, - {value: 0x0004, lo: 0xb4, hi: 0xb4}, - {value: 0x001a, lo: 0xb5, hi: 0xb5}, - {value: 0x0054, lo: 0xb7, hi: 0xb7}, - {value: 0x0004, lo: 0xb8, hi: 0xb8}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - // Block 0x1, offset 0x9 - {value: 0x2013, lo: 0x80, hi: 0x96}, - {value: 0x2013, lo: 0x98, hi: 0x9e}, - {value: 0x009a, lo: 0x9f, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xb6}, - {value: 0x2012, lo: 0xb8, hi: 0xbe}, - {value: 0x0252, lo: 0xbf, hi: 0xbf}, - // Block 0x2, offset 0xf - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x011b, lo: 0xb0, hi: 0xb0}, - {value: 0x019a, lo: 0xb1, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb7}, - {value: 0x0012, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x0553, lo: 0xbf, hi: 0xbf}, - // Block 0x3, offset 0x18 - {value: 0x0552, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x01da, lo: 0x89, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xb7}, - {value: 0x0253, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x028a, lo: 0xbf, hi: 0xbf}, - // Block 0x4, offset 0x24 - {value: 0x0117, lo: 0x80, hi: 0x9f}, - {value: 0x2f53, lo: 0xa0, hi: 0xa0}, - {value: 0x0012, lo: 0xa1, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xb3}, - {value: 0x0012, lo: 0xb4, hi: 0xb9}, - {value: 0x090b, lo: 0xba, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x2953, lo: 0xbd, hi: 0xbd}, - {value: 0x098b, lo: 0xbe, hi: 0xbe}, - {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, - // Block 0x5, offset 0x2e - {value: 0x0015, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x97}, - {value: 0x0004, lo: 0x98, hi: 0x9d}, - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0015, lo: 0xa0, hi: 0xa4}, - {value: 0x0004, lo: 0xa5, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xbf}, - // Block 0x6, offset 0x35 - {value: 0x0024, lo: 0x80, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbf}, - // Block 0x7, offset 0x38 - {value: 0x6553, lo: 0x80, hi: 0x8f}, - {value: 0x2013, lo: 0x90, hi: 0x9f}, - {value: 0x5f53, lo: 0xa0, hi: 0xaf}, - {value: 0x2012, lo: 0xb0, hi: 0xbf}, - // Block 0x8, offset 0x3c - {value: 0x5f52, lo: 0x80, hi: 0x8f}, - {value: 0x6552, lo: 0x90, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x9, offset 0x3f - {value: 0x0117, lo: 0x80, hi: 0x81}, - {value: 0x0024, lo: 0x83, hi: 0x87}, - {value: 0x0014, lo: 0x88, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xbf}, - // Block 0xa, offset 0x43 - {value: 0x0f13, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x0316, lo: 0x89, hi: 0x8a}, - {value: 0x0716, lo: 0x8b, hi: 0x8c}, - {value: 0x0316, lo: 0x8d, hi: 0x8e}, - {value: 0x0f12, lo: 0x8f, hi: 0x8f}, - {value: 0x0117, lo: 0x90, hi: 0xbf}, - // Block 0xb, offset 0x4d - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x6553, lo: 0xb1, hi: 0xbf}, - // Block 0xc, offset 0x4f - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6853, lo: 0x90, hi: 0x96}, - {value: 0x0014, lo: 0x99, hi: 0x99}, - {value: 0x6552, lo: 0xa1, hi: 0xaf}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0xd, offset 0x54 - {value: 0x6852, lo: 0x80, hi: 0x86}, - {value: 0x198a, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x91, hi: 0x91}, - {value: 0x0024, lo: 0x92, hi: 0x95}, - {value: 0x0034, lo: 0x96, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x99}, - {value: 0x0034, lo: 0x9a, hi: 0x9b}, - {value: 0x0024, lo: 0x9c, hi: 0xa1}, - {value: 0x0034, lo: 0xa2, hi: 0xa7}, - {value: 0x0024, lo: 0xa8, hi: 0xa9}, - {value: 0x0034, lo: 0xaa, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xbd}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xe, offset 0x64 - {value: 0x0034, lo: 0x81, hi: 0x82}, - {value: 0x0024, lo: 0x84, hi: 0x84}, - {value: 0x0034, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xb3}, - {value: 0x0054, lo: 0xb4, hi: 0xb4}, - // Block 0xf, offset 0x6b - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0024, lo: 0x90, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0014, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x10, offset 0x70 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9c}, - {value: 0x0024, lo: 0x9d, hi: 0x9e}, - {value: 0x0034, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x11, offset 0x7e - {value: 0x0010, lo: 0x80, hi: 0xbf}, - // Block 0x12, offset 0x7f - {value: 0x0010, lo: 0x80, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0024, lo: 0x9f, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xaa, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x13, offset 0x8d - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0034, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0034, lo: 0xb1, hi: 0xb1}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbd}, - {value: 0x0034, lo: 0xbe, hi: 0xbe}, - {value: 0x0024, lo: 0xbf, hi: 0xbf}, - // Block 0x14, offset 0x9c - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0024, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x88}, - {value: 0x0024, lo: 0x89, hi: 0x8a}, - {value: 0x0010, lo: 0x8d, hi: 0xbf}, - // Block 0x15, offset 0xa6 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x16, offset 0xa9 - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xb1}, - {value: 0x0034, lo: 0xb2, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - // Block 0x17, offset 0xaf - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x99}, - {value: 0x0014, lo: 0x9a, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0xa3}, - {value: 0x0014, lo: 0xa4, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xad}, - // Block 0x18, offset 0xb7 - {value: 0x0010, lo: 0x80, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x9b}, - {value: 0x0010, lo: 0xa0, hi: 0xaa}, - // Block 0x19, offset 0xba - {value: 0x0010, lo: 0xa0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbd}, - // Block 0x1a, offset 0xbc - {value: 0x0024, lo: 0x94, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0024, lo: 0xaa, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbf}, - // Block 0x1b, offset 0xca - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1c, offset 0xd0 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0x1d, offset 0xde - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb6, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1e, offset 0xe9 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xb1}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - // Block 0x1f, offset 0xf5 - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x20, offset 0x100 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x99, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x21, offset 0x10c - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x22, offset 0x116 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x85}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xbf}, - // Block 0x23, offset 0x122 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x24, offset 0x12d - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x25, offset 0x139 - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0010, lo: 0xa8, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x26, offset 0x145 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x27, offset 0x14d - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb9}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbf}, - // Block 0x28, offset 0x155 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x88}, - {value: 0x0014, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x29, offset 0x15f - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x2a, offset 0x16a - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb2}, - // Block 0x2b, offset 0x176 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x2c, offset 0x17d - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x94, hi: 0x97}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xba, hi: 0xbf}, - // Block 0x2d, offset 0x188 - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x96}, - {value: 0x0010, lo: 0x9a, hi: 0xb1}, - {value: 0x0010, lo: 0xb3, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x2e, offset 0x18d - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x94}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9f}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - // Block 0x2f, offset 0x195 - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xba}, - // Block 0x30, offset 0x198 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x31, offset 0x19d - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xb9}, - {value: 0x0014, lo: 0xbb, hi: 0xbc}, - // Block 0x32, offset 0x1a1 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x33, offset 0x1a5 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0034, lo: 0x98, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0034, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x34, offset 0x1ac - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xac}, - {value: 0x0034, lo: 0xb1, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xba, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x35, offset 0x1b5 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0024, lo: 0x82, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x86, hi: 0x87}, - {value: 0x0010, lo: 0x88, hi: 0x8c}, - {value: 0x0014, lo: 0x8d, hi: 0x97}, - {value: 0x0014, lo: 0x99, hi: 0xbc}, - // Block 0x36, offset 0x1bd - {value: 0x0034, lo: 0x86, hi: 0x86}, - // Block 0x37, offset 0x1be - {value: 0x0010, lo: 0xab, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbe}, - // Block 0x38, offset 0x1c7 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x96, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x99}, - {value: 0x0014, lo: 0x9e, hi: 0xa0}, - {value: 0x0010, lo: 0xa2, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xad}, - {value: 0x0014, lo: 0xb1, hi: 0xb4}, - // Block 0x39, offset 0x1ce - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x6c53, lo: 0xa0, hi: 0xbf}, - // Block 0x3a, offset 0x1d6 - {value: 0x7053, lo: 0x80, hi: 0x85}, - {value: 0x7053, lo: 0x87, hi: 0x87}, - {value: 0x7053, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xba}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x3b, offset 0x1dc - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x9a, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x3c, offset 0x1e2 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x3d, offset 0x1e7 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x82, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3e, offset 0x1eb - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3f, offset 0x1ee - {value: 0x0010, lo: 0x80, hi: 0x9a}, - {value: 0x0024, lo: 0x9d, hi: 0x9f}, - // Block 0x40, offset 0x1f0 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x7453, lo: 0xa0, hi: 0xaf}, - {value: 0x7853, lo: 0xb0, hi: 0xbf}, - // Block 0x41, offset 0x1f3 - {value: 0x7c53, lo: 0x80, hi: 0x8f}, - {value: 0x8053, lo: 0x90, hi: 0x9f}, - {value: 0x7c53, lo: 0xa0, hi: 0xaf}, - {value: 0x0813, lo: 0xb0, hi: 0xb5}, - {value: 0x0892, lo: 0xb8, hi: 0xbd}, - // Block 0x42, offset 0x1f8 - {value: 0x0010, lo: 0x81, hi: 0xbf}, - // Block 0x43, offset 0x1f9 - {value: 0x0010, lo: 0x80, hi: 0xac}, - {value: 0x0010, lo: 0xaf, hi: 0xbf}, - // Block 0x44, offset 0x1fb - {value: 0x0010, lo: 0x81, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x45, offset 0x1fd - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb8}, - // Block 0x46, offset 0x1ff - {value: 0x0010, lo: 0x80, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0034, lo: 0x94, hi: 0x94}, - {value: 0x0010, lo: 0xa0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - // Block 0x47, offset 0x206 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xac}, - {value: 0x0010, lo: 0xae, hi: 0xb0}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - // Block 0x48, offset 0x20b - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x49, offset 0x20f - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x89, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0014, lo: 0x93, hi: 0x93}, - {value: 0x0004, lo: 0x97, hi: 0x97}, - {value: 0x0024, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0x4a, offset 0x218 - {value: 0x0014, lo: 0x8b, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x4b, offset 0x21b - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb7}, - // Block 0x4c, offset 0x21e - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x4d, offset 0x224 - {value: 0x0010, lo: 0x80, hi: 0xb5}, - // Block 0x4e, offset 0x225 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbb}, - // Block 0x4f, offset 0x230 - {value: 0x0010, lo: 0x86, hi: 0x8f}, - // Block 0x50, offset 0x231 - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x51, offset 0x232 - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - // Block 0x52, offset 0x237 - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x9e}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xac}, - {value: 0x0010, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xbc}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x53, offset 0x244 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xa7, hi: 0xa7}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - {value: 0x0034, lo: 0xb5, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbc}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0x54, offset 0x24c - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x55, offset 0x254 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0030, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8b}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xab, hi: 0xab}, - {value: 0x0034, lo: 0xac, hi: 0xac}, - {value: 0x0024, lo: 0xad, hi: 0xb3}, - // Block 0x56, offset 0x25d - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0030, lo: 0xaa, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbf}, - // Block 0x57, offset 0x266 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0030, lo: 0xb2, hi: 0xb3}, - // Block 0x58, offset 0x26f - {value: 0x0010, lo: 0x80, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0x59, offset 0x274 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8d, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x5a, offset 0x277 - {value: 0x1a6a, lo: 0x80, hi: 0x80}, - {value: 0x1aea, lo: 0x81, hi: 0x81}, - {value: 0x1b6a, lo: 0x82, hi: 0x82}, - {value: 0x1bea, lo: 0x83, hi: 0x83}, - {value: 0x1c6a, lo: 0x84, hi: 0x84}, - {value: 0x1cea, lo: 0x85, hi: 0x85}, - {value: 0x1d6a, lo: 0x86, hi: 0x86}, - {value: 0x1dea, lo: 0x87, hi: 0x87}, - {value: 0x1e6a, lo: 0x88, hi: 0x88}, - // Block 0x5b, offset 0x280 - {value: 0x0024, lo: 0x90, hi: 0x92}, - {value: 0x0034, lo: 0x94, hi: 0x99}, - {value: 0x0024, lo: 0x9a, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9f}, - {value: 0x0024, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0034, lo: 0xa2, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xb3}, - {value: 0x0024, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb7}, - {value: 0x0024, lo: 0xb8, hi: 0xb9}, - // Block 0x5c, offset 0x28d - {value: 0x0012, lo: 0x80, hi: 0xab}, - {value: 0x0015, lo: 0xac, hi: 0xbf}, - // Block 0x5d, offset 0x28f - {value: 0x0015, lo: 0x80, hi: 0xaa}, - {value: 0x0012, lo: 0xab, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb8}, - {value: 0x8452, lo: 0xb9, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbc}, - {value: 0x8852, lo: 0xbd, hi: 0xbd}, - {value: 0x0012, lo: 0xbe, hi: 0xbf}, - // Block 0x5e, offset 0x296 - {value: 0x0012, lo: 0x80, hi: 0x9a}, - {value: 0x0015, lo: 0x9b, hi: 0xbf}, - // Block 0x5f, offset 0x298 - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0024, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb9}, - {value: 0x0024, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbd}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x60, offset 0x2a4 - {value: 0x0117, lo: 0x80, hi: 0xbf}, - // Block 0x61, offset 0x2a5 - {value: 0x0117, lo: 0x80, hi: 0x95}, - {value: 0x1f1a, lo: 0x96, hi: 0x96}, - {value: 0x1fca, lo: 0x97, hi: 0x97}, - {value: 0x207a, lo: 0x98, hi: 0x98}, - {value: 0x212a, lo: 0x99, hi: 0x99}, - {value: 0x21da, lo: 0x9a, hi: 0x9a}, - {value: 0x228a, lo: 0x9b, hi: 0x9b}, - {value: 0x0012, lo: 0x9c, hi: 0x9d}, - {value: 0x233b, lo: 0x9e, hi: 0x9e}, - {value: 0x0012, lo: 0x9f, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x62, offset 0x2b0 - {value: 0x0812, lo: 0x80, hi: 0x87}, - {value: 0x0813, lo: 0x88, hi: 0x8f}, - {value: 0x0812, lo: 0x90, hi: 0x95}, - {value: 0x0813, lo: 0x98, hi: 0x9d}, - {value: 0x0812, lo: 0xa0, hi: 0xa7}, - {value: 0x0813, lo: 0xa8, hi: 0xaf}, - {value: 0x0812, lo: 0xb0, hi: 0xb7}, - {value: 0x0813, lo: 0xb8, hi: 0xbf}, - // Block 0x63, offset 0x2b8 - {value: 0x0004, lo: 0x8b, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8f}, - {value: 0x0054, lo: 0x98, hi: 0x99}, - {value: 0x0054, lo: 0xa4, hi: 0xa4}, - {value: 0x0054, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xaa, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xaf}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x64, offset 0x2c0 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x94, hi: 0x94}, - {value: 0x0014, lo: 0xa0, hi: 0xa4}, - {value: 0x0014, lo: 0xa6, hi: 0xaf}, - {value: 0x0015, lo: 0xb1, hi: 0xb1}, - {value: 0x0015, lo: 0xbf, hi: 0xbf}, - // Block 0x65, offset 0x2c6 - {value: 0x0015, lo: 0x90, hi: 0x9c}, - // Block 0x66, offset 0x2c7 - {value: 0x0024, lo: 0x90, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x93}, - {value: 0x0024, lo: 0x94, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0xa0}, - {value: 0x0024, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa4}, - {value: 0x0034, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa7}, - {value: 0x0034, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xa9}, - {value: 0x0034, lo: 0xaa, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - // Block 0x67, offset 0x2d5 - {value: 0x0016, lo: 0x85, hi: 0x86}, - {value: 0x0012, lo: 0x87, hi: 0x89}, - {value: 0x9d52, lo: 0x8e, hi: 0x8e}, - {value: 0x1013, lo: 0xa0, hi: 0xaf}, - {value: 0x1012, lo: 0xb0, hi: 0xbf}, - // Block 0x68, offset 0x2da - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x88}, - // Block 0x69, offset 0x2dd - {value: 0xa053, lo: 0xb6, hi: 0xb7}, - {value: 0xa353, lo: 0xb8, hi: 0xb9}, - {value: 0xa653, lo: 0xba, hi: 0xbb}, - {value: 0xa353, lo: 0xbc, hi: 0xbd}, - {value: 0xa053, lo: 0xbe, hi: 0xbf}, - // Block 0x6a, offset 0x2e2 - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6553, lo: 0x90, hi: 0x9f}, - {value: 0xa953, lo: 0xa0, hi: 0xae}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0x6b, offset 0x2e6 - {value: 0x0117, lo: 0x80, hi: 0xa3}, - {value: 0x0012, lo: 0xa4, hi: 0xa4}, - {value: 0x0716, lo: 0xab, hi: 0xac}, - {value: 0x0316, lo: 0xad, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb3}, - // Block 0x6c, offset 0x2ec - {value: 0x6c52, lo: 0x80, hi: 0x9f}, - {value: 0x7052, lo: 0xa0, hi: 0xa5}, - {value: 0x7052, lo: 0xa7, hi: 0xa7}, - {value: 0x7052, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x6d, offset 0x2f1 - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x6e, offset 0x2f4 - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0010, lo: 0xb0, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x6f, offset 0x2f9 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9e}, - {value: 0x0024, lo: 0xa0, hi: 0xbf}, - // Block 0x70, offset 0x2fe - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - // Block 0x71, offset 0x2ff - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0xaa, hi: 0xad}, - {value: 0x0030, lo: 0xae, hi: 0xaf}, - {value: 0x0004, lo: 0xb1, hi: 0xb5}, - {value: 0x0014, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - // Block 0x72, offset 0x305 - {value: 0x0034, lo: 0x99, hi: 0x9a}, - {value: 0x0004, lo: 0x9b, hi: 0x9e}, - // Block 0x73, offset 0x307 - {value: 0x0004, lo: 0xbc, hi: 0xbe}, - // Block 0x74, offset 0x308 - {value: 0x0010, lo: 0x85, hi: 0xae}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x75, offset 0x30a - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0010, lo: 0xa0, hi: 0xba}, - // Block 0x76, offset 0x30c - {value: 0x0010, lo: 0x80, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0xbf}, - // Block 0x77, offset 0x30f - {value: 0x0010, lo: 0x80, hi: 0x8c}, - // Block 0x78, offset 0x310 - {value: 0x0010, lo: 0x90, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x79, offset 0x312 - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0xab}, - // Block 0x7a, offset 0x315 - {value: 0x0117, lo: 0x80, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb2}, - {value: 0x0024, lo: 0xb4, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x7b, offset 0x31b - {value: 0x0117, lo: 0x80, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9d}, - {value: 0x0024, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x7c, offset 0x31f - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb1}, - // Block 0x7d, offset 0x321 - {value: 0x0004, lo: 0x80, hi: 0x96}, - {value: 0x0014, lo: 0x97, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xaf}, - {value: 0x0012, lo: 0xb0, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xbf}, - // Block 0x7e, offset 0x326 - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x0015, lo: 0xb0, hi: 0xb0}, - {value: 0x0012, lo: 0xb1, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x8453, lo: 0xbd, hi: 0xbd}, - {value: 0x0117, lo: 0xbe, hi: 0xbf}, - // Block 0x7f, offset 0x32d - {value: 0x0010, lo: 0xb7, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbf}, - // Block 0x80, offset 0x331 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x8c, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - // Block 0x81, offset 0x33a - {value: 0x0010, lo: 0x80, hi: 0xb3}, - // Block 0x82, offset 0x33b - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xa0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb7}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x83, offset 0x343 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x84, offset 0x347 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0x92}, - {value: 0x0030, lo: 0x93, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0x85, offset 0x34c - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb9}, - {value: 0x0010, lo: 0xba, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x86, offset 0x354 - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0004, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x87, offset 0x35a - {value: 0x0010, lo: 0x80, hi: 0xa8}, - {value: 0x0014, lo: 0xa9, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0x88, offset 0x360 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x89, offset 0x36a - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0024, lo: 0xbe, hi: 0xbf}, - // Block 0x8a, offset 0x36f - {value: 0x0024, lo: 0x81, hi: 0x81}, - {value: 0x0004, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - // Block 0x8b, offset 0x378 - {value: 0x0010, lo: 0x81, hi: 0x86}, - {value: 0x0010, lo: 0x89, hi: 0x8e}, - {value: 0x0010, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x8c, offset 0x37e - {value: 0x0012, lo: 0x80, hi: 0x92}, - {value: 0xac52, lo: 0x93, hi: 0x93}, - {value: 0x0012, lo: 0x94, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9f}, - {value: 0x0012, lo: 0xa0, hi: 0xa5}, - {value: 0x74d2, lo: 0xb0, hi: 0xbf}, - // Block 0x8d, offset 0x385 - {value: 0x78d2, lo: 0x80, hi: 0x8f}, - {value: 0x7cd2, lo: 0x90, hi: 0x9f}, - {value: 0x80d2, lo: 0xa0, hi: 0xaf}, - {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, - // Block 0x8e, offset 0x389 - {value: 0x0010, lo: 0x80, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x8f, offset 0x391 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x90, offset 0x393 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x8b, hi: 0xbb}, - // Block 0x91, offset 0x395 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0xbf}, - // Block 0x92, offset 0x398 - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0004, lo: 0xb2, hi: 0xbf}, - // Block 0x93, offset 0x39a - {value: 0x0004, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x93, hi: 0xbf}, - // Block 0x94, offset 0x39c - {value: 0x0010, lo: 0x80, hi: 0xbd}, - // Block 0x95, offset 0x39d - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0x96, offset 0x39e - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0xbf}, - // Block 0x97, offset 0x3a0 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0xb0, hi: 0xbb}, - // Block 0x98, offset 0x3a2 - {value: 0x0014, lo: 0x80, hi: 0x8f}, - {value: 0x0054, lo: 0x93, hi: 0x93}, - {value: 0x0024, lo: 0xa0, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xad}, - {value: 0x0024, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - // Block 0x99, offset 0x3a8 - {value: 0x0010, lo: 0x8d, hi: 0x8f}, - {value: 0x0054, lo: 0x92, hi: 0x92}, - {value: 0x0054, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0xb0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0x9a, offset 0x3ad - {value: 0x0010, lo: 0x80, hi: 0xbc}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x9b, offset 0x3af - {value: 0x0054, lo: 0x87, hi: 0x87}, - {value: 0x0054, lo: 0x8e, hi: 0x8e}, - {value: 0x0054, lo: 0x9a, hi: 0x9a}, - {value: 0x5f53, lo: 0xa1, hi: 0xba}, - {value: 0x0004, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9c, offset 0x3b5 - {value: 0x0004, lo: 0x80, hi: 0x80}, - {value: 0x5f52, lo: 0x81, hi: 0x9a}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - // Block 0x9d, offset 0x3b8 - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbe}, - // Block 0x9e, offset 0x3ba - {value: 0x0010, lo: 0x82, hi: 0x87}, - {value: 0x0010, lo: 0x8a, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0x97}, - {value: 0x0010, lo: 0x9a, hi: 0x9c}, - {value: 0x0004, lo: 0xa3, hi: 0xa3}, - {value: 0x0014, lo: 0xb9, hi: 0xbb}, - // Block 0x9f, offset 0x3c0 - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0010, lo: 0x8d, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xba}, - {value: 0x0010, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xa0, offset 0x3c5 - {value: 0x0010, lo: 0x80, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x9d}, - // Block 0xa1, offset 0x3c7 - {value: 0x0010, lo: 0x80, hi: 0xba}, - // Block 0xa2, offset 0x3c8 - {value: 0x0010, lo: 0x80, hi: 0xb4}, - // Block 0xa3, offset 0x3c9 - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0xa4, offset 0x3ca - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa5, offset 0x3cc - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - // Block 0xa6, offset 0x3ce - {value: 0x0010, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xad, hi: 0xbf}, - // Block 0xa7, offset 0x3d0 - {value: 0x0010, lo: 0x80, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0xb5}, - {value: 0x0024, lo: 0xb6, hi: 0xba}, - // Block 0xa8, offset 0x3d3 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa9, offset 0x3d5 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x91, hi: 0x95}, - // Block 0xaa, offset 0x3d8 - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x97}, - {value: 0xaf53, lo: 0x98, hi: 0x9f}, - {value: 0xb253, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbf}, - // Block 0xab, offset 0x3e0 - {value: 0xaf52, lo: 0x80, hi: 0x87}, - {value: 0xb252, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0xac, offset 0x3e3 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0xb253, lo: 0xb0, hi: 0xb7}, - {value: 0xaf53, lo: 0xb8, hi: 0xbf}, - // Block 0xad, offset 0x3e7 - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x93}, - {value: 0xb252, lo: 0x98, hi: 0x9f}, - {value: 0xaf52, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbb}, - // Block 0xae, offset 0x3ef - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xaf, offset 0x3f1 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - // Block 0xb0, offset 0x3f2 - {value: 0x0010, lo: 0x80, hi: 0xb6}, - // Block 0xb1, offset 0x3f3 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xa7}, - // Block 0xb2, offset 0x3f5 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xb5}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xb3, offset 0x3fb - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xb4, offset 0x3fd - {value: 0x0010, lo: 0x80, hi: 0x9e}, - // Block 0xb5, offset 0x3fe - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - // Block 0xb6, offset 0x400 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb9}, - // Block 0xb7, offset 0x402 - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0xb8, offset 0x404 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x8e, hi: 0x8e}, - {value: 0x0024, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x99, hi: 0xb3}, - {value: 0x0024, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xb9, offset 0x411 - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0xba, offset 0x412 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - // Block 0xbb, offset 0x413 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - // Block 0xbc, offset 0x417 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - // Block 0xbd, offset 0x419 - {value: 0x0010, lo: 0x80, hi: 0x91}, - // Block 0xbe, offset 0x41a - {value: 0x0010, lo: 0x80, hi: 0x88}, - // Block 0xbf, offset 0x41b - {value: 0x5653, lo: 0x80, hi: 0xb2}, - // Block 0xc0, offset 0x41c - {value: 0x5652, lo: 0x80, hi: 0xb2}, - // Block 0xc1, offset 0x41d - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xc2, offset 0x421 - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xc3, offset 0x425 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb6}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - // Block 0xc4, offset 0x42b - {value: 0x0010, lo: 0x90, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xc5, offset 0x42d - {value: 0x0024, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0xc6, offset 0x434 - {value: 0x0010, lo: 0x90, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - // Block 0xc7, offset 0x437 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xc8, offset 0x43b - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - // Block 0xc9, offset 0x441 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb4}, - {value: 0x0030, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xb7}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0xca, offset 0x44a - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xcb, offset 0x450 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa2}, - {value: 0x0014, lo: 0xa3, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xcc, offset 0x456 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xcd, offset 0x460 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0030, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9d, hi: 0xa3}, - {value: 0x0024, lo: 0xa6, hi: 0xac}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - // Block 0xce, offset 0x46a - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xcf, offset 0x46c - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd0, offset 0x473 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xd1, offset 0x479 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd2, offset 0x47f - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd3, offset 0x485 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x98, hi: 0x9b}, - {value: 0x0014, lo: 0x9c, hi: 0x9d}, - // Block 0xd4, offset 0x488 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd5, offset 0x48e - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd6, offset 0x491 - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0014, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb5}, - {value: 0x0030, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0xd7, offset 0x499 - {value: 0x0010, lo: 0x80, hi: 0x89}, - // Block 0xd8, offset 0x49a - {value: 0x0014, lo: 0x9d, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xd9, offset 0x4a1 - {value: 0x5f53, lo: 0xa0, hi: 0xbf}, - // Block 0xda, offset 0x4a2 - {value: 0x5f52, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xdb, offset 0x4a5 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x89, hi: 0x8a}, - {value: 0x0010, lo: 0x8b, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbb, hi: 0xbe}, - // Block 0xdc, offset 0x4af - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0014, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x98}, - {value: 0x0014, lo: 0x99, hi: 0x9b}, - {value: 0x0010, lo: 0x9c, hi: 0xbf}, - // Block 0xdd, offset 0x4b5 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x86, hi: 0x89}, - {value: 0x0014, lo: 0x8a, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x99}, - // Block 0xde, offset 0x4bb - {value: 0x0010, lo: 0x80, hi: 0xb8}, - // Block 0xdf, offset 0x4bc - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb6}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xe0, offset 0x4c2 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0xe1, offset 0x4c5 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0014, lo: 0x92, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xa9}, - {value: 0x0014, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0xe2, offset 0x4cd - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb6}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xe3, offset 0x4d4 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xe4, offset 0x4db - {value: 0x0010, lo: 0x80, hi: 0x99}, - // Block 0xe5, offset 0x4dc - {value: 0x0010, lo: 0x80, hi: 0xae}, - // Block 0xe6, offset 0x4dd - {value: 0x0010, lo: 0x80, hi: 0x83}, - // Block 0xe7, offset 0x4de - {value: 0x0010, lo: 0x80, hi: 0x86}, - // Block 0xe8, offset 0x4df - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xe9, offset 0x4e1 - {value: 0x0010, lo: 0x90, hi: 0xad}, - {value: 0x0034, lo: 0xb0, hi: 0xb4}, - // Block 0xea, offset 0x4e3 - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb6}, - // Block 0xeb, offset 0x4e5 - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa3, hi: 0xb7}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xec, offset 0x4e9 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - // Block 0xed, offset 0x4ea - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0010, lo: 0x90, hi: 0xbe}, - // Block 0xee, offset 0x4ec - {value: 0x0014, lo: 0x8f, hi: 0x9f}, - // Block 0xef, offset 0x4ed - {value: 0x0014, lo: 0xa0, hi: 0xa1}, - // Block 0xf0, offset 0x4ee - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbc}, - // Block 0xf1, offset 0x4f0 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0034, lo: 0x9e, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa3}, - // Block 0xf2, offset 0x4f5 - {value: 0x0030, lo: 0xa5, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xa9}, - {value: 0x0030, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbf}, - // Block 0xf3, offset 0x4fa - {value: 0x0034, lo: 0x80, hi: 0x82}, - {value: 0x0024, lo: 0x85, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8b}, - {value: 0x0024, lo: 0xaa, hi: 0xad}, - // Block 0xf4, offset 0x4fe - {value: 0x0024, lo: 0x82, hi: 0x84}, - // Block 0xf5, offset 0x4ff - {value: 0x0013, lo: 0x80, hi: 0x99}, - {value: 0x0012, lo: 0x9a, hi: 0xb3}, - {value: 0x0013, lo: 0xb4, hi: 0xbf}, - // Block 0xf6, offset 0x502 - {value: 0x0013, lo: 0x80, hi: 0x8d}, - {value: 0x0012, lo: 0x8e, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0xa7}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0xf7, offset 0x506 - {value: 0x0013, lo: 0x80, hi: 0x81}, - {value: 0x0012, lo: 0x82, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0x9c}, - {value: 0x0013, lo: 0x9e, hi: 0x9f}, - {value: 0x0013, lo: 0xa2, hi: 0xa2}, - {value: 0x0013, lo: 0xa5, hi: 0xa6}, - {value: 0x0013, lo: 0xa9, hi: 0xac}, - {value: 0x0013, lo: 0xae, hi: 0xb5}, - {value: 0x0012, lo: 0xb6, hi: 0xb9}, - {value: 0x0012, lo: 0xbb, hi: 0xbb}, - {value: 0x0012, lo: 0xbd, hi: 0xbf}, - // Block 0xf8, offset 0x511 - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0012, lo: 0x85, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0xf9, offset 0x515 - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0013, lo: 0x84, hi: 0x85}, - {value: 0x0013, lo: 0x87, hi: 0x8a}, - {value: 0x0013, lo: 0x8d, hi: 0x94}, - {value: 0x0013, lo: 0x96, hi: 0x9c}, - {value: 0x0012, lo: 0x9e, hi: 0xb7}, - {value: 0x0013, lo: 0xb8, hi: 0xb9}, - {value: 0x0013, lo: 0xbb, hi: 0xbe}, - // Block 0xfa, offset 0x51d - {value: 0x0013, lo: 0x80, hi: 0x84}, - {value: 0x0013, lo: 0x86, hi: 0x86}, - {value: 0x0013, lo: 0x8a, hi: 0x90}, - {value: 0x0012, lo: 0x92, hi: 0xab}, - {value: 0x0013, lo: 0xac, hi: 0xbf}, - // Block 0xfb, offset 0x522 - {value: 0x0013, lo: 0x80, hi: 0x85}, - {value: 0x0012, lo: 0x86, hi: 0x9f}, - {value: 0x0013, lo: 0xa0, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbf}, - // Block 0xfc, offset 0x526 - {value: 0x0012, lo: 0x80, hi: 0x93}, - {value: 0x0013, lo: 0x94, hi: 0xad}, - {value: 0x0012, lo: 0xae, hi: 0xbf}, - // Block 0xfd, offset 0x529 - {value: 0x0012, lo: 0x80, hi: 0x87}, - {value: 0x0013, lo: 0x88, hi: 0xa1}, - {value: 0x0012, lo: 0xa2, hi: 0xbb}, - {value: 0x0013, lo: 0xbc, hi: 0xbf}, - // Block 0xfe, offset 0x52d - {value: 0x0013, lo: 0x80, hi: 0x95}, - {value: 0x0012, lo: 0x96, hi: 0xaf}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0xff, offset 0x530 - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0012, lo: 0x8a, hi: 0xa5}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0x100, offset 0x533 - {value: 0x0013, lo: 0x80, hi: 0x80}, - {value: 0x0012, lo: 0x82, hi: 0x9a}, - {value: 0x0012, lo: 0x9c, hi: 0xa1}, - {value: 0x0013, lo: 0xa2, hi: 0xba}, - {value: 0x0012, lo: 0xbc, hi: 0xbf}, - // Block 0x101, offset 0x538 - {value: 0x0012, lo: 0x80, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0xb4}, - {value: 0x0012, lo: 0xb6, hi: 0xbf}, - // Block 0x102, offset 0x53c - {value: 0x0012, lo: 0x80, hi: 0x8e}, - {value: 0x0012, lo: 0x90, hi: 0x95}, - {value: 0x0013, lo: 0x96, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x103, offset 0x540 - {value: 0x0012, lo: 0x80, hi: 0x88}, - {value: 0x0012, lo: 0x8a, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0x104, offset 0x544 - {value: 0x0012, lo: 0x80, hi: 0x82}, - {value: 0x0012, lo: 0x84, hi: 0x89}, - {value: 0x0017, lo: 0x8a, hi: 0x8b}, - {value: 0x0010, lo: 0x8e, hi: 0xbf}, - // Block 0x105, offset 0x548 - {value: 0x0014, lo: 0x80, hi: 0xb6}, - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x106, offset 0x54a - {value: 0x0014, lo: 0x80, hi: 0xac}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x107, offset 0x54c - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x9b, hi: 0x9f}, - {value: 0x0014, lo: 0xa1, hi: 0xaf}, - // Block 0x108, offset 0x54f - {value: 0x0024, lo: 0x80, hi: 0x86}, - {value: 0x0024, lo: 0x88, hi: 0x98}, - {value: 0x0024, lo: 0x9b, hi: 0xa1}, - {value: 0x0024, lo: 0xa3, hi: 0xa4}, - {value: 0x0024, lo: 0xa6, hi: 0xaa}, - // Block 0x109, offset 0x554 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0034, lo: 0x90, hi: 0x96}, - // Block 0x10a, offset 0x556 - {value: 0xb552, lo: 0x80, hi: 0x81}, - {value: 0xb852, lo: 0x82, hi: 0x83}, - {value: 0x0024, lo: 0x84, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x10b, offset 0x55b - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x9f}, - {value: 0x0010, lo: 0xa1, hi: 0xa2}, - {value: 0x0010, lo: 0xa4, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb7}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - // Block 0x10c, offset 0x564 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x9b}, - {value: 0x0010, lo: 0xa1, hi: 0xa3}, - {value: 0x0010, lo: 0xa5, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xbb}, - // Block 0x10d, offset 0x569 - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x10e, offset 0x56a - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x10f, offset 0x56d - {value: 0x0013, lo: 0x80, hi: 0x89}, - // Block 0x110, offset 0x56e - {value: 0x0004, lo: 0xbb, hi: 0xbf}, - // Block 0x111, offset 0x56f - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0014, lo: 0xa0, hi: 0xbf}, - // Block 0x112, offset 0x571 - {value: 0x0014, lo: 0x80, hi: 0xbf}, - // Block 0x113, offset 0x572 - {value: 0x0014, lo: 0x80, hi: 0xaf}, -} - -// Total table size 14177 bytes (13KiB); checksum: F17D40E8 diff --git a/vendor/golang.org/x/text/cases/tables11.0.0.go b/vendor/golang.org/x/text/cases/tables11.0.0.go deleted file mode 100644 index b1106b4171..0000000000 --- a/vendor/golang.org/x/text/cases/tables11.0.0.go +++ /dev/null @@ -1,2317 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -//go:build go1.13 && !go1.14 -// +build go1.13,!go1.14 - -package cases - -// UnicodeVersion is the Unicode version from which the tables in this package are derived. -const UnicodeVersion = "11.0.0" - -var xorData string = "" + // Size: 188 bytes - "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + - "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + - "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + - "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + - "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + - "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + - "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a" + - "\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&" + - "\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00" + - "\x01\x22" - -var exceptions string = "" + // Size: 2436 bytes - "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + - "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + - "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + - "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + - "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + - "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + - "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + - "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა\x10\x1bᲑბ" + - "\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ\x10\x1bᲘი" + - "\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ\x10\x1bᲟჟ" + - "\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ\x10\x1bᲦღ" + - "\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ\x10\x1bᲭჭ" + - "\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ\x10\x1bᲴჴ" + - "\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ\x10\x1bᲽჽ" + - "\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12сСС\x12\x12" + - "тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗ" + - "T̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14" + - "$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ" + - "\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈ" + - "Ι\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15" + - "\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ" + - "\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ" + - "\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠι" + - "ὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧι" + - "ὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ" + - "\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ" + - "\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ" + - "\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΙ" + - "̈́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓" + - "\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x16" + - "6ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12\x10ɫɫ\x12\x10ɽ" + - "ɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ" + - "\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ" + - "\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFFFf\x12\x12fiFIFi\x12\x12flFLFl" + - "\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12stSTSt\x12\x12stSTSt\x14$մնՄՆՄ" + - "ն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄխ" - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// caseTrie. Total size: 12250 bytes (11.96 KiB). Checksum: 53ff6cb7321675e1. -type caseTrie struct{} - -func newCaseTrie(i int) *caseTrie { - return &caseTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { - switch { - case n < 20: - return uint16(caseValues[n<<6+uint32(b)]) - default: - n -= 20 - return uint16(sparse.lookup(n, b)) - } -} - -// caseValues: 22 blocks, 1408 entries, 2816 bytes -// The third block is the zero block. -var caseValues = [1408]uint16{ - // Block 0x0, offset 0x0 - 0x27: 0x0054, - 0x2e: 0x0054, - 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, - 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, - // Block 0x1, offset 0x40 - 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, - 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, - 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, - 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, - 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, - 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, - 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, - 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, - 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, - 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, - 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, - 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, - 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, - 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, - 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, - 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, - 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, - 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, - 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, - 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, - // Block 0x4, offset 0x100 - 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, - 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, - 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, - 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, - 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, - 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, - 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, - 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, - 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, - 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, - 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, - // Block 0x5, offset 0x140 - 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, - 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, - 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, - 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, - 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, - 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, - 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, - 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, - 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, - 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, - 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, - // Block 0x6, offset 0x180 - 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, - 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, - 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, - 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, - 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, - 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, - 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, - 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, - 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, - 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, - 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, - 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, - 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, - 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, - 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, - 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, - 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, - 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, - 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, - 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, - 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, - // Block 0x8, offset 0x200 - 0x204: 0x0004, 0x205: 0x0004, - 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, - 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, - 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, - 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, - 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, - 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, - 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, - 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, - 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, - 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, - // Block 0x9, offset 0x240 - 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, - 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, - 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, - 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, - 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, - 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, - 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, - 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, - 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, - 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, - 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, - // Block 0xa, offset 0x280 - 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, - 0x286: 0x6852, 0x287: 0x198a, 0x288: 0x0012, - 0x291: 0x0034, - 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, - 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, - 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, - 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, - 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, - 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, - 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, - 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, - 0x2c7: 0x7053, - 0x2cd: 0x7053, 0x2d0: 0x1a6a, 0x2d1: 0x1aea, - 0x2d2: 0x1b6a, 0x2d3: 0x1bea, 0x2d4: 0x1c6a, 0x2d5: 0x1cea, 0x2d6: 0x1d6a, 0x2d7: 0x1dea, - 0x2d8: 0x1e6a, 0x2d9: 0x1eea, 0x2da: 0x1f6a, 0x2db: 0x1fea, 0x2dc: 0x206a, 0x2dd: 0x20ea, - 0x2de: 0x216a, 0x2df: 0x21ea, 0x2e0: 0x226a, 0x2e1: 0x22ea, 0x2e2: 0x236a, 0x2e3: 0x23ea, - 0x2e4: 0x246a, 0x2e5: 0x24ea, 0x2e6: 0x256a, 0x2e7: 0x25ea, 0x2e8: 0x266a, 0x2e9: 0x26ea, - 0x2ea: 0x276a, 0x2eb: 0x27ea, 0x2ec: 0x286a, 0x2ed: 0x28ea, 0x2ee: 0x296a, 0x2ef: 0x29ea, - 0x2f0: 0x2a6a, 0x2f1: 0x2aea, 0x2f2: 0x2b6a, 0x2f3: 0x2bea, 0x2f4: 0x2c6a, 0x2f5: 0x2cea, - 0x2f6: 0x2d6a, 0x2f7: 0x2dea, 0x2f8: 0x2e6a, 0x2f9: 0x2eea, 0x2fa: 0x2f6a, - 0x2fc: 0x0014, 0x2fd: 0x2fea, 0x2fe: 0x306a, 0x2ff: 0x30ea, - // Block 0xc, offset 0x300 - 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, - 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, - 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3a9a, 0x311: 0x0812, - 0x312: 0x3b7a, 0x313: 0x0812, 0x314: 0x3cba, 0x315: 0x0812, 0x316: 0x3dfa, 0x317: 0x0812, - 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, - 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, - 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, - 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, - 0x330: 0x8e52, 0x331: 0x8e52, 0x332: 0x9152, 0x333: 0x9152, 0x334: 0x9452, 0x335: 0x9452, - 0x336: 0x9752, 0x337: 0x9752, 0x338: 0x9a52, 0x339: 0x9a52, 0x33a: 0x9d52, 0x33b: 0x9d52, - 0x33c: 0x4d52, 0x33d: 0x4d52, - // Block 0xd, offset 0x340 - 0x340: 0x3f3a, 0x341: 0x402a, 0x342: 0x411a, 0x343: 0x420a, 0x344: 0x42fa, 0x345: 0x43ea, - 0x346: 0x44da, 0x347: 0x45ca, 0x348: 0x46b9, 0x349: 0x47a9, 0x34a: 0x4899, 0x34b: 0x4989, - 0x34c: 0x4a79, 0x34d: 0x4b69, 0x34e: 0x4c59, 0x34f: 0x4d49, 0x350: 0x4e3a, 0x351: 0x4f2a, - 0x352: 0x501a, 0x353: 0x510a, 0x354: 0x51fa, 0x355: 0x52ea, 0x356: 0x53da, 0x357: 0x54ca, - 0x358: 0x55b9, 0x359: 0x56a9, 0x35a: 0x5799, 0x35b: 0x5889, 0x35c: 0x5979, 0x35d: 0x5a69, - 0x35e: 0x5b59, 0x35f: 0x5c49, 0x360: 0x5d3a, 0x361: 0x5e2a, 0x362: 0x5f1a, 0x363: 0x600a, - 0x364: 0x60fa, 0x365: 0x61ea, 0x366: 0x62da, 0x367: 0x63ca, 0x368: 0x64b9, 0x369: 0x65a9, - 0x36a: 0x6699, 0x36b: 0x6789, 0x36c: 0x6879, 0x36d: 0x6969, 0x36e: 0x6a59, 0x36f: 0x6b49, - 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6c3a, 0x373: 0x6d4a, 0x374: 0x6e1a, - 0x376: 0x6efa, 0x377: 0x6fda, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x8e53, 0x37b: 0x8e53, - 0x37c: 0x7119, 0x37d: 0x0004, 0x37e: 0x71ea, 0x37f: 0x0004, - // Block 0xe, offset 0x380 - 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x726a, 0x383: 0x737a, 0x384: 0x744a, - 0x386: 0x752a, 0x387: 0x760a, 0x388: 0x9153, 0x389: 0x9153, 0x38a: 0x9453, 0x38b: 0x9453, - 0x38c: 0x7749, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, - 0x392: 0x781a, 0x393: 0x795a, 0x396: 0x7a9a, 0x397: 0x7b7a, - 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9753, 0x39b: 0x9753, 0x39d: 0x0004, - 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7cba, 0x3a3: 0x7dfa, - 0x3a4: 0x7f3a, 0x3a5: 0x0912, 0x3a6: 0x801a, 0x3a7: 0x80fa, 0x3a8: 0x0813, 0x3a9: 0x0813, - 0x3aa: 0x9d53, 0x3ab: 0x9d53, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, - 0x3b2: 0x823a, 0x3b3: 0x834a, 0x3b4: 0x841a, - 0x3b6: 0x84fa, 0x3b7: 0x85da, 0x3b8: 0x9a53, 0x3b9: 0x9a53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, - 0x3bc: 0x8719, 0x3bd: 0x0004, 0x3be: 0x0004, - // Block 0xf, offset 0x3c0 - 0x3c2: 0x0013, - 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, - 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, - 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, - 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, - 0x3e4: 0x0013, 0x3e6: 0x87eb, 0x3e8: 0x0013, - 0x3ea: 0x884b, 0x3eb: 0x888b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, - 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa053, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, - 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, - 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, - // Block 0x10, offset 0x400 - 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, - 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, - 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa352, 0x411: 0xa352, - 0x412: 0xa652, 0x413: 0xa652, 0x414: 0xa952, 0x415: 0xa952, 0x416: 0xa652, 0x417: 0xa652, - 0x418: 0xa352, 0x419: 0xa352, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, - 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, - 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, - // Block 0x11, offset 0x440 - 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, - 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, - 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xac52, 0x451: 0xac52, - 0x452: 0xac52, 0x453: 0xac52, 0x454: 0xac52, 0x455: 0xac52, 0x456: 0xac52, 0x457: 0xac52, - 0x458: 0xac52, 0x459: 0xac52, 0x45a: 0xac52, 0x45b: 0xac52, 0x45c: 0xac52, 0x45d: 0xac52, - 0x45e: 0xac52, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x88eb, 0x463: 0x8b53, - 0x464: 0x894b, 0x465: 0x89aa, 0x466: 0x8a0a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, - 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8a6b, 0x46e: 0x8acb, 0x46f: 0x8b2b, - 0x470: 0x8b8b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, - 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, - 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8beb, 0x47f: 0x8c4b, - // Block 0x12, offset 0x480 - 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, - 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, - 0x48c: 0x0712, 0x48d: 0x8cab, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, - 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x0012, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, - 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, - 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, - 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, - 0x4aa: 0x8d0b, 0x4ab: 0x8d6b, 0x4ac: 0x8dcb, 0x4ad: 0x8e2b, 0x4ae: 0x8e8b, 0x4af: 0x0012, - 0x4b0: 0x8eeb, 0x4b1: 0x8f4b, 0x4b2: 0x8fab, 0x4b3: 0xaf53, 0x4b4: 0x0113, 0x4b5: 0x0112, - 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, - // Block 0x13, offset 0x4c0 - 0x4c0: 0x900a, 0x4c1: 0x908a, 0x4c2: 0x910a, 0x4c3: 0x918a, 0x4c4: 0x923a, 0x4c5: 0x92ea, - 0x4c6: 0x936a, - 0x4d3: 0x93ea, 0x4d4: 0x94ca, 0x4d5: 0x95aa, 0x4d6: 0x968a, 0x4d7: 0x976a, - 0x4dd: 0x0010, - 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, - 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, - 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, - 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, - 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, - 0x4fc: 0x0010, 0x4fe: 0x0010, - // Block 0x14, offset 0x500 - 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, - 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, - 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, - 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, - 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, - 0x51e: 0xb853, 0x51f: 0xb853, 0x520: 0xbb53, 0x521: 0xbb53, 0x522: 0x2212, 0x523: 0x2212, - 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, - 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, - 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, - 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, - 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, - // Block 0x15, offset 0x540 - 0x542: 0x0010, - 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, - 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, - 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, - 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, - 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, - 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, - 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, - 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, - 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, - 0x57c: 0x0010, 0x57e: 0x0010, -} - -// caseIndex: 25 blocks, 1600 entries, 3200 bytes -// Block 0 is the zero block. -var caseIndex = [1600]uint16{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, - 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, - 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, - 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, - 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, - 0xf0: 0x14, 0xf3: 0x16, - // Block 0x4, offset 0x100 - 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, - 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, - 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, - 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, - // Block 0x5, offset 0x140 - 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, - 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, - 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, - 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, - 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, - 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, - 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, - 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, - // Block 0x6, offset 0x180 - 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0d, 0x185: 0x79, 0x186: 0x7a, - 0x192: 0x7b, 0x193: 0x0e, - 0x1b0: 0x7c, 0x1b1: 0x0f, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, - 0x1b8: 0x82, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x24, 0x1c6: 0x87, - // Block 0x8, offset 0x200 - 0x200: 0x88, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, - 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, - 0x210: 0x24, 0x211: 0x24, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, - 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x10, 0x21f: 0x91, - 0x220: 0x92, 0x221: 0x93, 0x222: 0x24, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, - 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, - 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, - 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, - // Block 0x9, offset 0x240 - 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, - 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, - 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, - 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, - 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, - 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, - 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, - 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, - // Block 0xa, offset 0x280 - 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, - 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, - 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, - 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa1, 0x29f: 0xa2, - // Block 0xb, offset 0x2c0 - 0x2ec: 0x11, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, - 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, - 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x24, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, - // Block 0xc, offset 0x300 - 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x24, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, - 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, - 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, - 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc2, 0x31d: 0xc3, - 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, - 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, - 0x330: 0x24, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, 0x334: 0xd3, - 0x33c: 0xd4, 0x33d: 0xd5, - // Block 0xd, offset 0x340 - 0x340: 0xd6, 0x341: 0xd7, 0x342: 0xd8, 0x343: 0xd9, 0x344: 0xda, 0x345: 0xdb, 0x346: 0xdc, 0x347: 0xdd, - 0x348: 0xde, 0x34a: 0xdf, 0x34b: 0xe0, 0x34c: 0xe1, 0x34d: 0xe2, - 0x350: 0xe3, 0x351: 0xe4, 0x352: 0xe5, 0x353: 0xe6, 0x356: 0xe7, 0x357: 0xe8, - 0x358: 0xe9, 0x359: 0xea, 0x35a: 0xeb, 0x35b: 0xec, 0x35c: 0xed, - 0x360: 0xee, 0x362: 0xef, 0x363: 0xf0, - 0x368: 0xf1, 0x369: 0xf2, 0x36a: 0xf3, 0x36b: 0xf4, - 0x370: 0xf5, 0x371: 0xf6, 0x372: 0xf7, 0x374: 0xf8, 0x375: 0xf9, 0x376: 0xfa, - 0x37b: 0xfb, - // Block 0xe, offset 0x380 - 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, - 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0xfc, - 0x390: 0x24, 0x391: 0xfd, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0xfe, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, - 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, - 0x3d0: 0xfd, - // Block 0x10, offset 0x400 - 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, - 0x418: 0x24, 0x419: 0xff, - // Block 0x11, offset 0x440 - 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, - 0x468: 0xf4, 0x469: 0x100, 0x46b: 0x101, 0x46c: 0x102, 0x46d: 0x103, 0x46e: 0x104, - 0x479: 0x105, 0x47c: 0x24, 0x47d: 0x106, 0x47e: 0x107, 0x47f: 0x108, - // Block 0x12, offset 0x480 - 0x4b0: 0x24, 0x4b1: 0x109, 0x4b2: 0x10a, - // Block 0x13, offset 0x4c0 - 0x4c5: 0x10b, 0x4c6: 0x10c, - 0x4c9: 0x10d, - 0x4d0: 0x10e, 0x4d1: 0x10f, 0x4d2: 0x110, 0x4d3: 0x111, 0x4d4: 0x112, 0x4d5: 0x113, 0x4d6: 0x114, 0x4d7: 0x115, - 0x4d8: 0x116, 0x4d9: 0x117, 0x4da: 0x118, 0x4db: 0x119, 0x4dc: 0x11a, 0x4dd: 0x11b, 0x4de: 0x11c, 0x4df: 0x11d, - 0x4e8: 0x11e, 0x4e9: 0x11f, 0x4ea: 0x120, - // Block 0x14, offset 0x500 - 0x500: 0x121, - 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x122, 0x524: 0x12, 0x525: 0x123, - 0x538: 0x124, 0x539: 0x13, 0x53a: 0x125, - // Block 0x15, offset 0x540 - 0x544: 0x126, 0x545: 0x127, 0x546: 0x128, - 0x54f: 0x129, - // Block 0x16, offset 0x580 - 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, - 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, - // Block 0x17, offset 0x5c0 - 0x5c0: 0x12a, 0x5c1: 0x12b, 0x5c4: 0x12b, 0x5c5: 0x12b, 0x5c6: 0x12b, 0x5c7: 0x12c, - // Block 0x18, offset 0x600 - 0x620: 0x15, -} - -// sparseOffsets: 282 entries, 564 bytes -var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xbf, 0xc5, 0xd3, 0xde, 0xeb, 0xf6, 0x102, 0x10c, 0x118, 0x123, 0x12f, 0x13b, 0x143, 0x14c, 0x156, 0x161, 0x16d, 0x174, 0x17f, 0x184, 0x18c, 0x18f, 0x194, 0x198, 0x19c, 0x1a3, 0x1ac, 0x1b4, 0x1b5, 0x1be, 0x1c5, 0x1cd, 0x1d3, 0x1d8, 0x1dc, 0x1df, 0x1e1, 0x1e4, 0x1e9, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f7, 0x1fc, 0x200, 0x209, 0x20c, 0x20f, 0x215, 0x216, 0x221, 0x222, 0x223, 0x228, 0x235, 0x23d, 0x245, 0x24e, 0x257, 0x260, 0x265, 0x268, 0x273, 0x280, 0x282, 0x289, 0x28b, 0x297, 0x298, 0x2a3, 0x2ab, 0x2b3, 0x2b9, 0x2ba, 0x2c8, 0x2cd, 0x2d0, 0x2d5, 0x2d9, 0x2df, 0x2e4, 0x2e7, 0x2ec, 0x2f1, 0x2f2, 0x2f8, 0x2fa, 0x2fb, 0x2fd, 0x2ff, 0x302, 0x303, 0x305, 0x308, 0x30e, 0x312, 0x314, 0x319, 0x320, 0x324, 0x32d, 0x32e, 0x337, 0x33b, 0x340, 0x348, 0x34e, 0x354, 0x35e, 0x363, 0x36c, 0x372, 0x379, 0x37d, 0x385, 0x387, 0x389, 0x38c, 0x38e, 0x390, 0x391, 0x392, 0x394, 0x396, 0x39c, 0x3a1, 0x3a3, 0x3a9, 0x3ac, 0x3ae, 0x3b4, 0x3b9, 0x3bb, 0x3bc, 0x3bd, 0x3be, 0x3c0, 0x3c2, 0x3c4, 0x3c7, 0x3c9, 0x3cc, 0x3d4, 0x3d7, 0x3db, 0x3e3, 0x3e5, 0x3e6, 0x3e7, 0x3e9, 0x3ef, 0x3f1, 0x3f2, 0x3f4, 0x3f6, 0x3f8, 0x405, 0x406, 0x407, 0x40b, 0x40d, 0x40e, 0x40f, 0x410, 0x411, 0x414, 0x417, 0x41d, 0x421, 0x425, 0x42b, 0x42e, 0x435, 0x439, 0x43d, 0x444, 0x44d, 0x453, 0x459, 0x463, 0x46d, 0x46f, 0x477, 0x47d, 0x483, 0x489, 0x48c, 0x492, 0x495, 0x49d, 0x49e, 0x4a5, 0x4a9, 0x4aa, 0x4ad, 0x4b5, 0x4bb, 0x4c2, 0x4c3, 0x4c9, 0x4cc, 0x4d4, 0x4db, 0x4e5, 0x4ed, 0x4f0, 0x4f1, 0x4f2, 0x4f3, 0x4f4, 0x4f6, 0x4f8, 0x4fa, 0x4fe, 0x4ff, 0x501, 0x503, 0x504, 0x505, 0x507, 0x50c, 0x511, 0x515, 0x516, 0x519, 0x51d, 0x528, 0x52c, 0x534, 0x539, 0x53d, 0x540, 0x544, 0x547, 0x54a, 0x54f, 0x553, 0x557, 0x55b, 0x55f, 0x561, 0x563, 0x566, 0x56b, 0x56d, 0x572, 0x57b, 0x580, 0x581, 0x584, 0x585, 0x586, 0x588, 0x589, 0x58a} - -// sparseValues: 1418 entries, 5672 bytes -var sparseValues = [1418]valueRange{ - // Block 0x0, offset 0x0 - {value: 0x0004, lo: 0xa8, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xaa}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0004, lo: 0xaf, hi: 0xaf}, - {value: 0x0004, lo: 0xb4, hi: 0xb4}, - {value: 0x001a, lo: 0xb5, hi: 0xb5}, - {value: 0x0054, lo: 0xb7, hi: 0xb7}, - {value: 0x0004, lo: 0xb8, hi: 0xb8}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - // Block 0x1, offset 0x9 - {value: 0x2013, lo: 0x80, hi: 0x96}, - {value: 0x2013, lo: 0x98, hi: 0x9e}, - {value: 0x009a, lo: 0x9f, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xb6}, - {value: 0x2012, lo: 0xb8, hi: 0xbe}, - {value: 0x0252, lo: 0xbf, hi: 0xbf}, - // Block 0x2, offset 0xf - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x011b, lo: 0xb0, hi: 0xb0}, - {value: 0x019a, lo: 0xb1, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb7}, - {value: 0x0012, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x0553, lo: 0xbf, hi: 0xbf}, - // Block 0x3, offset 0x18 - {value: 0x0552, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x01da, lo: 0x89, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xb7}, - {value: 0x0253, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x028a, lo: 0xbf, hi: 0xbf}, - // Block 0x4, offset 0x24 - {value: 0x0117, lo: 0x80, hi: 0x9f}, - {value: 0x2f53, lo: 0xa0, hi: 0xa0}, - {value: 0x0012, lo: 0xa1, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xb3}, - {value: 0x0012, lo: 0xb4, hi: 0xb9}, - {value: 0x090b, lo: 0xba, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x2953, lo: 0xbd, hi: 0xbd}, - {value: 0x098b, lo: 0xbe, hi: 0xbe}, - {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, - // Block 0x5, offset 0x2e - {value: 0x0015, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x97}, - {value: 0x0004, lo: 0x98, hi: 0x9d}, - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0015, lo: 0xa0, hi: 0xa4}, - {value: 0x0004, lo: 0xa5, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xbf}, - // Block 0x6, offset 0x35 - {value: 0x0024, lo: 0x80, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbf}, - // Block 0x7, offset 0x38 - {value: 0x6553, lo: 0x80, hi: 0x8f}, - {value: 0x2013, lo: 0x90, hi: 0x9f}, - {value: 0x5f53, lo: 0xa0, hi: 0xaf}, - {value: 0x2012, lo: 0xb0, hi: 0xbf}, - // Block 0x8, offset 0x3c - {value: 0x5f52, lo: 0x80, hi: 0x8f}, - {value: 0x6552, lo: 0x90, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x9, offset 0x3f - {value: 0x0117, lo: 0x80, hi: 0x81}, - {value: 0x0024, lo: 0x83, hi: 0x87}, - {value: 0x0014, lo: 0x88, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xbf}, - // Block 0xa, offset 0x43 - {value: 0x0f13, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x0316, lo: 0x89, hi: 0x8a}, - {value: 0x0716, lo: 0x8b, hi: 0x8c}, - {value: 0x0316, lo: 0x8d, hi: 0x8e}, - {value: 0x0f12, lo: 0x8f, hi: 0x8f}, - {value: 0x0117, lo: 0x90, hi: 0xbf}, - // Block 0xb, offset 0x4d - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x6553, lo: 0xb1, hi: 0xbf}, - // Block 0xc, offset 0x4f - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6853, lo: 0x90, hi: 0x96}, - {value: 0x0014, lo: 0x99, hi: 0x99}, - {value: 0x0010, lo: 0x9b, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0012, lo: 0xa0, hi: 0xa0}, - {value: 0x6552, lo: 0xa1, hi: 0xaf}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0xd, offset 0x57 - {value: 0x0034, lo: 0x81, hi: 0x82}, - {value: 0x0024, lo: 0x84, hi: 0x84}, - {value: 0x0034, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0xaa}, - {value: 0x0010, lo: 0xaf, hi: 0xb3}, - {value: 0x0054, lo: 0xb4, hi: 0xb4}, - // Block 0xe, offset 0x5e - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0024, lo: 0x90, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0014, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xf, offset 0x63 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9c}, - {value: 0x0024, lo: 0x9d, hi: 0x9e}, - {value: 0x0034, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x10, offset 0x71 - {value: 0x0010, lo: 0x80, hi: 0xbf}, - // Block 0x11, offset 0x72 - {value: 0x0010, lo: 0x80, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0024, lo: 0x9f, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xaa, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x12, offset 0x80 - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0034, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0034, lo: 0xb1, hi: 0xb1}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbd}, - {value: 0x0034, lo: 0xbe, hi: 0xbe}, - {value: 0x0024, lo: 0xbf, hi: 0xbf}, - // Block 0x13, offset 0x8f - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0024, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x88}, - {value: 0x0024, lo: 0x89, hi: 0x8a}, - {value: 0x0010, lo: 0x8d, hi: 0xbf}, - // Block 0x14, offset 0x99 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x15, offset 0x9c - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xb1}, - {value: 0x0034, lo: 0xb2, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0x16, offset 0xa3 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x99}, - {value: 0x0014, lo: 0x9a, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0xa3}, - {value: 0x0014, lo: 0xa4, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xad}, - // Block 0x17, offset 0xab - {value: 0x0010, lo: 0x80, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x9b}, - {value: 0x0010, lo: 0xa0, hi: 0xaa}, - // Block 0x18, offset 0xae - {value: 0x0010, lo: 0xa0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbd}, - // Block 0x19, offset 0xb0 - {value: 0x0034, lo: 0x93, hi: 0x93}, - {value: 0x0024, lo: 0x94, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0024, lo: 0xaa, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbf}, - // Block 0x1a, offset 0xbf - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1b, offset 0xc5 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0x1c, offset 0xd3 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb6, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1d, offset 0xde - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xb1}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - // Block 0x1e, offset 0xeb - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x1f, offset 0xf6 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x99, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x20, offset 0x102 - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x21, offset 0x10c - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x85}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xbf}, - // Block 0x22, offset 0x118 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x23, offset 0x123 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x24, offset 0x12f - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0010, lo: 0xa8, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x25, offset 0x13b - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x26, offset 0x143 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb9}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbf}, - // Block 0x27, offset 0x14c - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x88}, - {value: 0x0014, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x28, offset 0x156 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x29, offset 0x161 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb2}, - // Block 0x2a, offset 0x16d - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x2b, offset 0x174 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x94, hi: 0x97}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xba, hi: 0xbf}, - // Block 0x2c, offset 0x17f - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x96}, - {value: 0x0010, lo: 0x9a, hi: 0xb1}, - {value: 0x0010, lo: 0xb3, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x2d, offset 0x184 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x94}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9f}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - // Block 0x2e, offset 0x18c - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xba}, - // Block 0x2f, offset 0x18f - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x30, offset 0x194 - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xb9}, - {value: 0x0014, lo: 0xbb, hi: 0xbc}, - // Block 0x31, offset 0x198 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x32, offset 0x19c - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0034, lo: 0x98, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0034, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x33, offset 0x1a3 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xac}, - {value: 0x0034, lo: 0xb1, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xba, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x34, offset 0x1ac - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0024, lo: 0x82, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x86, hi: 0x87}, - {value: 0x0010, lo: 0x88, hi: 0x8c}, - {value: 0x0014, lo: 0x8d, hi: 0x97}, - {value: 0x0014, lo: 0x99, hi: 0xbc}, - // Block 0x35, offset 0x1b4 - {value: 0x0034, lo: 0x86, hi: 0x86}, - // Block 0x36, offset 0x1b5 - {value: 0x0010, lo: 0xab, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbe}, - // Block 0x37, offset 0x1be - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x96, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x99}, - {value: 0x0014, lo: 0x9e, hi: 0xa0}, - {value: 0x0010, lo: 0xa2, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xad}, - {value: 0x0014, lo: 0xb1, hi: 0xb4}, - // Block 0x38, offset 0x1c5 - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x6c53, lo: 0xa0, hi: 0xbf}, - // Block 0x39, offset 0x1cd - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x9a, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x3a, offset 0x1d3 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x3b, offset 0x1d8 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x82, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3c, offset 0x1dc - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3d, offset 0x1df - {value: 0x0010, lo: 0x80, hi: 0x9a}, - {value: 0x0024, lo: 0x9d, hi: 0x9f}, - // Block 0x3e, offset 0x1e1 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x7453, lo: 0xa0, hi: 0xaf}, - {value: 0x7853, lo: 0xb0, hi: 0xbf}, - // Block 0x3f, offset 0x1e4 - {value: 0x7c53, lo: 0x80, hi: 0x8f}, - {value: 0x8053, lo: 0x90, hi: 0x9f}, - {value: 0x7c53, lo: 0xa0, hi: 0xaf}, - {value: 0x0813, lo: 0xb0, hi: 0xb5}, - {value: 0x0892, lo: 0xb8, hi: 0xbd}, - // Block 0x40, offset 0x1e9 - {value: 0x0010, lo: 0x81, hi: 0xbf}, - // Block 0x41, offset 0x1ea - {value: 0x0010, lo: 0x80, hi: 0xac}, - {value: 0x0010, lo: 0xaf, hi: 0xbf}, - // Block 0x42, offset 0x1ec - {value: 0x0010, lo: 0x81, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x43, offset 0x1ee - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb8}, - // Block 0x44, offset 0x1f0 - {value: 0x0010, lo: 0x80, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0034, lo: 0x94, hi: 0x94}, - {value: 0x0010, lo: 0xa0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - // Block 0x45, offset 0x1f7 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xac}, - {value: 0x0010, lo: 0xae, hi: 0xb0}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - // Block 0x46, offset 0x1fc - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x47, offset 0x200 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x89, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0014, lo: 0x93, hi: 0x93}, - {value: 0x0004, lo: 0x97, hi: 0x97}, - {value: 0x0024, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0x48, offset 0x209 - {value: 0x0014, lo: 0x8b, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x49, offset 0x20c - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb8}, - // Block 0x4a, offset 0x20f - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x4b, offset 0x215 - {value: 0x0010, lo: 0x80, hi: 0xb5}, - // Block 0x4c, offset 0x216 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbb}, - // Block 0x4d, offset 0x221 - {value: 0x0010, lo: 0x86, hi: 0x8f}, - // Block 0x4e, offset 0x222 - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x4f, offset 0x223 - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - // Block 0x50, offset 0x228 - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x9e}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xac}, - {value: 0x0010, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xbc}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x51, offset 0x235 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xa7, hi: 0xa7}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - {value: 0x0034, lo: 0xb5, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbc}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0x52, offset 0x23d - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x53, offset 0x245 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0030, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8b}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xab, hi: 0xab}, - {value: 0x0034, lo: 0xac, hi: 0xac}, - {value: 0x0024, lo: 0xad, hi: 0xb3}, - // Block 0x54, offset 0x24e - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0030, lo: 0xaa, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbf}, - // Block 0x55, offset 0x257 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0030, lo: 0xb2, hi: 0xb3}, - // Block 0x56, offset 0x260 - {value: 0x0010, lo: 0x80, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0x57, offset 0x265 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8d, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x58, offset 0x268 - {value: 0x316a, lo: 0x80, hi: 0x80}, - {value: 0x31ea, lo: 0x81, hi: 0x81}, - {value: 0x326a, lo: 0x82, hi: 0x82}, - {value: 0x32ea, lo: 0x83, hi: 0x83}, - {value: 0x336a, lo: 0x84, hi: 0x84}, - {value: 0x33ea, lo: 0x85, hi: 0x85}, - {value: 0x346a, lo: 0x86, hi: 0x86}, - {value: 0x34ea, lo: 0x87, hi: 0x87}, - {value: 0x356a, lo: 0x88, hi: 0x88}, - {value: 0x8353, lo: 0x90, hi: 0xba}, - {value: 0x8353, lo: 0xbd, hi: 0xbf}, - // Block 0x59, offset 0x273 - {value: 0x0024, lo: 0x90, hi: 0x92}, - {value: 0x0034, lo: 0x94, hi: 0x99}, - {value: 0x0024, lo: 0x9a, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9f}, - {value: 0x0024, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0034, lo: 0xa2, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xb3}, - {value: 0x0024, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb7}, - {value: 0x0024, lo: 0xb8, hi: 0xb9}, - // Block 0x5a, offset 0x280 - {value: 0x0012, lo: 0x80, hi: 0xab}, - {value: 0x0015, lo: 0xac, hi: 0xbf}, - // Block 0x5b, offset 0x282 - {value: 0x0015, lo: 0x80, hi: 0xaa}, - {value: 0x0012, lo: 0xab, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb8}, - {value: 0x8752, lo: 0xb9, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbc}, - {value: 0x8b52, lo: 0xbd, hi: 0xbd}, - {value: 0x0012, lo: 0xbe, hi: 0xbf}, - // Block 0x5c, offset 0x289 - {value: 0x0012, lo: 0x80, hi: 0x9a}, - {value: 0x0015, lo: 0x9b, hi: 0xbf}, - // Block 0x5d, offset 0x28b - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0024, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb9}, - {value: 0x0024, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbd}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x5e, offset 0x297 - {value: 0x0117, lo: 0x80, hi: 0xbf}, - // Block 0x5f, offset 0x298 - {value: 0x0117, lo: 0x80, hi: 0x95}, - {value: 0x361a, lo: 0x96, hi: 0x96}, - {value: 0x36ca, lo: 0x97, hi: 0x97}, - {value: 0x377a, lo: 0x98, hi: 0x98}, - {value: 0x382a, lo: 0x99, hi: 0x99}, - {value: 0x38da, lo: 0x9a, hi: 0x9a}, - {value: 0x398a, lo: 0x9b, hi: 0x9b}, - {value: 0x0012, lo: 0x9c, hi: 0x9d}, - {value: 0x3a3b, lo: 0x9e, hi: 0x9e}, - {value: 0x0012, lo: 0x9f, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x60, offset 0x2a3 - {value: 0x0812, lo: 0x80, hi: 0x87}, - {value: 0x0813, lo: 0x88, hi: 0x8f}, - {value: 0x0812, lo: 0x90, hi: 0x95}, - {value: 0x0813, lo: 0x98, hi: 0x9d}, - {value: 0x0812, lo: 0xa0, hi: 0xa7}, - {value: 0x0813, lo: 0xa8, hi: 0xaf}, - {value: 0x0812, lo: 0xb0, hi: 0xb7}, - {value: 0x0813, lo: 0xb8, hi: 0xbf}, - // Block 0x61, offset 0x2ab - {value: 0x0004, lo: 0x8b, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8f}, - {value: 0x0054, lo: 0x98, hi: 0x99}, - {value: 0x0054, lo: 0xa4, hi: 0xa4}, - {value: 0x0054, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xaa, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xaf}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x62, offset 0x2b3 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x94, hi: 0x94}, - {value: 0x0014, lo: 0xa0, hi: 0xa4}, - {value: 0x0014, lo: 0xa6, hi: 0xaf}, - {value: 0x0015, lo: 0xb1, hi: 0xb1}, - {value: 0x0015, lo: 0xbf, hi: 0xbf}, - // Block 0x63, offset 0x2b9 - {value: 0x0015, lo: 0x90, hi: 0x9c}, - // Block 0x64, offset 0x2ba - {value: 0x0024, lo: 0x90, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x93}, - {value: 0x0024, lo: 0x94, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0xa0}, - {value: 0x0024, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa4}, - {value: 0x0034, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa7}, - {value: 0x0034, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xa9}, - {value: 0x0034, lo: 0xaa, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - // Block 0x65, offset 0x2c8 - {value: 0x0016, lo: 0x85, hi: 0x86}, - {value: 0x0012, lo: 0x87, hi: 0x89}, - {value: 0xa052, lo: 0x8e, hi: 0x8e}, - {value: 0x1013, lo: 0xa0, hi: 0xaf}, - {value: 0x1012, lo: 0xb0, hi: 0xbf}, - // Block 0x66, offset 0x2cd - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x88}, - // Block 0x67, offset 0x2d0 - {value: 0xa353, lo: 0xb6, hi: 0xb7}, - {value: 0xa653, lo: 0xb8, hi: 0xb9}, - {value: 0xa953, lo: 0xba, hi: 0xbb}, - {value: 0xa653, lo: 0xbc, hi: 0xbd}, - {value: 0xa353, lo: 0xbe, hi: 0xbf}, - // Block 0x68, offset 0x2d5 - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6553, lo: 0x90, hi: 0x9f}, - {value: 0xac53, lo: 0xa0, hi: 0xae}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0x69, offset 0x2d9 - {value: 0x0117, lo: 0x80, hi: 0xa3}, - {value: 0x0012, lo: 0xa4, hi: 0xa4}, - {value: 0x0716, lo: 0xab, hi: 0xac}, - {value: 0x0316, lo: 0xad, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb3}, - // Block 0x6a, offset 0x2df - {value: 0x6c52, lo: 0x80, hi: 0x9f}, - {value: 0x7052, lo: 0xa0, hi: 0xa5}, - {value: 0x7052, lo: 0xa7, hi: 0xa7}, - {value: 0x7052, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x6b, offset 0x2e4 - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x6c, offset 0x2e7 - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0010, lo: 0xb0, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x6d, offset 0x2ec - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9e}, - {value: 0x0024, lo: 0xa0, hi: 0xbf}, - // Block 0x6e, offset 0x2f1 - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - // Block 0x6f, offset 0x2f2 - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0xaa, hi: 0xad}, - {value: 0x0030, lo: 0xae, hi: 0xaf}, - {value: 0x0004, lo: 0xb1, hi: 0xb5}, - {value: 0x0014, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - // Block 0x70, offset 0x2f8 - {value: 0x0034, lo: 0x99, hi: 0x9a}, - {value: 0x0004, lo: 0x9b, hi: 0x9e}, - // Block 0x71, offset 0x2fa - {value: 0x0004, lo: 0xbc, hi: 0xbe}, - // Block 0x72, offset 0x2fb - {value: 0x0010, lo: 0x85, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x73, offset 0x2fd - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0010, lo: 0xa0, hi: 0xba}, - // Block 0x74, offset 0x2ff - {value: 0x0010, lo: 0x80, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0xbf}, - // Block 0x75, offset 0x302 - {value: 0x0010, lo: 0x80, hi: 0x8c}, - // Block 0x76, offset 0x303 - {value: 0x0010, lo: 0x90, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x77, offset 0x305 - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0xab}, - // Block 0x78, offset 0x308 - {value: 0x0117, lo: 0x80, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb2}, - {value: 0x0024, lo: 0xb4, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x79, offset 0x30e - {value: 0x0117, lo: 0x80, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9d}, - {value: 0x0024, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x7a, offset 0x312 - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb1}, - // Block 0x7b, offset 0x314 - {value: 0x0004, lo: 0x80, hi: 0x96}, - {value: 0x0014, lo: 0x97, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xaf}, - {value: 0x0012, lo: 0xb0, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xbf}, - // Block 0x7c, offset 0x319 - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x0015, lo: 0xb0, hi: 0xb0}, - {value: 0x0012, lo: 0xb1, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x8753, lo: 0xbd, hi: 0xbd}, - {value: 0x0117, lo: 0xbe, hi: 0xbf}, - // Block 0x7d, offset 0x320 - {value: 0x0010, lo: 0xb7, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbf}, - // Block 0x7e, offset 0x324 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x8c, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - // Block 0x7f, offset 0x32d - {value: 0x0010, lo: 0x80, hi: 0xb3}, - // Block 0x80, offset 0x32e - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xa0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb7}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x81, offset 0x337 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x82, offset 0x33b - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0x92}, - {value: 0x0030, lo: 0x93, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0x83, offset 0x340 - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb9}, - {value: 0x0010, lo: 0xba, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x84, offset 0x348 - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0004, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x85, offset 0x34e - {value: 0x0010, lo: 0x80, hi: 0xa8}, - {value: 0x0014, lo: 0xa9, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0x86, offset 0x354 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x87, offset 0x35e - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0024, lo: 0xbe, hi: 0xbf}, - // Block 0x88, offset 0x363 - {value: 0x0024, lo: 0x81, hi: 0x81}, - {value: 0x0004, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - // Block 0x89, offset 0x36c - {value: 0x0010, lo: 0x81, hi: 0x86}, - {value: 0x0010, lo: 0x89, hi: 0x8e}, - {value: 0x0010, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x8a, offset 0x372 - {value: 0x0012, lo: 0x80, hi: 0x92}, - {value: 0xaf52, lo: 0x93, hi: 0x93}, - {value: 0x0012, lo: 0x94, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9f}, - {value: 0x0012, lo: 0xa0, hi: 0xa5}, - {value: 0x74d2, lo: 0xb0, hi: 0xbf}, - // Block 0x8b, offset 0x379 - {value: 0x78d2, lo: 0x80, hi: 0x8f}, - {value: 0x7cd2, lo: 0x90, hi: 0x9f}, - {value: 0x80d2, lo: 0xa0, hi: 0xaf}, - {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, - // Block 0x8c, offset 0x37d - {value: 0x0010, lo: 0x80, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x8d, offset 0x385 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x8e, offset 0x387 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x8b, hi: 0xbb}, - // Block 0x8f, offset 0x389 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0xbf}, - // Block 0x90, offset 0x38c - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0004, lo: 0xb2, hi: 0xbf}, - // Block 0x91, offset 0x38e - {value: 0x0004, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x93, hi: 0xbf}, - // Block 0x92, offset 0x390 - {value: 0x0010, lo: 0x80, hi: 0xbd}, - // Block 0x93, offset 0x391 - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0x94, offset 0x392 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0xbf}, - // Block 0x95, offset 0x394 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0xb0, hi: 0xbb}, - // Block 0x96, offset 0x396 - {value: 0x0014, lo: 0x80, hi: 0x8f}, - {value: 0x0054, lo: 0x93, hi: 0x93}, - {value: 0x0024, lo: 0xa0, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xad}, - {value: 0x0024, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - // Block 0x97, offset 0x39c - {value: 0x0010, lo: 0x8d, hi: 0x8f}, - {value: 0x0054, lo: 0x92, hi: 0x92}, - {value: 0x0054, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0xb0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0x98, offset 0x3a1 - {value: 0x0010, lo: 0x80, hi: 0xbc}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x99, offset 0x3a3 - {value: 0x0054, lo: 0x87, hi: 0x87}, - {value: 0x0054, lo: 0x8e, hi: 0x8e}, - {value: 0x0054, lo: 0x9a, hi: 0x9a}, - {value: 0x5f53, lo: 0xa1, hi: 0xba}, - {value: 0x0004, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9a, offset 0x3a9 - {value: 0x0004, lo: 0x80, hi: 0x80}, - {value: 0x5f52, lo: 0x81, hi: 0x9a}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - // Block 0x9b, offset 0x3ac - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbe}, - // Block 0x9c, offset 0x3ae - {value: 0x0010, lo: 0x82, hi: 0x87}, - {value: 0x0010, lo: 0x8a, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0x97}, - {value: 0x0010, lo: 0x9a, hi: 0x9c}, - {value: 0x0004, lo: 0xa3, hi: 0xa3}, - {value: 0x0014, lo: 0xb9, hi: 0xbb}, - // Block 0x9d, offset 0x3b4 - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0010, lo: 0x8d, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xba}, - {value: 0x0010, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9e, offset 0x3b9 - {value: 0x0010, lo: 0x80, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x9d}, - // Block 0x9f, offset 0x3bb - {value: 0x0010, lo: 0x80, hi: 0xba}, - // Block 0xa0, offset 0x3bc - {value: 0x0010, lo: 0x80, hi: 0xb4}, - // Block 0xa1, offset 0x3bd - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0xa2, offset 0x3be - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa3, offset 0x3c0 - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - // Block 0xa4, offset 0x3c2 - {value: 0x0010, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xad, hi: 0xbf}, - // Block 0xa5, offset 0x3c4 - {value: 0x0010, lo: 0x80, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0xb5}, - {value: 0x0024, lo: 0xb6, hi: 0xba}, - // Block 0xa6, offset 0x3c7 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa7, offset 0x3c9 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x91, hi: 0x95}, - // Block 0xa8, offset 0x3cc - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x97}, - {value: 0xb253, lo: 0x98, hi: 0x9f}, - {value: 0xb553, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbf}, - // Block 0xa9, offset 0x3d4 - {value: 0xb252, lo: 0x80, hi: 0x87}, - {value: 0xb552, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0xaa, offset 0x3d7 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0xb553, lo: 0xb0, hi: 0xb7}, - {value: 0xb253, lo: 0xb8, hi: 0xbf}, - // Block 0xab, offset 0x3db - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x93}, - {value: 0xb552, lo: 0x98, hi: 0x9f}, - {value: 0xb252, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbb}, - // Block 0xac, offset 0x3e3 - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xad, offset 0x3e5 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - // Block 0xae, offset 0x3e6 - {value: 0x0010, lo: 0x80, hi: 0xb6}, - // Block 0xaf, offset 0x3e7 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xa7}, - // Block 0xb0, offset 0x3e9 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xb5}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xb1, offset 0x3ef - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xb2, offset 0x3f1 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - // Block 0xb3, offset 0x3f2 - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - // Block 0xb4, offset 0x3f4 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb9}, - // Block 0xb5, offset 0x3f6 - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0xb6, offset 0x3f8 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x8e, hi: 0x8e}, - {value: 0x0024, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x99, hi: 0xb5}, - {value: 0x0024, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xb7, offset 0x405 - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0xb8, offset 0x406 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - // Block 0xb9, offset 0x407 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - // Block 0xba, offset 0x40b - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - // Block 0xbb, offset 0x40d - {value: 0x0010, lo: 0x80, hi: 0x91}, - // Block 0xbc, offset 0x40e - {value: 0x0010, lo: 0x80, hi: 0x88}, - // Block 0xbd, offset 0x40f - {value: 0x5653, lo: 0x80, hi: 0xb2}, - // Block 0xbe, offset 0x410 - {value: 0x5652, lo: 0x80, hi: 0xb2}, - // Block 0xbf, offset 0x411 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xc0, offset 0x414 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xc1, offset 0x417 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x87}, - {value: 0x0024, lo: 0x88, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x8b}, - {value: 0x0024, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - // Block 0xc2, offset 0x41d - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xc3, offset 0x421 - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xc4, offset 0x425 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb6}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - // Block 0xc5, offset 0x42b - {value: 0x0014, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xc6, offset 0x42e - {value: 0x0024, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0xc7, offset 0x435 - {value: 0x0010, lo: 0x84, hi: 0x86}, - {value: 0x0010, lo: 0x90, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - // Block 0xc8, offset 0x439 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xc9, offset 0x43d - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x89, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - // Block 0xca, offset 0x444 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb4}, - {value: 0x0030, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xb7}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0xcb, offset 0x44d - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xcc, offset 0x453 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa2}, - {value: 0x0014, lo: 0xa3, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xcd, offset 0x459 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xce, offset 0x463 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0030, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9d, hi: 0xa3}, - {value: 0x0024, lo: 0xa6, hi: 0xac}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - // Block 0xcf, offset 0x46d - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xd0, offset 0x46f - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0x9e, hi: 0x9e}, - // Block 0xd1, offset 0x477 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xd2, offset 0x47d - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd3, offset 0x483 - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd4, offset 0x489 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x98, hi: 0x9b}, - {value: 0x0014, lo: 0x9c, hi: 0x9d}, - // Block 0xd5, offset 0x48c - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd6, offset 0x492 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd7, offset 0x495 - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0014, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb5}, - {value: 0x0030, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0xd8, offset 0x49d - {value: 0x0010, lo: 0x80, hi: 0x89}, - // Block 0xd9, offset 0x49e - {value: 0x0014, lo: 0x9d, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xda, offset 0x4a5 - {value: 0x0010, lo: 0x80, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - // Block 0xdb, offset 0x4a9 - {value: 0x5f53, lo: 0xa0, hi: 0xbf}, - // Block 0xdc, offset 0x4aa - {value: 0x5f52, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xdd, offset 0x4ad - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x8a}, - {value: 0x0010, lo: 0x8b, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbb, hi: 0xbe}, - // Block 0xde, offset 0x4b5 - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0014, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x98}, - {value: 0x0014, lo: 0x99, hi: 0x9b}, - {value: 0x0010, lo: 0x9c, hi: 0xbf}, - // Block 0xdf, offset 0x4bb - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x86, hi: 0x89}, - {value: 0x0014, lo: 0x8a, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x99}, - {value: 0x0010, lo: 0x9d, hi: 0x9d}, - // Block 0xe0, offset 0x4c2 - {value: 0x0010, lo: 0x80, hi: 0xb8}, - // Block 0xe1, offset 0x4c3 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb6}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xe2, offset 0x4c9 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0xe3, offset 0x4cc - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0014, lo: 0x92, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xa9}, - {value: 0x0014, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0xe4, offset 0x4d4 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb6}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xe5, offset 0x4db - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa5}, - {value: 0x0010, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xbf}, - // Block 0xe6, offset 0x4e5 - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0014, lo: 0x90, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0x96}, - {value: 0x0034, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xe7, offset 0x4ed - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - // Block 0xe8, offset 0x4f0 - {value: 0x0010, lo: 0x80, hi: 0x99}, - // Block 0xe9, offset 0x4f1 - {value: 0x0010, lo: 0x80, hi: 0xae}, - // Block 0xea, offset 0x4f2 - {value: 0x0010, lo: 0x80, hi: 0x83}, - // Block 0xeb, offset 0x4f3 - {value: 0x0010, lo: 0x80, hi: 0x86}, - // Block 0xec, offset 0x4f4 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xed, offset 0x4f6 - {value: 0x0010, lo: 0x90, hi: 0xad}, - {value: 0x0034, lo: 0xb0, hi: 0xb4}, - // Block 0xee, offset 0x4f8 - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb6}, - // Block 0xef, offset 0x4fa - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa3, hi: 0xb7}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xf0, offset 0x4fe - {value: 0x0010, lo: 0x80, hi: 0x8f}, - // Block 0xf1, offset 0x4ff - {value: 0x2013, lo: 0x80, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xbf}, - // Block 0xf2, offset 0x501 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0010, lo: 0x90, hi: 0xbe}, - // Block 0xf3, offset 0x503 - {value: 0x0014, lo: 0x8f, hi: 0x9f}, - // Block 0xf4, offset 0x504 - {value: 0x0014, lo: 0xa0, hi: 0xa1}, - // Block 0xf5, offset 0x505 - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbc}, - // Block 0xf6, offset 0x507 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0034, lo: 0x9e, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa3}, - // Block 0xf7, offset 0x50c - {value: 0x0030, lo: 0xa5, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xa9}, - {value: 0x0030, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbf}, - // Block 0xf8, offset 0x511 - {value: 0x0034, lo: 0x80, hi: 0x82}, - {value: 0x0024, lo: 0x85, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8b}, - {value: 0x0024, lo: 0xaa, hi: 0xad}, - // Block 0xf9, offset 0x515 - {value: 0x0024, lo: 0x82, hi: 0x84}, - // Block 0xfa, offset 0x516 - {value: 0x0013, lo: 0x80, hi: 0x99}, - {value: 0x0012, lo: 0x9a, hi: 0xb3}, - {value: 0x0013, lo: 0xb4, hi: 0xbf}, - // Block 0xfb, offset 0x519 - {value: 0x0013, lo: 0x80, hi: 0x8d}, - {value: 0x0012, lo: 0x8e, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0xa7}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0xfc, offset 0x51d - {value: 0x0013, lo: 0x80, hi: 0x81}, - {value: 0x0012, lo: 0x82, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0x9c}, - {value: 0x0013, lo: 0x9e, hi: 0x9f}, - {value: 0x0013, lo: 0xa2, hi: 0xa2}, - {value: 0x0013, lo: 0xa5, hi: 0xa6}, - {value: 0x0013, lo: 0xa9, hi: 0xac}, - {value: 0x0013, lo: 0xae, hi: 0xb5}, - {value: 0x0012, lo: 0xb6, hi: 0xb9}, - {value: 0x0012, lo: 0xbb, hi: 0xbb}, - {value: 0x0012, lo: 0xbd, hi: 0xbf}, - // Block 0xfd, offset 0x528 - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0012, lo: 0x85, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0xfe, offset 0x52c - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0013, lo: 0x84, hi: 0x85}, - {value: 0x0013, lo: 0x87, hi: 0x8a}, - {value: 0x0013, lo: 0x8d, hi: 0x94}, - {value: 0x0013, lo: 0x96, hi: 0x9c}, - {value: 0x0012, lo: 0x9e, hi: 0xb7}, - {value: 0x0013, lo: 0xb8, hi: 0xb9}, - {value: 0x0013, lo: 0xbb, hi: 0xbe}, - // Block 0xff, offset 0x534 - {value: 0x0013, lo: 0x80, hi: 0x84}, - {value: 0x0013, lo: 0x86, hi: 0x86}, - {value: 0x0013, lo: 0x8a, hi: 0x90}, - {value: 0x0012, lo: 0x92, hi: 0xab}, - {value: 0x0013, lo: 0xac, hi: 0xbf}, - // Block 0x100, offset 0x539 - {value: 0x0013, lo: 0x80, hi: 0x85}, - {value: 0x0012, lo: 0x86, hi: 0x9f}, - {value: 0x0013, lo: 0xa0, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbf}, - // Block 0x101, offset 0x53d - {value: 0x0012, lo: 0x80, hi: 0x93}, - {value: 0x0013, lo: 0x94, hi: 0xad}, - {value: 0x0012, lo: 0xae, hi: 0xbf}, - // Block 0x102, offset 0x540 - {value: 0x0012, lo: 0x80, hi: 0x87}, - {value: 0x0013, lo: 0x88, hi: 0xa1}, - {value: 0x0012, lo: 0xa2, hi: 0xbb}, - {value: 0x0013, lo: 0xbc, hi: 0xbf}, - // Block 0x103, offset 0x544 - {value: 0x0013, lo: 0x80, hi: 0x95}, - {value: 0x0012, lo: 0x96, hi: 0xaf}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x104, offset 0x547 - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0012, lo: 0x8a, hi: 0xa5}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0x105, offset 0x54a - {value: 0x0013, lo: 0x80, hi: 0x80}, - {value: 0x0012, lo: 0x82, hi: 0x9a}, - {value: 0x0012, lo: 0x9c, hi: 0xa1}, - {value: 0x0013, lo: 0xa2, hi: 0xba}, - {value: 0x0012, lo: 0xbc, hi: 0xbf}, - // Block 0x106, offset 0x54f - {value: 0x0012, lo: 0x80, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0xb4}, - {value: 0x0012, lo: 0xb6, hi: 0xbf}, - // Block 0x107, offset 0x553 - {value: 0x0012, lo: 0x80, hi: 0x8e}, - {value: 0x0012, lo: 0x90, hi: 0x95}, - {value: 0x0013, lo: 0x96, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x108, offset 0x557 - {value: 0x0012, lo: 0x80, hi: 0x88}, - {value: 0x0012, lo: 0x8a, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0x109, offset 0x55b - {value: 0x0012, lo: 0x80, hi: 0x82}, - {value: 0x0012, lo: 0x84, hi: 0x89}, - {value: 0x0017, lo: 0x8a, hi: 0x8b}, - {value: 0x0010, lo: 0x8e, hi: 0xbf}, - // Block 0x10a, offset 0x55f - {value: 0x0014, lo: 0x80, hi: 0xb6}, - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x10b, offset 0x561 - {value: 0x0014, lo: 0x80, hi: 0xac}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x10c, offset 0x563 - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x9b, hi: 0x9f}, - {value: 0x0014, lo: 0xa1, hi: 0xaf}, - // Block 0x10d, offset 0x566 - {value: 0x0024, lo: 0x80, hi: 0x86}, - {value: 0x0024, lo: 0x88, hi: 0x98}, - {value: 0x0024, lo: 0x9b, hi: 0xa1}, - {value: 0x0024, lo: 0xa3, hi: 0xa4}, - {value: 0x0024, lo: 0xa6, hi: 0xaa}, - // Block 0x10e, offset 0x56b - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0034, lo: 0x90, hi: 0x96}, - // Block 0x10f, offset 0x56d - {value: 0xb852, lo: 0x80, hi: 0x81}, - {value: 0xbb52, lo: 0x82, hi: 0x83}, - {value: 0x0024, lo: 0x84, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x110, offset 0x572 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x9f}, - {value: 0x0010, lo: 0xa1, hi: 0xa2}, - {value: 0x0010, lo: 0xa4, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb7}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - // Block 0x111, offset 0x57b - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x9b}, - {value: 0x0010, lo: 0xa1, hi: 0xa3}, - {value: 0x0010, lo: 0xa5, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xbb}, - // Block 0x112, offset 0x580 - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x113, offset 0x581 - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x114, offset 0x584 - {value: 0x0013, lo: 0x80, hi: 0x89}, - // Block 0x115, offset 0x585 - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x116, offset 0x586 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0014, lo: 0xa0, hi: 0xbf}, - // Block 0x117, offset 0x588 - {value: 0x0014, lo: 0x80, hi: 0xbf}, - // Block 0x118, offset 0x589 - {value: 0x0014, lo: 0x80, hi: 0xaf}, -} - -// Total table size 14906 bytes (14KiB); checksum: 362795C7 diff --git a/vendor/golang.org/x/text/cases/tables12.0.0.go b/vendor/golang.org/x/text/cases/tables12.0.0.go deleted file mode 100644 index ae7dc24072..0000000000 --- a/vendor/golang.org/x/text/cases/tables12.0.0.go +++ /dev/null @@ -1,2360 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -//go:build go1.14 && !go1.16 -// +build go1.14,!go1.16 - -package cases - -// UnicodeVersion is the Unicode version from which the tables in this package are derived. -const UnicodeVersion = "12.0.0" - -var xorData string = "" + // Size: 192 bytes - "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + - "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + - "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + - "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + - "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + - "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + - "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + - "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + - "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01" + - "\x1e\x00\x01\x22" - -var exceptions string = "" + // Size: 2450 bytes - "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + - "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + - "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + - "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + - "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + - "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + - "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + - "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + - "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + - "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + - "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + - "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + - "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + - "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + - "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + - "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + - "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + - "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + - "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + - "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + - "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + - "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + - "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + - "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + - "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + - "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + - "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + - "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + - "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + - "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + - "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + - "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + - "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + - "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + - "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + - "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + - "խ" - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// caseTrie. Total size: 12396 bytes (12.11 KiB). Checksum: c0656238384c3da1. -type caseTrie struct{} - -func newCaseTrie(i int) *caseTrie { - return &caseTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { - switch { - case n < 20: - return uint16(caseValues[n<<6+uint32(b)]) - default: - n -= 20 - return uint16(sparse.lookup(n, b)) - } -} - -// caseValues: 22 blocks, 1408 entries, 2816 bytes -// The third block is the zero block. -var caseValues = [1408]uint16{ - // Block 0x0, offset 0x0 - 0x27: 0x0054, - 0x2e: 0x0054, - 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, - 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, - // Block 0x1, offset 0x40 - 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, - 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, - 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, - 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, - 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, - 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, - 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, - 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, - 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, - 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, - 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, - 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, - 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, - 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, - 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, - 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, - 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, - 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, - 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, - 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, - // Block 0x4, offset 0x100 - 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, - 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, - 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, - 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, - 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, - 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, - 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, - 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, - 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, - 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, - 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, - // Block 0x5, offset 0x140 - 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, - 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, - 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, - 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, - 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, - 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, - 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, - 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, - 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, - 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, - 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, - // Block 0x6, offset 0x180 - 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, - 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, - 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, - 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, - 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, - 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, - 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, - 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, - 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, - 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, - 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, - 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, - 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, - 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, - 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, - 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, - 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, - 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, - 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, - 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, - 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, - // Block 0x8, offset 0x200 - 0x204: 0x0004, 0x205: 0x0004, - 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, - 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, - 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, - 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, - 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, - 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, - 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, - 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, - 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, - 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, - // Block 0x9, offset 0x240 - 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, - 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, - 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, - 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, - 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, - 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, - 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, - 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, - 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, - 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, - 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, - // Block 0xa, offset 0x280 - 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, - 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, - 0x291: 0x0034, - 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, - 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, - 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, - 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, - 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, - 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, - 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, - 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, - 0x2c7: 0x7053, - 0x2cd: 0x7053, 0x2d0: 0x1aea, 0x2d1: 0x1b6a, - 0x2d2: 0x1bea, 0x2d3: 0x1c6a, 0x2d4: 0x1cea, 0x2d5: 0x1d6a, 0x2d6: 0x1dea, 0x2d7: 0x1e6a, - 0x2d8: 0x1eea, 0x2d9: 0x1f6a, 0x2da: 0x1fea, 0x2db: 0x206a, 0x2dc: 0x20ea, 0x2dd: 0x216a, - 0x2de: 0x21ea, 0x2df: 0x226a, 0x2e0: 0x22ea, 0x2e1: 0x236a, 0x2e2: 0x23ea, 0x2e3: 0x246a, - 0x2e4: 0x24ea, 0x2e5: 0x256a, 0x2e6: 0x25ea, 0x2e7: 0x266a, 0x2e8: 0x26ea, 0x2e9: 0x276a, - 0x2ea: 0x27ea, 0x2eb: 0x286a, 0x2ec: 0x28ea, 0x2ed: 0x296a, 0x2ee: 0x29ea, 0x2ef: 0x2a6a, - 0x2f0: 0x2aea, 0x2f1: 0x2b6a, 0x2f2: 0x2bea, 0x2f3: 0x2c6a, 0x2f4: 0x2cea, 0x2f5: 0x2d6a, - 0x2f6: 0x2dea, 0x2f7: 0x2e6a, 0x2f8: 0x2eea, 0x2f9: 0x2f6a, 0x2fa: 0x2fea, - 0x2fc: 0x0014, 0x2fd: 0x306a, 0x2fe: 0x30ea, 0x2ff: 0x316a, - // Block 0xc, offset 0x300 - 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, - 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, - 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3b1a, 0x311: 0x0812, - 0x312: 0x3bfa, 0x313: 0x0812, 0x314: 0x3d3a, 0x315: 0x0812, 0x316: 0x3e7a, 0x317: 0x0812, - 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, - 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, - 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, - 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, - 0x330: 0x9252, 0x331: 0x9252, 0x332: 0x9552, 0x333: 0x9552, 0x334: 0x9852, 0x335: 0x9852, - 0x336: 0x9b52, 0x337: 0x9b52, 0x338: 0x9e52, 0x339: 0x9e52, 0x33a: 0xa152, 0x33b: 0xa152, - 0x33c: 0x4d52, 0x33d: 0x4d52, - // Block 0xd, offset 0x340 - 0x340: 0x3fba, 0x341: 0x40aa, 0x342: 0x419a, 0x343: 0x428a, 0x344: 0x437a, 0x345: 0x446a, - 0x346: 0x455a, 0x347: 0x464a, 0x348: 0x4739, 0x349: 0x4829, 0x34a: 0x4919, 0x34b: 0x4a09, - 0x34c: 0x4af9, 0x34d: 0x4be9, 0x34e: 0x4cd9, 0x34f: 0x4dc9, 0x350: 0x4eba, 0x351: 0x4faa, - 0x352: 0x509a, 0x353: 0x518a, 0x354: 0x527a, 0x355: 0x536a, 0x356: 0x545a, 0x357: 0x554a, - 0x358: 0x5639, 0x359: 0x5729, 0x35a: 0x5819, 0x35b: 0x5909, 0x35c: 0x59f9, 0x35d: 0x5ae9, - 0x35e: 0x5bd9, 0x35f: 0x5cc9, 0x360: 0x5dba, 0x361: 0x5eaa, 0x362: 0x5f9a, 0x363: 0x608a, - 0x364: 0x617a, 0x365: 0x626a, 0x366: 0x635a, 0x367: 0x644a, 0x368: 0x6539, 0x369: 0x6629, - 0x36a: 0x6719, 0x36b: 0x6809, 0x36c: 0x68f9, 0x36d: 0x69e9, 0x36e: 0x6ad9, 0x36f: 0x6bc9, - 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6cba, 0x373: 0x6dca, 0x374: 0x6e9a, - 0x376: 0x6f7a, 0x377: 0x705a, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x9253, 0x37b: 0x9253, - 0x37c: 0x7199, 0x37d: 0x0004, 0x37e: 0x726a, 0x37f: 0x0004, - // Block 0xe, offset 0x380 - 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x72ea, 0x383: 0x73fa, 0x384: 0x74ca, - 0x386: 0x75aa, 0x387: 0x768a, 0x388: 0x9553, 0x389: 0x9553, 0x38a: 0x9853, 0x38b: 0x9853, - 0x38c: 0x77c9, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, - 0x392: 0x789a, 0x393: 0x79da, 0x396: 0x7b1a, 0x397: 0x7bfa, - 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9b53, 0x39b: 0x9b53, 0x39d: 0x0004, - 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7d3a, 0x3a3: 0x7e7a, - 0x3a4: 0x7fba, 0x3a5: 0x0912, 0x3a6: 0x809a, 0x3a7: 0x817a, 0x3a8: 0x0813, 0x3a9: 0x0813, - 0x3aa: 0xa153, 0x3ab: 0xa153, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, - 0x3b2: 0x82ba, 0x3b3: 0x83ca, 0x3b4: 0x849a, - 0x3b6: 0x857a, 0x3b7: 0x865a, 0x3b8: 0x9e53, 0x3b9: 0x9e53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, - 0x3bc: 0x8799, 0x3bd: 0x0004, 0x3be: 0x0004, - // Block 0xf, offset 0x3c0 - 0x3c2: 0x0013, - 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, - 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, - 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, - 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, - 0x3e4: 0x0013, 0x3e6: 0x886b, 0x3e8: 0x0013, - 0x3ea: 0x88cb, 0x3eb: 0x890b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, - 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa453, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, - 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, - 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, - // Block 0x10, offset 0x400 - 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, - 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, - 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa752, 0x411: 0xa752, - 0x412: 0xaa52, 0x413: 0xaa52, 0x414: 0xad52, 0x415: 0xad52, 0x416: 0xaa52, 0x417: 0xaa52, - 0x418: 0xa752, 0x419: 0xa752, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, - 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, - 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, - // Block 0x11, offset 0x440 - 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, - 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, - 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xb052, 0x451: 0xb052, - 0x452: 0xb052, 0x453: 0xb052, 0x454: 0xb052, 0x455: 0xb052, 0x456: 0xb052, 0x457: 0xb052, - 0x458: 0xb052, 0x459: 0xb052, 0x45a: 0xb052, 0x45b: 0xb052, 0x45c: 0xb052, 0x45d: 0xb052, - 0x45e: 0xb052, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x896b, 0x463: 0x8b53, - 0x464: 0x89cb, 0x465: 0x8a2a, 0x466: 0x8a8a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, - 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8aeb, 0x46e: 0x8b4b, 0x46f: 0x8bab, - 0x470: 0x8c0b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, - 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, - 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8c6b, 0x47f: 0x8ccb, - // Block 0x12, offset 0x480 - 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, - 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, - 0x48c: 0x0712, 0x48d: 0x8d2b, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, - 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x6552, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, - 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, - 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, - 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, - 0x4aa: 0x8d8b, 0x4ab: 0x8deb, 0x4ac: 0x8e4b, 0x4ad: 0x8eab, 0x4ae: 0x8f0b, 0x4af: 0x0012, - 0x4b0: 0x8f6b, 0x4b1: 0x8fcb, 0x4b2: 0x902b, 0x4b3: 0xb353, 0x4b4: 0x0113, 0x4b5: 0x0112, - 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, 0x4ba: 0x0113, 0x4bb: 0x0112, - 0x4bc: 0x0113, 0x4bd: 0x0112, 0x4be: 0x0113, 0x4bf: 0x0112, - // Block 0x13, offset 0x4c0 - 0x4c0: 0x90ea, 0x4c1: 0x916a, 0x4c2: 0x91ea, 0x4c3: 0x926a, 0x4c4: 0x931a, 0x4c5: 0x93ca, - 0x4c6: 0x944a, - 0x4d3: 0x94ca, 0x4d4: 0x95aa, 0x4d5: 0x968a, 0x4d6: 0x976a, 0x4d7: 0x984a, - 0x4dd: 0x0010, - 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, - 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, - 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, - 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, - 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, - 0x4fc: 0x0010, 0x4fe: 0x0010, - // Block 0x14, offset 0x500 - 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, - 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, - 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, - 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, - 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, - 0x51e: 0xbc53, 0x51f: 0xbc53, 0x520: 0xbf53, 0x521: 0xbf53, 0x522: 0x2212, 0x523: 0x2212, - 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, - 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, - 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, - 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, - 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, - // Block 0x15, offset 0x540 - 0x542: 0x0010, - 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, - 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, - 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, - 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, - 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, - 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, - 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, - 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, - 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, - 0x57c: 0x0010, 0x57e: 0x0010, -} - -// caseIndex: 25 blocks, 1600 entries, 3200 bytes -// Block 0 is the zero block. -var caseIndex = [1600]uint16{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, - 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, - 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, - 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, - 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, - 0xf0: 0x14, 0xf3: 0x16, - // Block 0x4, offset 0x100 - 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, - 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, - 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, - 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, - // Block 0x5, offset 0x140 - 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, - 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, - 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, - 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, - 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, - 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, - 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, - 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, - // Block 0x6, offset 0x180 - 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0d, 0x185: 0x79, 0x186: 0x7a, - 0x192: 0x7b, 0x193: 0x0e, - 0x1b0: 0x7c, 0x1b1: 0x0f, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, - 0x1b8: 0x82, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x24, 0x1c6: 0x87, - // Block 0x8, offset 0x200 - 0x200: 0x88, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, - 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, - 0x210: 0x24, 0x211: 0x24, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, - 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x10, 0x21f: 0x91, - 0x220: 0x92, 0x221: 0x93, 0x222: 0x24, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, - 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, - 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, - 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, - // Block 0x9, offset 0x240 - 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, - 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, - 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, - 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, - 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, - 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, - 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, - 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, - // Block 0xa, offset 0x280 - 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, - 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, - 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, - 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa1, 0x29f: 0xa2, - // Block 0xb, offset 0x2c0 - 0x2ec: 0x11, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, - 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, - 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x24, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, - // Block 0xc, offset 0x300 - 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x24, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, - 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, - 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, - 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc2, 0x31d: 0xc3, - 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, - 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, - 0x330: 0x24, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, 0x334: 0xd3, - 0x33c: 0xd4, 0x33d: 0xd5, 0x33f: 0xd6, - // Block 0xd, offset 0x340 - 0x340: 0xd7, 0x341: 0xd8, 0x342: 0xd9, 0x343: 0xda, 0x344: 0xdb, 0x345: 0xdc, 0x346: 0xdd, 0x347: 0xde, - 0x348: 0xdf, 0x34a: 0xe0, 0x34b: 0xe1, 0x34c: 0xe2, 0x34d: 0xe3, - 0x350: 0xe4, 0x351: 0xe5, 0x352: 0xe6, 0x353: 0xe7, 0x356: 0xe8, 0x357: 0xe9, - 0x358: 0xea, 0x359: 0xeb, 0x35a: 0xec, 0x35b: 0xed, 0x35c: 0xee, - 0x360: 0xef, 0x362: 0xf0, 0x363: 0xf1, 0x366: 0xf2, 0x367: 0xf3, - 0x368: 0xf4, 0x369: 0xf5, 0x36a: 0xf6, 0x36b: 0xf7, - 0x370: 0xf8, 0x371: 0xf9, 0x372: 0xfa, 0x374: 0xfb, 0x375: 0xfc, 0x376: 0xfd, - 0x37b: 0xfe, - // Block 0xe, offset 0x380 - 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, - 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0xff, - 0x390: 0x24, 0x391: 0x100, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0x101, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, - 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, - 0x3d0: 0x102, - // Block 0x10, offset 0x400 - 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, - 0x418: 0x24, 0x419: 0x103, - // Block 0x11, offset 0x440 - 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, - 0x468: 0xf7, 0x469: 0x104, 0x46b: 0x105, 0x46c: 0x106, 0x46d: 0x107, 0x46e: 0x108, - 0x479: 0x109, 0x47c: 0x24, 0x47d: 0x10a, 0x47e: 0x10b, 0x47f: 0x10c, - // Block 0x12, offset 0x480 - 0x4b0: 0x24, 0x4b1: 0x10d, 0x4b2: 0x10e, - // Block 0x13, offset 0x4c0 - 0x4c5: 0x10f, 0x4c6: 0x110, - 0x4c9: 0x111, - 0x4d0: 0x112, 0x4d1: 0x113, 0x4d2: 0x114, 0x4d3: 0x115, 0x4d4: 0x116, 0x4d5: 0x117, 0x4d6: 0x118, 0x4d7: 0x119, - 0x4d8: 0x11a, 0x4d9: 0x11b, 0x4da: 0x11c, 0x4db: 0x11d, 0x4dc: 0x11e, 0x4dd: 0x11f, 0x4de: 0x120, 0x4df: 0x121, - 0x4e8: 0x122, 0x4e9: 0x123, 0x4ea: 0x124, - // Block 0x14, offset 0x500 - 0x500: 0x125, 0x504: 0x126, 0x505: 0x127, - 0x50b: 0x128, - 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x129, 0x524: 0x12, 0x525: 0x12a, - 0x538: 0x12b, 0x539: 0x13, 0x53a: 0x12c, - // Block 0x15, offset 0x540 - 0x544: 0x12d, 0x545: 0x12e, 0x546: 0x12f, - 0x54f: 0x130, - // Block 0x16, offset 0x580 - 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, - 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, - // Block 0x17, offset 0x5c0 - 0x5c0: 0x131, 0x5c1: 0x132, 0x5c4: 0x132, 0x5c5: 0x132, 0x5c6: 0x132, 0x5c7: 0x133, - // Block 0x18, offset 0x600 - 0x620: 0x15, -} - -// sparseOffsets: 289 entries, 578 bytes -var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xbf, 0xc5, 0xd3, 0xde, 0xeb, 0xf6, 0x102, 0x10c, 0x118, 0x123, 0x12f, 0x13b, 0x143, 0x14c, 0x156, 0x161, 0x16d, 0x174, 0x17f, 0x184, 0x18c, 0x18f, 0x194, 0x198, 0x19c, 0x1a3, 0x1ac, 0x1b4, 0x1b5, 0x1be, 0x1c5, 0x1cd, 0x1d3, 0x1d8, 0x1dc, 0x1df, 0x1e1, 0x1e4, 0x1e9, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f7, 0x1fc, 0x200, 0x209, 0x20c, 0x20f, 0x215, 0x216, 0x221, 0x222, 0x223, 0x228, 0x235, 0x23d, 0x245, 0x24e, 0x257, 0x260, 0x265, 0x268, 0x273, 0x281, 0x283, 0x28a, 0x28e, 0x29a, 0x29b, 0x2a6, 0x2ae, 0x2b6, 0x2bc, 0x2bd, 0x2cb, 0x2d0, 0x2d3, 0x2d8, 0x2dc, 0x2e2, 0x2e7, 0x2ea, 0x2ef, 0x2f4, 0x2f5, 0x2fb, 0x2fd, 0x2fe, 0x300, 0x302, 0x305, 0x306, 0x308, 0x30b, 0x311, 0x315, 0x317, 0x31c, 0x323, 0x32b, 0x334, 0x335, 0x33e, 0x342, 0x347, 0x34f, 0x355, 0x35b, 0x365, 0x36a, 0x373, 0x379, 0x380, 0x384, 0x38c, 0x38e, 0x390, 0x393, 0x395, 0x397, 0x398, 0x399, 0x39b, 0x39d, 0x3a3, 0x3a8, 0x3aa, 0x3b1, 0x3b4, 0x3b6, 0x3bc, 0x3c1, 0x3c3, 0x3c4, 0x3c5, 0x3c6, 0x3c8, 0x3ca, 0x3cc, 0x3cf, 0x3d1, 0x3d4, 0x3dc, 0x3df, 0x3e3, 0x3eb, 0x3ed, 0x3ee, 0x3ef, 0x3f1, 0x3f7, 0x3f9, 0x3fa, 0x3fc, 0x3fe, 0x400, 0x40d, 0x40e, 0x40f, 0x413, 0x415, 0x416, 0x417, 0x418, 0x419, 0x41c, 0x41f, 0x425, 0x426, 0x42a, 0x42e, 0x434, 0x437, 0x43e, 0x442, 0x446, 0x44d, 0x456, 0x45c, 0x462, 0x46c, 0x476, 0x478, 0x481, 0x487, 0x48d, 0x493, 0x496, 0x49c, 0x49f, 0x4a8, 0x4a9, 0x4b0, 0x4b4, 0x4b5, 0x4b8, 0x4ba, 0x4c1, 0x4c9, 0x4cf, 0x4d5, 0x4d6, 0x4dc, 0x4df, 0x4e7, 0x4ee, 0x4f8, 0x500, 0x503, 0x504, 0x505, 0x506, 0x508, 0x509, 0x50b, 0x50d, 0x50f, 0x513, 0x514, 0x516, 0x519, 0x51b, 0x51d, 0x51f, 0x524, 0x529, 0x52d, 0x52e, 0x531, 0x535, 0x540, 0x544, 0x54c, 0x551, 0x555, 0x558, 0x55c, 0x55f, 0x562, 0x567, 0x56b, 0x56f, 0x573, 0x577, 0x579, 0x57b, 0x57e, 0x583, 0x586, 0x588, 0x58b, 0x58d, 0x593, 0x59c, 0x5a1, 0x5a2, 0x5a5, 0x5a6, 0x5a7, 0x5a9, 0x5aa, 0x5ab} - -// sparseValues: 1451 entries, 5804 bytes -var sparseValues = [1451]valueRange{ - // Block 0x0, offset 0x0 - {value: 0x0004, lo: 0xa8, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xaa}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0004, lo: 0xaf, hi: 0xaf}, - {value: 0x0004, lo: 0xb4, hi: 0xb4}, - {value: 0x001a, lo: 0xb5, hi: 0xb5}, - {value: 0x0054, lo: 0xb7, hi: 0xb7}, - {value: 0x0004, lo: 0xb8, hi: 0xb8}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - // Block 0x1, offset 0x9 - {value: 0x2013, lo: 0x80, hi: 0x96}, - {value: 0x2013, lo: 0x98, hi: 0x9e}, - {value: 0x009a, lo: 0x9f, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xb6}, - {value: 0x2012, lo: 0xb8, hi: 0xbe}, - {value: 0x0252, lo: 0xbf, hi: 0xbf}, - // Block 0x2, offset 0xf - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x011b, lo: 0xb0, hi: 0xb0}, - {value: 0x019a, lo: 0xb1, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb7}, - {value: 0x0012, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x0553, lo: 0xbf, hi: 0xbf}, - // Block 0x3, offset 0x18 - {value: 0x0552, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x01da, lo: 0x89, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xb7}, - {value: 0x0253, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x028a, lo: 0xbf, hi: 0xbf}, - // Block 0x4, offset 0x24 - {value: 0x0117, lo: 0x80, hi: 0x9f}, - {value: 0x2f53, lo: 0xa0, hi: 0xa0}, - {value: 0x0012, lo: 0xa1, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xb3}, - {value: 0x0012, lo: 0xb4, hi: 0xb9}, - {value: 0x090b, lo: 0xba, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x2953, lo: 0xbd, hi: 0xbd}, - {value: 0x098b, lo: 0xbe, hi: 0xbe}, - {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, - // Block 0x5, offset 0x2e - {value: 0x0015, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x97}, - {value: 0x0004, lo: 0x98, hi: 0x9d}, - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0015, lo: 0xa0, hi: 0xa4}, - {value: 0x0004, lo: 0xa5, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xbf}, - // Block 0x6, offset 0x35 - {value: 0x0024, lo: 0x80, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbf}, - // Block 0x7, offset 0x38 - {value: 0x6553, lo: 0x80, hi: 0x8f}, - {value: 0x2013, lo: 0x90, hi: 0x9f}, - {value: 0x5f53, lo: 0xa0, hi: 0xaf}, - {value: 0x2012, lo: 0xb0, hi: 0xbf}, - // Block 0x8, offset 0x3c - {value: 0x5f52, lo: 0x80, hi: 0x8f}, - {value: 0x6552, lo: 0x90, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x9, offset 0x3f - {value: 0x0117, lo: 0x80, hi: 0x81}, - {value: 0x0024, lo: 0x83, hi: 0x87}, - {value: 0x0014, lo: 0x88, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xbf}, - // Block 0xa, offset 0x43 - {value: 0x0f13, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x0316, lo: 0x89, hi: 0x8a}, - {value: 0x0716, lo: 0x8b, hi: 0x8c}, - {value: 0x0316, lo: 0x8d, hi: 0x8e}, - {value: 0x0f12, lo: 0x8f, hi: 0x8f}, - {value: 0x0117, lo: 0x90, hi: 0xbf}, - // Block 0xb, offset 0x4d - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x6553, lo: 0xb1, hi: 0xbf}, - // Block 0xc, offset 0x4f - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6853, lo: 0x90, hi: 0x96}, - {value: 0x0014, lo: 0x99, hi: 0x99}, - {value: 0x0010, lo: 0x9b, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0012, lo: 0xa0, hi: 0xa0}, - {value: 0x6552, lo: 0xa1, hi: 0xaf}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0xd, offset 0x57 - {value: 0x0034, lo: 0x81, hi: 0x82}, - {value: 0x0024, lo: 0x84, hi: 0x84}, - {value: 0x0034, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0xaa}, - {value: 0x0010, lo: 0xaf, hi: 0xb3}, - {value: 0x0054, lo: 0xb4, hi: 0xb4}, - // Block 0xe, offset 0x5e - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0024, lo: 0x90, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0014, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xf, offset 0x63 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9c}, - {value: 0x0024, lo: 0x9d, hi: 0x9e}, - {value: 0x0034, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x10, offset 0x71 - {value: 0x0010, lo: 0x80, hi: 0xbf}, - // Block 0x11, offset 0x72 - {value: 0x0010, lo: 0x80, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0024, lo: 0x9f, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xaa, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x12, offset 0x80 - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0034, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0034, lo: 0xb1, hi: 0xb1}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbd}, - {value: 0x0034, lo: 0xbe, hi: 0xbe}, - {value: 0x0024, lo: 0xbf, hi: 0xbf}, - // Block 0x13, offset 0x8f - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0024, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x88}, - {value: 0x0024, lo: 0x89, hi: 0x8a}, - {value: 0x0010, lo: 0x8d, hi: 0xbf}, - // Block 0x14, offset 0x99 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x15, offset 0x9c - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xb1}, - {value: 0x0034, lo: 0xb2, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0x16, offset 0xa3 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x99}, - {value: 0x0014, lo: 0x9a, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0xa3}, - {value: 0x0014, lo: 0xa4, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xad}, - // Block 0x17, offset 0xab - {value: 0x0010, lo: 0x80, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x9b}, - {value: 0x0010, lo: 0xa0, hi: 0xaa}, - // Block 0x18, offset 0xae - {value: 0x0010, lo: 0xa0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbd}, - // Block 0x19, offset 0xb0 - {value: 0x0034, lo: 0x93, hi: 0x93}, - {value: 0x0024, lo: 0x94, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0024, lo: 0xaa, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbf}, - // Block 0x1a, offset 0xbf - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1b, offset 0xc5 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0x1c, offset 0xd3 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb6, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1d, offset 0xde - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xb1}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - // Block 0x1e, offset 0xeb - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x1f, offset 0xf6 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x99, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x20, offset 0x102 - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x21, offset 0x10c - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x85}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xbf}, - // Block 0x22, offset 0x118 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x23, offset 0x123 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x24, offset 0x12f - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0010, lo: 0xa8, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x25, offset 0x13b - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x26, offset 0x143 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb9}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbf}, - // Block 0x27, offset 0x14c - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x88}, - {value: 0x0014, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x28, offset 0x156 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x29, offset 0x161 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb2}, - // Block 0x2a, offset 0x16d - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x2b, offset 0x174 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x94, hi: 0x97}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xba, hi: 0xbf}, - // Block 0x2c, offset 0x17f - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x96}, - {value: 0x0010, lo: 0x9a, hi: 0xb1}, - {value: 0x0010, lo: 0xb3, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x2d, offset 0x184 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x94}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9f}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - // Block 0x2e, offset 0x18c - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xba}, - // Block 0x2f, offset 0x18f - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x30, offset 0x194 - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xba}, - {value: 0x0014, lo: 0xbb, hi: 0xbc}, - // Block 0x31, offset 0x198 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x32, offset 0x19c - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0034, lo: 0x98, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0034, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x33, offset 0x1a3 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xac}, - {value: 0x0034, lo: 0xb1, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xba, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x34, offset 0x1ac - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0024, lo: 0x82, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x86, hi: 0x87}, - {value: 0x0010, lo: 0x88, hi: 0x8c}, - {value: 0x0014, lo: 0x8d, hi: 0x97}, - {value: 0x0014, lo: 0x99, hi: 0xbc}, - // Block 0x35, offset 0x1b4 - {value: 0x0034, lo: 0x86, hi: 0x86}, - // Block 0x36, offset 0x1b5 - {value: 0x0010, lo: 0xab, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbe}, - // Block 0x37, offset 0x1be - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x96, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x99}, - {value: 0x0014, lo: 0x9e, hi: 0xa0}, - {value: 0x0010, lo: 0xa2, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xad}, - {value: 0x0014, lo: 0xb1, hi: 0xb4}, - // Block 0x38, offset 0x1c5 - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x6c53, lo: 0xa0, hi: 0xbf}, - // Block 0x39, offset 0x1cd - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x9a, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x3a, offset 0x1d3 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x3b, offset 0x1d8 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x82, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3c, offset 0x1dc - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3d, offset 0x1df - {value: 0x0010, lo: 0x80, hi: 0x9a}, - {value: 0x0024, lo: 0x9d, hi: 0x9f}, - // Block 0x3e, offset 0x1e1 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x7453, lo: 0xa0, hi: 0xaf}, - {value: 0x7853, lo: 0xb0, hi: 0xbf}, - // Block 0x3f, offset 0x1e4 - {value: 0x7c53, lo: 0x80, hi: 0x8f}, - {value: 0x8053, lo: 0x90, hi: 0x9f}, - {value: 0x7c53, lo: 0xa0, hi: 0xaf}, - {value: 0x0813, lo: 0xb0, hi: 0xb5}, - {value: 0x0892, lo: 0xb8, hi: 0xbd}, - // Block 0x40, offset 0x1e9 - {value: 0x0010, lo: 0x81, hi: 0xbf}, - // Block 0x41, offset 0x1ea - {value: 0x0010, lo: 0x80, hi: 0xac}, - {value: 0x0010, lo: 0xaf, hi: 0xbf}, - // Block 0x42, offset 0x1ec - {value: 0x0010, lo: 0x81, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x43, offset 0x1ee - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb8}, - // Block 0x44, offset 0x1f0 - {value: 0x0010, lo: 0x80, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0034, lo: 0x94, hi: 0x94}, - {value: 0x0010, lo: 0xa0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - // Block 0x45, offset 0x1f7 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xac}, - {value: 0x0010, lo: 0xae, hi: 0xb0}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - // Block 0x46, offset 0x1fc - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x47, offset 0x200 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x89, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0014, lo: 0x93, hi: 0x93}, - {value: 0x0004, lo: 0x97, hi: 0x97}, - {value: 0x0024, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0x48, offset 0x209 - {value: 0x0014, lo: 0x8b, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x49, offset 0x20c - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb8}, - // Block 0x4a, offset 0x20f - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x4b, offset 0x215 - {value: 0x0010, lo: 0x80, hi: 0xb5}, - // Block 0x4c, offset 0x216 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbb}, - // Block 0x4d, offset 0x221 - {value: 0x0010, lo: 0x86, hi: 0x8f}, - // Block 0x4e, offset 0x222 - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x4f, offset 0x223 - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - // Block 0x50, offset 0x228 - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x9e}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xac}, - {value: 0x0010, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xbc}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x51, offset 0x235 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xa7, hi: 0xa7}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - {value: 0x0034, lo: 0xb5, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbc}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0x52, offset 0x23d - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x53, offset 0x245 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0030, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8b}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xab, hi: 0xab}, - {value: 0x0034, lo: 0xac, hi: 0xac}, - {value: 0x0024, lo: 0xad, hi: 0xb3}, - // Block 0x54, offset 0x24e - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0030, lo: 0xaa, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbf}, - // Block 0x55, offset 0x257 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0030, lo: 0xb2, hi: 0xb3}, - // Block 0x56, offset 0x260 - {value: 0x0010, lo: 0x80, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0x57, offset 0x265 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8d, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x58, offset 0x268 - {value: 0x31ea, lo: 0x80, hi: 0x80}, - {value: 0x326a, lo: 0x81, hi: 0x81}, - {value: 0x32ea, lo: 0x82, hi: 0x82}, - {value: 0x336a, lo: 0x83, hi: 0x83}, - {value: 0x33ea, lo: 0x84, hi: 0x84}, - {value: 0x346a, lo: 0x85, hi: 0x85}, - {value: 0x34ea, lo: 0x86, hi: 0x86}, - {value: 0x356a, lo: 0x87, hi: 0x87}, - {value: 0x35ea, lo: 0x88, hi: 0x88}, - {value: 0x8353, lo: 0x90, hi: 0xba}, - {value: 0x8353, lo: 0xbd, hi: 0xbf}, - // Block 0x59, offset 0x273 - {value: 0x0024, lo: 0x90, hi: 0x92}, - {value: 0x0034, lo: 0x94, hi: 0x99}, - {value: 0x0024, lo: 0x9a, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9f}, - {value: 0x0024, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0034, lo: 0xa2, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xb3}, - {value: 0x0024, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb7}, - {value: 0x0024, lo: 0xb8, hi: 0xb9}, - {value: 0x0010, lo: 0xba, hi: 0xba}, - // Block 0x5a, offset 0x281 - {value: 0x0012, lo: 0x80, hi: 0xab}, - {value: 0x0015, lo: 0xac, hi: 0xbf}, - // Block 0x5b, offset 0x283 - {value: 0x0015, lo: 0x80, hi: 0xaa}, - {value: 0x0012, lo: 0xab, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb8}, - {value: 0x8752, lo: 0xb9, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbc}, - {value: 0x8b52, lo: 0xbd, hi: 0xbd}, - {value: 0x0012, lo: 0xbe, hi: 0xbf}, - // Block 0x5c, offset 0x28a - {value: 0x0012, lo: 0x80, hi: 0x8d}, - {value: 0x8f52, lo: 0x8e, hi: 0x8e}, - {value: 0x0012, lo: 0x8f, hi: 0x9a}, - {value: 0x0015, lo: 0x9b, hi: 0xbf}, - // Block 0x5d, offset 0x28e - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0024, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb9}, - {value: 0x0024, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbd}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x5e, offset 0x29a - {value: 0x0117, lo: 0x80, hi: 0xbf}, - // Block 0x5f, offset 0x29b - {value: 0x0117, lo: 0x80, hi: 0x95}, - {value: 0x369a, lo: 0x96, hi: 0x96}, - {value: 0x374a, lo: 0x97, hi: 0x97}, - {value: 0x37fa, lo: 0x98, hi: 0x98}, - {value: 0x38aa, lo: 0x99, hi: 0x99}, - {value: 0x395a, lo: 0x9a, hi: 0x9a}, - {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, - {value: 0x0012, lo: 0x9c, hi: 0x9d}, - {value: 0x3abb, lo: 0x9e, hi: 0x9e}, - {value: 0x0012, lo: 0x9f, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x60, offset 0x2a6 - {value: 0x0812, lo: 0x80, hi: 0x87}, - {value: 0x0813, lo: 0x88, hi: 0x8f}, - {value: 0x0812, lo: 0x90, hi: 0x95}, - {value: 0x0813, lo: 0x98, hi: 0x9d}, - {value: 0x0812, lo: 0xa0, hi: 0xa7}, - {value: 0x0813, lo: 0xa8, hi: 0xaf}, - {value: 0x0812, lo: 0xb0, hi: 0xb7}, - {value: 0x0813, lo: 0xb8, hi: 0xbf}, - // Block 0x61, offset 0x2ae - {value: 0x0004, lo: 0x8b, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8f}, - {value: 0x0054, lo: 0x98, hi: 0x99}, - {value: 0x0054, lo: 0xa4, hi: 0xa4}, - {value: 0x0054, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xaa, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xaf}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x62, offset 0x2b6 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x94, hi: 0x94}, - {value: 0x0014, lo: 0xa0, hi: 0xa4}, - {value: 0x0014, lo: 0xa6, hi: 0xaf}, - {value: 0x0015, lo: 0xb1, hi: 0xb1}, - {value: 0x0015, lo: 0xbf, hi: 0xbf}, - // Block 0x63, offset 0x2bc - {value: 0x0015, lo: 0x90, hi: 0x9c}, - // Block 0x64, offset 0x2bd - {value: 0x0024, lo: 0x90, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x93}, - {value: 0x0024, lo: 0x94, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0xa0}, - {value: 0x0024, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa4}, - {value: 0x0034, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa7}, - {value: 0x0034, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xa9}, - {value: 0x0034, lo: 0xaa, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - // Block 0x65, offset 0x2cb - {value: 0x0016, lo: 0x85, hi: 0x86}, - {value: 0x0012, lo: 0x87, hi: 0x89}, - {value: 0xa452, lo: 0x8e, hi: 0x8e}, - {value: 0x1013, lo: 0xa0, hi: 0xaf}, - {value: 0x1012, lo: 0xb0, hi: 0xbf}, - // Block 0x66, offset 0x2d0 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x88}, - // Block 0x67, offset 0x2d3 - {value: 0xa753, lo: 0xb6, hi: 0xb7}, - {value: 0xaa53, lo: 0xb8, hi: 0xb9}, - {value: 0xad53, lo: 0xba, hi: 0xbb}, - {value: 0xaa53, lo: 0xbc, hi: 0xbd}, - {value: 0xa753, lo: 0xbe, hi: 0xbf}, - // Block 0x68, offset 0x2d8 - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6553, lo: 0x90, hi: 0x9f}, - {value: 0xb053, lo: 0xa0, hi: 0xae}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0x69, offset 0x2dc - {value: 0x0117, lo: 0x80, hi: 0xa3}, - {value: 0x0012, lo: 0xa4, hi: 0xa4}, - {value: 0x0716, lo: 0xab, hi: 0xac}, - {value: 0x0316, lo: 0xad, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb3}, - // Block 0x6a, offset 0x2e2 - {value: 0x6c52, lo: 0x80, hi: 0x9f}, - {value: 0x7052, lo: 0xa0, hi: 0xa5}, - {value: 0x7052, lo: 0xa7, hi: 0xa7}, - {value: 0x7052, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x6b, offset 0x2e7 - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x6c, offset 0x2ea - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0010, lo: 0xb0, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x6d, offset 0x2ef - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9e}, - {value: 0x0024, lo: 0xa0, hi: 0xbf}, - // Block 0x6e, offset 0x2f4 - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - // Block 0x6f, offset 0x2f5 - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0xaa, hi: 0xad}, - {value: 0x0030, lo: 0xae, hi: 0xaf}, - {value: 0x0004, lo: 0xb1, hi: 0xb5}, - {value: 0x0014, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - // Block 0x70, offset 0x2fb - {value: 0x0034, lo: 0x99, hi: 0x9a}, - {value: 0x0004, lo: 0x9b, hi: 0x9e}, - // Block 0x71, offset 0x2fd - {value: 0x0004, lo: 0xbc, hi: 0xbe}, - // Block 0x72, offset 0x2fe - {value: 0x0010, lo: 0x85, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x73, offset 0x300 - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0010, lo: 0xa0, hi: 0xba}, - // Block 0x74, offset 0x302 - {value: 0x0010, lo: 0x80, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0xbf}, - // Block 0x75, offset 0x305 - {value: 0x0010, lo: 0x80, hi: 0x8c}, - // Block 0x76, offset 0x306 - {value: 0x0010, lo: 0x90, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x77, offset 0x308 - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0xab}, - // Block 0x78, offset 0x30b - {value: 0x0117, lo: 0x80, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb2}, - {value: 0x0024, lo: 0xb4, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x79, offset 0x311 - {value: 0x0117, lo: 0x80, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9d}, - {value: 0x0024, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x7a, offset 0x315 - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb1}, - // Block 0x7b, offset 0x317 - {value: 0x0004, lo: 0x80, hi: 0x96}, - {value: 0x0014, lo: 0x97, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xaf}, - {value: 0x0012, lo: 0xb0, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xbf}, - // Block 0x7c, offset 0x31c - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x0015, lo: 0xb0, hi: 0xb0}, - {value: 0x0012, lo: 0xb1, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x8753, lo: 0xbd, hi: 0xbd}, - {value: 0x0117, lo: 0xbe, hi: 0xbf}, - // Block 0x7d, offset 0x323 - {value: 0x0117, lo: 0x82, hi: 0x83}, - {value: 0x6553, lo: 0x84, hi: 0x84}, - {value: 0x908b, lo: 0x85, hi: 0x85}, - {value: 0x8f53, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0xb7, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbf}, - // Block 0x7e, offset 0x32b - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x8c, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - // Block 0x7f, offset 0x334 - {value: 0x0010, lo: 0x80, hi: 0xb3}, - // Block 0x80, offset 0x335 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xa0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb7}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x81, offset 0x33e - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x82, offset 0x342 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0x92}, - {value: 0x0030, lo: 0x93, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0x83, offset 0x347 - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb9}, - {value: 0x0010, lo: 0xba, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x84, offset 0x34f - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0004, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x85, offset 0x355 - {value: 0x0010, lo: 0x80, hi: 0xa8}, - {value: 0x0014, lo: 0xa9, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0x86, offset 0x35b - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x87, offset 0x365 - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0024, lo: 0xbe, hi: 0xbf}, - // Block 0x88, offset 0x36a - {value: 0x0024, lo: 0x81, hi: 0x81}, - {value: 0x0004, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - // Block 0x89, offset 0x373 - {value: 0x0010, lo: 0x81, hi: 0x86}, - {value: 0x0010, lo: 0x89, hi: 0x8e}, - {value: 0x0010, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x8a, offset 0x379 - {value: 0x0012, lo: 0x80, hi: 0x92}, - {value: 0xb352, lo: 0x93, hi: 0x93}, - {value: 0x0012, lo: 0x94, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9f}, - {value: 0x0012, lo: 0xa0, hi: 0xa7}, - {value: 0x74d2, lo: 0xb0, hi: 0xbf}, - // Block 0x8b, offset 0x380 - {value: 0x78d2, lo: 0x80, hi: 0x8f}, - {value: 0x7cd2, lo: 0x90, hi: 0x9f}, - {value: 0x80d2, lo: 0xa0, hi: 0xaf}, - {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, - // Block 0x8c, offset 0x384 - {value: 0x0010, lo: 0x80, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x8d, offset 0x38c - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x8e, offset 0x38e - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x8b, hi: 0xbb}, - // Block 0x8f, offset 0x390 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0xbf}, - // Block 0x90, offset 0x393 - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0004, lo: 0xb2, hi: 0xbf}, - // Block 0x91, offset 0x395 - {value: 0x0004, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x93, hi: 0xbf}, - // Block 0x92, offset 0x397 - {value: 0x0010, lo: 0x80, hi: 0xbd}, - // Block 0x93, offset 0x398 - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0x94, offset 0x399 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0xbf}, - // Block 0x95, offset 0x39b - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0xb0, hi: 0xbb}, - // Block 0x96, offset 0x39d - {value: 0x0014, lo: 0x80, hi: 0x8f}, - {value: 0x0054, lo: 0x93, hi: 0x93}, - {value: 0x0024, lo: 0xa0, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xad}, - {value: 0x0024, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - // Block 0x97, offset 0x3a3 - {value: 0x0010, lo: 0x8d, hi: 0x8f}, - {value: 0x0054, lo: 0x92, hi: 0x92}, - {value: 0x0054, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0xb0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0x98, offset 0x3a8 - {value: 0x0010, lo: 0x80, hi: 0xbc}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x99, offset 0x3aa - {value: 0x0054, lo: 0x87, hi: 0x87}, - {value: 0x0054, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0054, lo: 0x9a, hi: 0x9a}, - {value: 0x5f53, lo: 0xa1, hi: 0xba}, - {value: 0x0004, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9a, offset 0x3b1 - {value: 0x0004, lo: 0x80, hi: 0x80}, - {value: 0x5f52, lo: 0x81, hi: 0x9a}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - // Block 0x9b, offset 0x3b4 - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbe}, - // Block 0x9c, offset 0x3b6 - {value: 0x0010, lo: 0x82, hi: 0x87}, - {value: 0x0010, lo: 0x8a, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0x97}, - {value: 0x0010, lo: 0x9a, hi: 0x9c}, - {value: 0x0004, lo: 0xa3, hi: 0xa3}, - {value: 0x0014, lo: 0xb9, hi: 0xbb}, - // Block 0x9d, offset 0x3bc - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0010, lo: 0x8d, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xba}, - {value: 0x0010, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9e, offset 0x3c1 - {value: 0x0010, lo: 0x80, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x9d}, - // Block 0x9f, offset 0x3c3 - {value: 0x0010, lo: 0x80, hi: 0xba}, - // Block 0xa0, offset 0x3c4 - {value: 0x0010, lo: 0x80, hi: 0xb4}, - // Block 0xa1, offset 0x3c5 - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0xa2, offset 0x3c6 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa3, offset 0x3c8 - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - // Block 0xa4, offset 0x3ca - {value: 0x0010, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xad, hi: 0xbf}, - // Block 0xa5, offset 0x3cc - {value: 0x0010, lo: 0x80, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0xb5}, - {value: 0x0024, lo: 0xb6, hi: 0xba}, - // Block 0xa6, offset 0x3cf - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa7, offset 0x3d1 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x91, hi: 0x95}, - // Block 0xa8, offset 0x3d4 - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x97}, - {value: 0xb653, lo: 0x98, hi: 0x9f}, - {value: 0xb953, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbf}, - // Block 0xa9, offset 0x3dc - {value: 0xb652, lo: 0x80, hi: 0x87}, - {value: 0xb952, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0xaa, offset 0x3df - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0xb953, lo: 0xb0, hi: 0xb7}, - {value: 0xb653, lo: 0xb8, hi: 0xbf}, - // Block 0xab, offset 0x3e3 - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x93}, - {value: 0xb952, lo: 0x98, hi: 0x9f}, - {value: 0xb652, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbb}, - // Block 0xac, offset 0x3eb - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xad, offset 0x3ed - {value: 0x0010, lo: 0x80, hi: 0xa3}, - // Block 0xae, offset 0x3ee - {value: 0x0010, lo: 0x80, hi: 0xb6}, - // Block 0xaf, offset 0x3ef - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xa7}, - // Block 0xb0, offset 0x3f1 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xb5}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xb1, offset 0x3f7 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xb2, offset 0x3f9 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - // Block 0xb3, offset 0x3fa - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - // Block 0xb4, offset 0x3fc - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb9}, - // Block 0xb5, offset 0x3fe - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0xb6, offset 0x400 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x8e, hi: 0x8e}, - {value: 0x0024, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x99, hi: 0xb5}, - {value: 0x0024, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xb7, offset 0x40d - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0xb8, offset 0x40e - {value: 0x0010, lo: 0x80, hi: 0x9c}, - // Block 0xb9, offset 0x40f - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - // Block 0xba, offset 0x413 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - // Block 0xbb, offset 0x415 - {value: 0x0010, lo: 0x80, hi: 0x91}, - // Block 0xbc, offset 0x416 - {value: 0x0010, lo: 0x80, hi: 0x88}, - // Block 0xbd, offset 0x417 - {value: 0x5653, lo: 0x80, hi: 0xb2}, - // Block 0xbe, offset 0x418 - {value: 0x5652, lo: 0x80, hi: 0xb2}, - // Block 0xbf, offset 0x419 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xc0, offset 0x41c - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xc1, offset 0x41f - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x87}, - {value: 0x0024, lo: 0x88, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x8b}, - {value: 0x0024, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - // Block 0xc2, offset 0x425 - {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xc3, offset 0x426 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xc4, offset 0x42a - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xc5, offset 0x42e - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb6}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - // Block 0xc6, offset 0x434 - {value: 0x0014, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xc7, offset 0x437 - {value: 0x0024, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0xc8, offset 0x43e - {value: 0x0010, lo: 0x84, hi: 0x86}, - {value: 0x0010, lo: 0x90, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - // Block 0xc9, offset 0x442 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xca, offset 0x446 - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x89, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - // Block 0xcb, offset 0x44d - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb4}, - {value: 0x0030, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xb7}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0xcc, offset 0x456 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xcd, offset 0x45c - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa2}, - {value: 0x0014, lo: 0xa3, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xce, offset 0x462 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xcf, offset 0x46c - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0030, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9d, hi: 0xa3}, - {value: 0x0024, lo: 0xa6, hi: 0xac}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - // Block 0xd0, offset 0x476 - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xd1, offset 0x478 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0x9f, hi: 0x9f}, - // Block 0xd2, offset 0x481 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xd3, offset 0x487 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd4, offset 0x48d - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd5, offset 0x493 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x98, hi: 0x9b}, - {value: 0x0014, lo: 0x9c, hi: 0x9d}, - // Block 0xd6, offset 0x496 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd7, offset 0x49c - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd8, offset 0x49f - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0014, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb5}, - {value: 0x0030, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - // Block 0xd9, offset 0x4a8 - {value: 0x0010, lo: 0x80, hi: 0x89}, - // Block 0xda, offset 0x4a9 - {value: 0x0014, lo: 0x9d, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xdb, offset 0x4b0 - {value: 0x0010, lo: 0x80, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - // Block 0xdc, offset 0x4b4 - {value: 0x5f53, lo: 0xa0, hi: 0xbf}, - // Block 0xdd, offset 0x4b5 - {value: 0x5f52, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xde, offset 0x4b8 - {value: 0x0010, lo: 0xa0, hi: 0xa7}, - {value: 0x0010, lo: 0xaa, hi: 0xbf}, - // Block 0xdf, offset 0x4ba - {value: 0x0010, lo: 0x80, hi: 0x93}, - {value: 0x0014, lo: 0x94, hi: 0x97}, - {value: 0x0014, lo: 0x9a, hi: 0x9b}, - {value: 0x0010, lo: 0x9c, hi: 0x9f}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - // Block 0xe0, offset 0x4c1 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x8a}, - {value: 0x0010, lo: 0x8b, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbb, hi: 0xbe}, - // Block 0xe1, offset 0x4c9 - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0014, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x98}, - {value: 0x0014, lo: 0x99, hi: 0x9b}, - {value: 0x0010, lo: 0x9c, hi: 0xbf}, - // Block 0xe2, offset 0x4cf - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0014, lo: 0x8a, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x99}, - {value: 0x0010, lo: 0x9d, hi: 0x9d}, - // Block 0xe3, offset 0x4d5 - {value: 0x0010, lo: 0x80, hi: 0xb8}, - // Block 0xe4, offset 0x4d6 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb6}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xe5, offset 0x4dc - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0xe6, offset 0x4df - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0014, lo: 0x92, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xa9}, - {value: 0x0014, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0xe7, offset 0x4e7 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb6}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xe8, offset 0x4ee - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa5}, - {value: 0x0010, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xbf}, - // Block 0xe9, offset 0x4f8 - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0014, lo: 0x90, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0x96}, - {value: 0x0034, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xea, offset 0x500 - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - // Block 0xeb, offset 0x503 - {value: 0x0010, lo: 0x80, hi: 0x99}, - // Block 0xec, offset 0x504 - {value: 0x0010, lo: 0x80, hi: 0xae}, - // Block 0xed, offset 0x505 - {value: 0x0010, lo: 0x80, hi: 0x83}, - // Block 0xee, offset 0x506 - {value: 0x0010, lo: 0x80, hi: 0xae}, - {value: 0x0014, lo: 0xb0, hi: 0xb8}, - // Block 0xef, offset 0x508 - {value: 0x0010, lo: 0x80, hi: 0x86}, - // Block 0xf0, offset 0x509 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xf1, offset 0x50b - {value: 0x0010, lo: 0x90, hi: 0xad}, - {value: 0x0034, lo: 0xb0, hi: 0xb4}, - // Block 0xf2, offset 0x50d - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb6}, - // Block 0xf3, offset 0x50f - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa3, hi: 0xb7}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xf4, offset 0x513 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - // Block 0xf5, offset 0x514 - {value: 0x2013, lo: 0x80, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xbf}, - // Block 0xf6, offset 0x516 - {value: 0x0010, lo: 0x80, hi: 0x8a}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0xf7, offset 0x519 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0014, lo: 0x8f, hi: 0x9f}, - // Block 0xf8, offset 0x51b - {value: 0x0014, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa3, hi: 0xa3}, - // Block 0xf9, offset 0x51d - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbc}, - // Block 0xfa, offset 0x51f - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0034, lo: 0x9e, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa3}, - // Block 0xfb, offset 0x524 - {value: 0x0030, lo: 0xa5, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xa9}, - {value: 0x0030, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbf}, - // Block 0xfc, offset 0x529 - {value: 0x0034, lo: 0x80, hi: 0x82}, - {value: 0x0024, lo: 0x85, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8b}, - {value: 0x0024, lo: 0xaa, hi: 0xad}, - // Block 0xfd, offset 0x52d - {value: 0x0024, lo: 0x82, hi: 0x84}, - // Block 0xfe, offset 0x52e - {value: 0x0013, lo: 0x80, hi: 0x99}, - {value: 0x0012, lo: 0x9a, hi: 0xb3}, - {value: 0x0013, lo: 0xb4, hi: 0xbf}, - // Block 0xff, offset 0x531 - {value: 0x0013, lo: 0x80, hi: 0x8d}, - {value: 0x0012, lo: 0x8e, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0xa7}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0x100, offset 0x535 - {value: 0x0013, lo: 0x80, hi: 0x81}, - {value: 0x0012, lo: 0x82, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0x9c}, - {value: 0x0013, lo: 0x9e, hi: 0x9f}, - {value: 0x0013, lo: 0xa2, hi: 0xa2}, - {value: 0x0013, lo: 0xa5, hi: 0xa6}, - {value: 0x0013, lo: 0xa9, hi: 0xac}, - {value: 0x0013, lo: 0xae, hi: 0xb5}, - {value: 0x0012, lo: 0xb6, hi: 0xb9}, - {value: 0x0012, lo: 0xbb, hi: 0xbb}, - {value: 0x0012, lo: 0xbd, hi: 0xbf}, - // Block 0x101, offset 0x540 - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0012, lo: 0x85, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0x102, offset 0x544 - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0013, lo: 0x84, hi: 0x85}, - {value: 0x0013, lo: 0x87, hi: 0x8a}, - {value: 0x0013, lo: 0x8d, hi: 0x94}, - {value: 0x0013, lo: 0x96, hi: 0x9c}, - {value: 0x0012, lo: 0x9e, hi: 0xb7}, - {value: 0x0013, lo: 0xb8, hi: 0xb9}, - {value: 0x0013, lo: 0xbb, hi: 0xbe}, - // Block 0x103, offset 0x54c - {value: 0x0013, lo: 0x80, hi: 0x84}, - {value: 0x0013, lo: 0x86, hi: 0x86}, - {value: 0x0013, lo: 0x8a, hi: 0x90}, - {value: 0x0012, lo: 0x92, hi: 0xab}, - {value: 0x0013, lo: 0xac, hi: 0xbf}, - // Block 0x104, offset 0x551 - {value: 0x0013, lo: 0x80, hi: 0x85}, - {value: 0x0012, lo: 0x86, hi: 0x9f}, - {value: 0x0013, lo: 0xa0, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbf}, - // Block 0x105, offset 0x555 - {value: 0x0012, lo: 0x80, hi: 0x93}, - {value: 0x0013, lo: 0x94, hi: 0xad}, - {value: 0x0012, lo: 0xae, hi: 0xbf}, - // Block 0x106, offset 0x558 - {value: 0x0012, lo: 0x80, hi: 0x87}, - {value: 0x0013, lo: 0x88, hi: 0xa1}, - {value: 0x0012, lo: 0xa2, hi: 0xbb}, - {value: 0x0013, lo: 0xbc, hi: 0xbf}, - // Block 0x107, offset 0x55c - {value: 0x0013, lo: 0x80, hi: 0x95}, - {value: 0x0012, lo: 0x96, hi: 0xaf}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x108, offset 0x55f - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0012, lo: 0x8a, hi: 0xa5}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0x109, offset 0x562 - {value: 0x0013, lo: 0x80, hi: 0x80}, - {value: 0x0012, lo: 0x82, hi: 0x9a}, - {value: 0x0012, lo: 0x9c, hi: 0xa1}, - {value: 0x0013, lo: 0xa2, hi: 0xba}, - {value: 0x0012, lo: 0xbc, hi: 0xbf}, - // Block 0x10a, offset 0x567 - {value: 0x0012, lo: 0x80, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0xb4}, - {value: 0x0012, lo: 0xb6, hi: 0xbf}, - // Block 0x10b, offset 0x56b - {value: 0x0012, lo: 0x80, hi: 0x8e}, - {value: 0x0012, lo: 0x90, hi: 0x95}, - {value: 0x0013, lo: 0x96, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x10c, offset 0x56f - {value: 0x0012, lo: 0x80, hi: 0x88}, - {value: 0x0012, lo: 0x8a, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0x10d, offset 0x573 - {value: 0x0012, lo: 0x80, hi: 0x82}, - {value: 0x0012, lo: 0x84, hi: 0x89}, - {value: 0x0017, lo: 0x8a, hi: 0x8b}, - {value: 0x0010, lo: 0x8e, hi: 0xbf}, - // Block 0x10e, offset 0x577 - {value: 0x0014, lo: 0x80, hi: 0xb6}, - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x10f, offset 0x579 - {value: 0x0014, lo: 0x80, hi: 0xac}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x110, offset 0x57b - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x9b, hi: 0x9f}, - {value: 0x0014, lo: 0xa1, hi: 0xaf}, - // Block 0x111, offset 0x57e - {value: 0x0024, lo: 0x80, hi: 0x86}, - {value: 0x0024, lo: 0x88, hi: 0x98}, - {value: 0x0024, lo: 0x9b, hi: 0xa1}, - {value: 0x0024, lo: 0xa3, hi: 0xa4}, - {value: 0x0024, lo: 0xa6, hi: 0xaa}, - // Block 0x112, offset 0x583 - {value: 0x0010, lo: 0x80, hi: 0xac}, - {value: 0x0024, lo: 0xb0, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xbd}, - // Block 0x113, offset 0x586 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - // Block 0x114, offset 0x588 - {value: 0x0010, lo: 0x80, hi: 0xab}, - {value: 0x0024, lo: 0xac, hi: 0xaf}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x115, offset 0x58b - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0034, lo: 0x90, hi: 0x96}, - // Block 0x116, offset 0x58d - {value: 0xbc52, lo: 0x80, hi: 0x81}, - {value: 0xbf52, lo: 0x82, hi: 0x83}, - {value: 0x0024, lo: 0x84, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x117, offset 0x593 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x9f}, - {value: 0x0010, lo: 0xa1, hi: 0xa2}, - {value: 0x0010, lo: 0xa4, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb7}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - // Block 0x118, offset 0x59c - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x9b}, - {value: 0x0010, lo: 0xa1, hi: 0xa3}, - {value: 0x0010, lo: 0xa5, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xbb}, - // Block 0x119, offset 0x5a1 - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x11a, offset 0x5a2 - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x11b, offset 0x5a5 - {value: 0x0013, lo: 0x80, hi: 0x89}, - // Block 0x11c, offset 0x5a6 - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x11d, offset 0x5a7 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0014, lo: 0xa0, hi: 0xbf}, - // Block 0x11e, offset 0x5a9 - {value: 0x0014, lo: 0x80, hi: 0xbf}, - // Block 0x11f, offset 0x5aa - {value: 0x0014, lo: 0x80, hi: 0xaf}, -} - -// Total table size 15070 bytes (14KiB); checksum: 1EB13752 diff --git a/vendor/golang.org/x/text/cases/tables13.0.0.go b/vendor/golang.org/x/text/cases/tables13.0.0.go deleted file mode 100644 index cd874775b3..0000000000 --- a/vendor/golang.org/x/text/cases/tables13.0.0.go +++ /dev/null @@ -1,2400 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -//go:build go1.16 -// +build go1.16 - -package cases - -// UnicodeVersion is the Unicode version from which the tables in this package are derived. -const UnicodeVersion = "13.0.0" - -var xorData string = "" + // Size: 192 bytes - "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + - "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + - "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + - "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + - "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + - "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + - "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + - "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + - "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01" + - "\x1e\x00\x01\x22" - -var exceptions string = "" + // Size: 2450 bytes - "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + - "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + - "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + - "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + - "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + - "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + - "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + - "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + - "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + - "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + - "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + - "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + - "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + - "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + - "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + - "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + - "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + - "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + - "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + - "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + - "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + - "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + - "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + - "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + - "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + - "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + - "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + - "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + - "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + - "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + - "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + - "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + - "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + - "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + - "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + - "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + - "խ" - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// caseTrie. Total size: 12538 bytes (12.24 KiB). Checksum: af4dfa7d60c71d4c. -type caseTrie struct{} - -func newCaseTrie(i int) *caseTrie { - return &caseTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { - switch { - case n < 20: - return uint16(caseValues[n<<6+uint32(b)]) - default: - n -= 20 - return uint16(sparse.lookup(n, b)) - } -} - -// caseValues: 22 blocks, 1408 entries, 2816 bytes -// The third block is the zero block. -var caseValues = [1408]uint16{ - // Block 0x0, offset 0x0 - 0x27: 0x0054, - 0x2e: 0x0054, - 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, - 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, - // Block 0x1, offset 0x40 - 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, - 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, - 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, - 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, - 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, - 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, - 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, - 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, - 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, - 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, - 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, - 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, - 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, - 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, - 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, - 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, - 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, - 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, - 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, - 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, - // Block 0x4, offset 0x100 - 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, - 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, - 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, - 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, - 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, - 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, - 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, - 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, - 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, - 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, - 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, - // Block 0x5, offset 0x140 - 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, - 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, - 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, - 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, - 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, - 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, - 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, - 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, - 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, - 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, - 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, - // Block 0x6, offset 0x180 - 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, - 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, - 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, - 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, - 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, - 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, - 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, - 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, - 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, - 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, - 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, - 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, - 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, - 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, - 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, - 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, - 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, - 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, - 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, - 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, - 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, - // Block 0x8, offset 0x200 - 0x204: 0x0004, 0x205: 0x0004, - 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, - 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, - 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, - 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, - 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, - 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, - 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, - 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, - 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, - 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, - // Block 0x9, offset 0x240 - 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, - 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, - 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, - 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, - 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, - 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, - 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, - 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, - 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, - 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, - 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, - // Block 0xa, offset 0x280 - 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, - 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, 0x28a: 0x0010, - 0x291: 0x0034, - 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, - 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, - 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, - 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, - 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, - 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, - 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, - 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, - 0x2c7: 0x7053, - 0x2cd: 0x7053, 0x2d0: 0x1aea, 0x2d1: 0x1b6a, - 0x2d2: 0x1bea, 0x2d3: 0x1c6a, 0x2d4: 0x1cea, 0x2d5: 0x1d6a, 0x2d6: 0x1dea, 0x2d7: 0x1e6a, - 0x2d8: 0x1eea, 0x2d9: 0x1f6a, 0x2da: 0x1fea, 0x2db: 0x206a, 0x2dc: 0x20ea, 0x2dd: 0x216a, - 0x2de: 0x21ea, 0x2df: 0x226a, 0x2e0: 0x22ea, 0x2e1: 0x236a, 0x2e2: 0x23ea, 0x2e3: 0x246a, - 0x2e4: 0x24ea, 0x2e5: 0x256a, 0x2e6: 0x25ea, 0x2e7: 0x266a, 0x2e8: 0x26ea, 0x2e9: 0x276a, - 0x2ea: 0x27ea, 0x2eb: 0x286a, 0x2ec: 0x28ea, 0x2ed: 0x296a, 0x2ee: 0x29ea, 0x2ef: 0x2a6a, - 0x2f0: 0x2aea, 0x2f1: 0x2b6a, 0x2f2: 0x2bea, 0x2f3: 0x2c6a, 0x2f4: 0x2cea, 0x2f5: 0x2d6a, - 0x2f6: 0x2dea, 0x2f7: 0x2e6a, 0x2f8: 0x2eea, 0x2f9: 0x2f6a, 0x2fa: 0x2fea, - 0x2fc: 0x0014, 0x2fd: 0x306a, 0x2fe: 0x30ea, 0x2ff: 0x316a, - // Block 0xc, offset 0x300 - 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, - 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, - 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3b1a, 0x311: 0x0812, - 0x312: 0x3bfa, 0x313: 0x0812, 0x314: 0x3d3a, 0x315: 0x0812, 0x316: 0x3e7a, 0x317: 0x0812, - 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, - 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, - 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, - 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, - 0x330: 0x9252, 0x331: 0x9252, 0x332: 0x9552, 0x333: 0x9552, 0x334: 0x9852, 0x335: 0x9852, - 0x336: 0x9b52, 0x337: 0x9b52, 0x338: 0x9e52, 0x339: 0x9e52, 0x33a: 0xa152, 0x33b: 0xa152, - 0x33c: 0x4d52, 0x33d: 0x4d52, - // Block 0xd, offset 0x340 - 0x340: 0x3fba, 0x341: 0x40aa, 0x342: 0x419a, 0x343: 0x428a, 0x344: 0x437a, 0x345: 0x446a, - 0x346: 0x455a, 0x347: 0x464a, 0x348: 0x4739, 0x349: 0x4829, 0x34a: 0x4919, 0x34b: 0x4a09, - 0x34c: 0x4af9, 0x34d: 0x4be9, 0x34e: 0x4cd9, 0x34f: 0x4dc9, 0x350: 0x4eba, 0x351: 0x4faa, - 0x352: 0x509a, 0x353: 0x518a, 0x354: 0x527a, 0x355: 0x536a, 0x356: 0x545a, 0x357: 0x554a, - 0x358: 0x5639, 0x359: 0x5729, 0x35a: 0x5819, 0x35b: 0x5909, 0x35c: 0x59f9, 0x35d: 0x5ae9, - 0x35e: 0x5bd9, 0x35f: 0x5cc9, 0x360: 0x5dba, 0x361: 0x5eaa, 0x362: 0x5f9a, 0x363: 0x608a, - 0x364: 0x617a, 0x365: 0x626a, 0x366: 0x635a, 0x367: 0x644a, 0x368: 0x6539, 0x369: 0x6629, - 0x36a: 0x6719, 0x36b: 0x6809, 0x36c: 0x68f9, 0x36d: 0x69e9, 0x36e: 0x6ad9, 0x36f: 0x6bc9, - 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6cba, 0x373: 0x6dca, 0x374: 0x6e9a, - 0x376: 0x6f7a, 0x377: 0x705a, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x9253, 0x37b: 0x9253, - 0x37c: 0x7199, 0x37d: 0x0004, 0x37e: 0x726a, 0x37f: 0x0004, - // Block 0xe, offset 0x380 - 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x72ea, 0x383: 0x73fa, 0x384: 0x74ca, - 0x386: 0x75aa, 0x387: 0x768a, 0x388: 0x9553, 0x389: 0x9553, 0x38a: 0x9853, 0x38b: 0x9853, - 0x38c: 0x77c9, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, - 0x392: 0x789a, 0x393: 0x79da, 0x396: 0x7b1a, 0x397: 0x7bfa, - 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9b53, 0x39b: 0x9b53, 0x39d: 0x0004, - 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7d3a, 0x3a3: 0x7e7a, - 0x3a4: 0x7fba, 0x3a5: 0x0912, 0x3a6: 0x809a, 0x3a7: 0x817a, 0x3a8: 0x0813, 0x3a9: 0x0813, - 0x3aa: 0xa153, 0x3ab: 0xa153, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, - 0x3b2: 0x82ba, 0x3b3: 0x83ca, 0x3b4: 0x849a, - 0x3b6: 0x857a, 0x3b7: 0x865a, 0x3b8: 0x9e53, 0x3b9: 0x9e53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, - 0x3bc: 0x8799, 0x3bd: 0x0004, 0x3be: 0x0004, - // Block 0xf, offset 0x3c0 - 0x3c2: 0x0013, - 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, - 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, - 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, - 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, - 0x3e4: 0x0013, 0x3e6: 0x886b, 0x3e8: 0x0013, - 0x3ea: 0x88cb, 0x3eb: 0x890b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, - 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa453, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, - 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, - 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, - // Block 0x10, offset 0x400 - 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, - 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, - 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa752, 0x411: 0xa752, - 0x412: 0xaa52, 0x413: 0xaa52, 0x414: 0xad52, 0x415: 0xad52, 0x416: 0xaa52, 0x417: 0xaa52, - 0x418: 0xa752, 0x419: 0xa752, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, - 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, - 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, - // Block 0x11, offset 0x440 - 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, - 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, - 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xb052, 0x451: 0xb052, - 0x452: 0xb052, 0x453: 0xb052, 0x454: 0xb052, 0x455: 0xb052, 0x456: 0xb052, 0x457: 0xb052, - 0x458: 0xb052, 0x459: 0xb052, 0x45a: 0xb052, 0x45b: 0xb052, 0x45c: 0xb052, 0x45d: 0xb052, - 0x45e: 0xb052, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x896b, 0x463: 0x8b53, - 0x464: 0x89cb, 0x465: 0x8a2a, 0x466: 0x8a8a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, - 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8aeb, 0x46e: 0x8b4b, 0x46f: 0x8bab, - 0x470: 0x8c0b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, - 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, - 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8c6b, 0x47f: 0x8ccb, - // Block 0x12, offset 0x480 - 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, - 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, - 0x48c: 0x0712, 0x48d: 0x8d2b, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, - 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x6552, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, - 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, - 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, - 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, - 0x4aa: 0x8d8b, 0x4ab: 0x8deb, 0x4ac: 0x8e4b, 0x4ad: 0x8eab, 0x4ae: 0x8f0b, 0x4af: 0x0012, - 0x4b0: 0x8f6b, 0x4b1: 0x8fcb, 0x4b2: 0x902b, 0x4b3: 0xb353, 0x4b4: 0x0113, 0x4b5: 0x0112, - 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, 0x4ba: 0x0113, 0x4bb: 0x0112, - 0x4bc: 0x0113, 0x4bd: 0x0112, 0x4be: 0x0113, 0x4bf: 0x0112, - // Block 0x13, offset 0x4c0 - 0x4c0: 0x90ea, 0x4c1: 0x916a, 0x4c2: 0x91ea, 0x4c3: 0x926a, 0x4c4: 0x931a, 0x4c5: 0x93ca, - 0x4c6: 0x944a, - 0x4d3: 0x94ca, 0x4d4: 0x95aa, 0x4d5: 0x968a, 0x4d6: 0x976a, 0x4d7: 0x984a, - 0x4dd: 0x0010, - 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, - 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, - 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, - 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, - 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, - 0x4fc: 0x0010, 0x4fe: 0x0010, - // Block 0x14, offset 0x500 - 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, - 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, - 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, - 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, - 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, - 0x51e: 0xbc53, 0x51f: 0xbc53, 0x520: 0xbf53, 0x521: 0xbf53, 0x522: 0x2212, 0x523: 0x2212, - 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, - 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, - 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, - 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, - 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, - // Block 0x15, offset 0x540 - 0x542: 0x0010, - 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, - 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, - 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, - 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, - 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, - 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, - 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, - 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, - 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, - 0x57c: 0x0010, 0x57e: 0x0010, -} - -// caseIndex: 25 blocks, 1600 entries, 3200 bytes -// Block 0 is the zero block. -var caseIndex = [1600]uint16{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, - 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, - 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, - 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, - 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, - 0xf0: 0x14, 0xf3: 0x16, - // Block 0x4, offset 0x100 - 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, - 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, - 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, - 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, - // Block 0x5, offset 0x140 - 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, - 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, - 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, - 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, - 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, - 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16b: 0x66, 0x16c: 0x67, 0x16d: 0x68, 0x16e: 0x69, 0x16f: 0x6a, - 0x170: 0x6b, 0x171: 0x6c, 0x172: 0x6d, 0x173: 0x6e, 0x174: 0x6f, 0x175: 0x70, 0x176: 0x71, 0x177: 0x72, - 0x178: 0x73, 0x179: 0x73, 0x17a: 0x74, 0x17b: 0x73, 0x17c: 0x75, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, - // Block 0x6, offset 0x180 - 0x180: 0x76, 0x181: 0x77, 0x182: 0x78, 0x183: 0x79, 0x184: 0x0d, 0x185: 0x7a, 0x186: 0x7b, - 0x192: 0x7c, 0x193: 0x0e, - 0x1b0: 0x7d, 0x1b1: 0x0f, 0x1b2: 0x73, 0x1b3: 0x7e, 0x1b4: 0x7f, 0x1b5: 0x80, 0x1b6: 0x81, 0x1b7: 0x82, - 0x1b8: 0x83, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x84, 0x1c2: 0x85, 0x1c3: 0x86, 0x1c4: 0x87, 0x1c5: 0x24, 0x1c6: 0x88, - // Block 0x8, offset 0x200 - 0x200: 0x89, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, - 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, - 0x210: 0x24, 0x211: 0x24, 0x212: 0x8a, 0x213: 0x8b, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, - 0x218: 0x8c, 0x219: 0x8d, 0x21a: 0x8e, 0x21b: 0x8f, 0x21c: 0x90, 0x21d: 0x91, 0x21e: 0x10, 0x21f: 0x92, - 0x220: 0x93, 0x221: 0x94, 0x222: 0x24, 0x223: 0x95, 0x224: 0x96, 0x225: 0x97, 0x226: 0x98, 0x227: 0x99, - 0x228: 0x9a, 0x229: 0x9b, 0x22a: 0x9c, 0x22b: 0x9d, 0x22c: 0x9e, 0x22d: 0x9f, 0x22e: 0xa0, 0x22f: 0xa1, - 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, - 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, - // Block 0x9, offset 0x240 - 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, - 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, - 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, - 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, - 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, - 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, - 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, - 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, - // Block 0xa, offset 0x280 - 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, - 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, - 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, - 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa2, 0x29f: 0xa3, - // Block 0xb, offset 0x2c0 - 0x2ec: 0x11, 0x2ed: 0xa4, 0x2ee: 0xa5, 0x2ef: 0xa6, - 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa7, 0x2f5: 0xa8, 0x2f6: 0xa9, 0x2f7: 0xaa, - 0x2f8: 0xab, 0x2f9: 0xac, 0x2fa: 0x24, 0x2fb: 0xad, 0x2fc: 0xae, 0x2fd: 0xaf, 0x2fe: 0xb0, 0x2ff: 0xb1, - // Block 0xc, offset 0x300 - 0x300: 0xb2, 0x301: 0xb3, 0x302: 0x24, 0x303: 0xb4, 0x305: 0xb5, 0x307: 0xb6, - 0x30a: 0xb7, 0x30b: 0xb8, 0x30c: 0xb9, 0x30d: 0xba, 0x30e: 0xbb, 0x30f: 0xbc, - 0x310: 0xbd, 0x311: 0xbe, 0x312: 0xbf, 0x313: 0xc0, 0x314: 0xc1, 0x315: 0xc2, - 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc3, 0x31d: 0xc4, - 0x320: 0xc5, 0x321: 0xc6, 0x322: 0xc7, 0x323: 0xc8, 0x324: 0xc9, 0x326: 0xca, - 0x328: 0xcb, 0x329: 0xcc, 0x32a: 0xcd, 0x32b: 0xce, 0x32c: 0x5f, 0x32d: 0xcf, 0x32e: 0xd0, - 0x330: 0x24, 0x331: 0xd1, 0x332: 0xd2, 0x333: 0xd3, 0x334: 0xd4, - 0x33a: 0xd5, 0x33c: 0xd6, 0x33d: 0xd7, 0x33e: 0xd8, 0x33f: 0xd9, - // Block 0xd, offset 0x340 - 0x340: 0xda, 0x341: 0xdb, 0x342: 0xdc, 0x343: 0xdd, 0x344: 0xde, 0x345: 0xdf, 0x346: 0xe0, 0x347: 0xe1, - 0x348: 0xe2, 0x34a: 0xe3, 0x34b: 0xe4, 0x34c: 0xe5, 0x34d: 0xe6, - 0x350: 0xe7, 0x351: 0xe8, 0x352: 0xe9, 0x353: 0xea, 0x356: 0xeb, 0x357: 0xec, - 0x358: 0xed, 0x359: 0xee, 0x35a: 0xef, 0x35b: 0xf0, 0x35c: 0xf1, - 0x360: 0xf2, 0x362: 0xf3, 0x363: 0xf4, 0x364: 0xf5, 0x365: 0xf6, 0x366: 0xf7, 0x367: 0xf8, - 0x368: 0xf9, 0x369: 0xfa, 0x36a: 0xfb, 0x36b: 0xfc, - 0x370: 0xfd, 0x371: 0xfe, 0x372: 0xff, 0x374: 0x100, 0x375: 0x101, 0x376: 0x102, - 0x37b: 0x103, 0x37e: 0x104, - // Block 0xe, offset 0x380 - 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, - 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0x105, - 0x390: 0x24, 0x391: 0x106, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0x107, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, - 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, - 0x3d0: 0x108, - // Block 0x10, offset 0x400 - 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, - 0x418: 0x24, 0x419: 0x109, - // Block 0x11, offset 0x440 - 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, - 0x468: 0xfc, 0x469: 0x10a, 0x46b: 0x10b, 0x46c: 0x10c, 0x46d: 0x10d, 0x46e: 0x10e, - 0x479: 0x10f, 0x47c: 0x24, 0x47d: 0x110, 0x47e: 0x111, 0x47f: 0x112, - // Block 0x12, offset 0x480 - 0x4b0: 0x24, 0x4b1: 0x113, 0x4b2: 0x114, - // Block 0x13, offset 0x4c0 - 0x4c5: 0x115, 0x4c6: 0x116, - 0x4c9: 0x117, - 0x4d0: 0x118, 0x4d1: 0x119, 0x4d2: 0x11a, 0x4d3: 0x11b, 0x4d4: 0x11c, 0x4d5: 0x11d, 0x4d6: 0x11e, 0x4d7: 0x11f, - 0x4d8: 0x120, 0x4d9: 0x121, 0x4da: 0x122, 0x4db: 0x123, 0x4dc: 0x124, 0x4dd: 0x125, 0x4de: 0x126, 0x4df: 0x127, - 0x4e8: 0x128, 0x4e9: 0x129, 0x4ea: 0x12a, - // Block 0x14, offset 0x500 - 0x500: 0x12b, 0x504: 0x12c, 0x505: 0x12d, - 0x50b: 0x12e, - 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x12f, 0x524: 0x12, 0x525: 0x130, - 0x538: 0x131, 0x539: 0x13, 0x53a: 0x132, - // Block 0x15, offset 0x540 - 0x544: 0x133, 0x545: 0x134, 0x546: 0x135, - 0x54f: 0x136, - 0x56f: 0x137, - // Block 0x16, offset 0x580 - 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, - 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, - // Block 0x17, offset 0x5c0 - 0x5c0: 0x138, 0x5c1: 0x139, 0x5c4: 0x139, 0x5c5: 0x139, 0x5c6: 0x139, 0x5c7: 0x13a, - // Block 0x18, offset 0x600 - 0x620: 0x15, -} - -// sparseOffsets: 296 entries, 592 bytes -var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x34, 0x37, 0x3b, 0x3e, 0x42, 0x4c, 0x4e, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xc0, 0xc6, 0xd4, 0xdf, 0xec, 0xf7, 0x103, 0x10d, 0x119, 0x124, 0x130, 0x13c, 0x144, 0x14d, 0x157, 0x162, 0x16e, 0x174, 0x17f, 0x185, 0x18d, 0x190, 0x195, 0x199, 0x19d, 0x1a4, 0x1ad, 0x1b5, 0x1b6, 0x1bf, 0x1c6, 0x1ce, 0x1d4, 0x1d9, 0x1dd, 0x1e0, 0x1e2, 0x1e5, 0x1ea, 0x1eb, 0x1ed, 0x1ef, 0x1f1, 0x1f8, 0x1fd, 0x201, 0x20a, 0x20d, 0x210, 0x216, 0x217, 0x222, 0x223, 0x224, 0x229, 0x236, 0x23f, 0x240, 0x248, 0x251, 0x25a, 0x263, 0x268, 0x26b, 0x276, 0x284, 0x286, 0x28d, 0x291, 0x29d, 0x29e, 0x2a9, 0x2b1, 0x2b9, 0x2bf, 0x2c0, 0x2ce, 0x2d3, 0x2d6, 0x2db, 0x2df, 0x2e5, 0x2ea, 0x2ed, 0x2f2, 0x2f7, 0x2f8, 0x2fe, 0x300, 0x301, 0x303, 0x305, 0x308, 0x309, 0x30b, 0x30e, 0x314, 0x318, 0x31a, 0x31f, 0x326, 0x331, 0x33b, 0x33c, 0x345, 0x349, 0x34e, 0x356, 0x35c, 0x362, 0x36c, 0x371, 0x37a, 0x380, 0x389, 0x38d, 0x395, 0x397, 0x399, 0x39c, 0x39e, 0x3a0, 0x3a1, 0x3a2, 0x3a4, 0x3a6, 0x3ac, 0x3b1, 0x3b3, 0x3ba, 0x3bd, 0x3bf, 0x3c5, 0x3ca, 0x3cc, 0x3cd, 0x3ce, 0x3cf, 0x3d1, 0x3d3, 0x3d5, 0x3d8, 0x3da, 0x3dd, 0x3e5, 0x3e8, 0x3ec, 0x3f4, 0x3f6, 0x3f7, 0x3f8, 0x3fa, 0x400, 0x402, 0x403, 0x405, 0x407, 0x409, 0x416, 0x417, 0x418, 0x41c, 0x41e, 0x41f, 0x420, 0x421, 0x422, 0x425, 0x428, 0x42b, 0x431, 0x432, 0x434, 0x438, 0x43c, 0x442, 0x445, 0x44c, 0x450, 0x454, 0x45d, 0x466, 0x46c, 0x472, 0x47c, 0x486, 0x488, 0x491, 0x497, 0x49d, 0x4a3, 0x4a6, 0x4ac, 0x4af, 0x4b8, 0x4b9, 0x4c0, 0x4c4, 0x4c5, 0x4c8, 0x4d2, 0x4d5, 0x4d7, 0x4de, 0x4e6, 0x4ec, 0x4f2, 0x4f3, 0x4f9, 0x4fc, 0x504, 0x50b, 0x515, 0x51d, 0x520, 0x521, 0x522, 0x523, 0x524, 0x526, 0x527, 0x529, 0x52b, 0x52d, 0x531, 0x532, 0x534, 0x537, 0x539, 0x53c, 0x53e, 0x543, 0x548, 0x54c, 0x54d, 0x550, 0x554, 0x55f, 0x563, 0x56b, 0x570, 0x574, 0x577, 0x57b, 0x57e, 0x581, 0x586, 0x58a, 0x58e, 0x592, 0x596, 0x598, 0x59a, 0x59d, 0x5a2, 0x5a5, 0x5a7, 0x5aa, 0x5ac, 0x5b2, 0x5bb, 0x5c0, 0x5c1, 0x5c4, 0x5c5, 0x5c6, 0x5c7, 0x5c9, 0x5ca, 0x5cb} - -// sparseValues: 1483 entries, 5932 bytes -var sparseValues = [1483]valueRange{ - // Block 0x0, offset 0x0 - {value: 0x0004, lo: 0xa8, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xaa}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0004, lo: 0xaf, hi: 0xaf}, - {value: 0x0004, lo: 0xb4, hi: 0xb4}, - {value: 0x001a, lo: 0xb5, hi: 0xb5}, - {value: 0x0054, lo: 0xb7, hi: 0xb7}, - {value: 0x0004, lo: 0xb8, hi: 0xb8}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - // Block 0x1, offset 0x9 - {value: 0x2013, lo: 0x80, hi: 0x96}, - {value: 0x2013, lo: 0x98, hi: 0x9e}, - {value: 0x009a, lo: 0x9f, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xb6}, - {value: 0x2012, lo: 0xb8, hi: 0xbe}, - {value: 0x0252, lo: 0xbf, hi: 0xbf}, - // Block 0x2, offset 0xf - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x011b, lo: 0xb0, hi: 0xb0}, - {value: 0x019a, lo: 0xb1, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb7}, - {value: 0x0012, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x0553, lo: 0xbf, hi: 0xbf}, - // Block 0x3, offset 0x18 - {value: 0x0552, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x01da, lo: 0x89, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xb7}, - {value: 0x0253, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x028a, lo: 0xbf, hi: 0xbf}, - // Block 0x4, offset 0x24 - {value: 0x0117, lo: 0x80, hi: 0x9f}, - {value: 0x2f53, lo: 0xa0, hi: 0xa0}, - {value: 0x0012, lo: 0xa1, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xb3}, - {value: 0x0012, lo: 0xb4, hi: 0xb9}, - {value: 0x090b, lo: 0xba, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x2953, lo: 0xbd, hi: 0xbd}, - {value: 0x098b, lo: 0xbe, hi: 0xbe}, - {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, - // Block 0x5, offset 0x2e - {value: 0x0015, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x97}, - {value: 0x0004, lo: 0x98, hi: 0x9d}, - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0015, lo: 0xa0, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xbf}, - // Block 0x6, offset 0x34 - {value: 0x0024, lo: 0x80, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbf}, - // Block 0x7, offset 0x37 - {value: 0x6553, lo: 0x80, hi: 0x8f}, - {value: 0x2013, lo: 0x90, hi: 0x9f}, - {value: 0x5f53, lo: 0xa0, hi: 0xaf}, - {value: 0x2012, lo: 0xb0, hi: 0xbf}, - // Block 0x8, offset 0x3b - {value: 0x5f52, lo: 0x80, hi: 0x8f}, - {value: 0x6552, lo: 0x90, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x9, offset 0x3e - {value: 0x0117, lo: 0x80, hi: 0x81}, - {value: 0x0024, lo: 0x83, hi: 0x87}, - {value: 0x0014, lo: 0x88, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xbf}, - // Block 0xa, offset 0x42 - {value: 0x0f13, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x0316, lo: 0x89, hi: 0x8a}, - {value: 0x0716, lo: 0x8b, hi: 0x8c}, - {value: 0x0316, lo: 0x8d, hi: 0x8e}, - {value: 0x0f12, lo: 0x8f, hi: 0x8f}, - {value: 0x0117, lo: 0x90, hi: 0xbf}, - // Block 0xb, offset 0x4c - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x6553, lo: 0xb1, hi: 0xbf}, - // Block 0xc, offset 0x4e - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6853, lo: 0x90, hi: 0x96}, - {value: 0x0014, lo: 0x99, hi: 0x99}, - {value: 0x0010, lo: 0x9a, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0054, lo: 0x9f, hi: 0x9f}, - {value: 0x0012, lo: 0xa0, hi: 0xa0}, - {value: 0x6552, lo: 0xa1, hi: 0xaf}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0xd, offset 0x57 - {value: 0x0034, lo: 0x81, hi: 0x82}, - {value: 0x0024, lo: 0x84, hi: 0x84}, - {value: 0x0034, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0xaa}, - {value: 0x0010, lo: 0xaf, hi: 0xb3}, - {value: 0x0054, lo: 0xb4, hi: 0xb4}, - // Block 0xe, offset 0x5e - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0024, lo: 0x90, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0014, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xf, offset 0x63 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9c}, - {value: 0x0024, lo: 0x9d, hi: 0x9e}, - {value: 0x0034, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x10, offset 0x71 - {value: 0x0010, lo: 0x80, hi: 0xbf}, - // Block 0x11, offset 0x72 - {value: 0x0010, lo: 0x80, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0024, lo: 0x9f, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xaa, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x12, offset 0x80 - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0034, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0034, lo: 0xb1, hi: 0xb1}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbd}, - {value: 0x0034, lo: 0xbe, hi: 0xbe}, - {value: 0x0024, lo: 0xbf, hi: 0xbf}, - // Block 0x13, offset 0x8f - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0024, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x88}, - {value: 0x0024, lo: 0x89, hi: 0x8a}, - {value: 0x0010, lo: 0x8d, hi: 0xbf}, - // Block 0x14, offset 0x99 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x15, offset 0x9c - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xb1}, - {value: 0x0034, lo: 0xb2, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0x16, offset 0xa3 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x99}, - {value: 0x0014, lo: 0x9a, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0xa3}, - {value: 0x0014, lo: 0xa4, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xad}, - // Block 0x17, offset 0xab - {value: 0x0010, lo: 0x80, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x9b}, - {value: 0x0010, lo: 0xa0, hi: 0xaa}, - // Block 0x18, offset 0xae - {value: 0x0010, lo: 0xa0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0x19, offset 0xb0 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0034, lo: 0x93, hi: 0x93}, - {value: 0x0024, lo: 0x94, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0024, lo: 0xaa, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbf}, - // Block 0x1a, offset 0xc0 - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1b, offset 0xc6 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0x1c, offset 0xd4 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb6, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1d, offset 0xdf - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xb1}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - // Block 0x1e, offset 0xec - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x1f, offset 0xf7 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x99, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x20, offset 0x103 - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x21, offset 0x10d - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x85}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xbf}, - // Block 0x22, offset 0x119 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x23, offset 0x124 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x24, offset 0x130 - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0010, lo: 0xa8, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x25, offset 0x13c - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x26, offset 0x144 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb9}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbf}, - // Block 0x27, offset 0x14d - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x88}, - {value: 0x0014, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x28, offset 0x157 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x29, offset 0x162 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb2}, - // Block 0x2a, offset 0x16e - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x2b, offset 0x174 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x94, hi: 0x97}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xba, hi: 0xbf}, - // Block 0x2c, offset 0x17f - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x96}, - {value: 0x0010, lo: 0x9a, hi: 0xb1}, - {value: 0x0010, lo: 0xb3, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x2d, offset 0x185 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x94}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9f}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - // Block 0x2e, offset 0x18d - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xba}, - // Block 0x2f, offset 0x190 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x30, offset 0x195 - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xba}, - {value: 0x0014, lo: 0xbb, hi: 0xbc}, - // Block 0x31, offset 0x199 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x32, offset 0x19d - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0034, lo: 0x98, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0034, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x33, offset 0x1a4 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xac}, - {value: 0x0034, lo: 0xb1, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xba, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x34, offset 0x1ad - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0024, lo: 0x82, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x86, hi: 0x87}, - {value: 0x0010, lo: 0x88, hi: 0x8c}, - {value: 0x0014, lo: 0x8d, hi: 0x97}, - {value: 0x0014, lo: 0x99, hi: 0xbc}, - // Block 0x35, offset 0x1b5 - {value: 0x0034, lo: 0x86, hi: 0x86}, - // Block 0x36, offset 0x1b6 - {value: 0x0010, lo: 0xab, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbe}, - // Block 0x37, offset 0x1bf - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x96, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x99}, - {value: 0x0014, lo: 0x9e, hi: 0xa0}, - {value: 0x0010, lo: 0xa2, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xad}, - {value: 0x0014, lo: 0xb1, hi: 0xb4}, - // Block 0x38, offset 0x1c6 - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x6c53, lo: 0xa0, hi: 0xbf}, - // Block 0x39, offset 0x1ce - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x9a, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x3a, offset 0x1d4 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x3b, offset 0x1d9 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x82, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3c, offset 0x1dd - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3d, offset 0x1e0 - {value: 0x0010, lo: 0x80, hi: 0x9a}, - {value: 0x0024, lo: 0x9d, hi: 0x9f}, - // Block 0x3e, offset 0x1e2 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x7453, lo: 0xa0, hi: 0xaf}, - {value: 0x7853, lo: 0xb0, hi: 0xbf}, - // Block 0x3f, offset 0x1e5 - {value: 0x7c53, lo: 0x80, hi: 0x8f}, - {value: 0x8053, lo: 0x90, hi: 0x9f}, - {value: 0x7c53, lo: 0xa0, hi: 0xaf}, - {value: 0x0813, lo: 0xb0, hi: 0xb5}, - {value: 0x0892, lo: 0xb8, hi: 0xbd}, - // Block 0x40, offset 0x1ea - {value: 0x0010, lo: 0x81, hi: 0xbf}, - // Block 0x41, offset 0x1eb - {value: 0x0010, lo: 0x80, hi: 0xac}, - {value: 0x0010, lo: 0xaf, hi: 0xbf}, - // Block 0x42, offset 0x1ed - {value: 0x0010, lo: 0x81, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x43, offset 0x1ef - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb8}, - // Block 0x44, offset 0x1f1 - {value: 0x0010, lo: 0x80, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0034, lo: 0x94, hi: 0x94}, - {value: 0x0010, lo: 0xa0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - // Block 0x45, offset 0x1f8 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xac}, - {value: 0x0010, lo: 0xae, hi: 0xb0}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - // Block 0x46, offset 0x1fd - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x47, offset 0x201 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x89, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0014, lo: 0x93, hi: 0x93}, - {value: 0x0004, lo: 0x97, hi: 0x97}, - {value: 0x0024, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0x48, offset 0x20a - {value: 0x0014, lo: 0x8b, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x49, offset 0x20d - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb8}, - // Block 0x4a, offset 0x210 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x4b, offset 0x216 - {value: 0x0010, lo: 0x80, hi: 0xb5}, - // Block 0x4c, offset 0x217 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbb}, - // Block 0x4d, offset 0x222 - {value: 0x0010, lo: 0x86, hi: 0x8f}, - // Block 0x4e, offset 0x223 - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x4f, offset 0x224 - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - // Block 0x50, offset 0x229 - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x9e}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xac}, - {value: 0x0010, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xbc}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x51, offset 0x236 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xa7, hi: 0xa7}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - {value: 0x0034, lo: 0xb5, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbc}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x52, offset 0x23f - {value: 0x0034, lo: 0x80, hi: 0x80}, - // Block 0x53, offset 0x240 - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x54, offset 0x248 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0030, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8b}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xab, hi: 0xab}, - {value: 0x0034, lo: 0xac, hi: 0xac}, - {value: 0x0024, lo: 0xad, hi: 0xb3}, - // Block 0x55, offset 0x251 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0030, lo: 0xaa, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbf}, - // Block 0x56, offset 0x25a - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0030, lo: 0xb2, hi: 0xb3}, - // Block 0x57, offset 0x263 - {value: 0x0010, lo: 0x80, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0x58, offset 0x268 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8d, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x59, offset 0x26b - {value: 0x31ea, lo: 0x80, hi: 0x80}, - {value: 0x326a, lo: 0x81, hi: 0x81}, - {value: 0x32ea, lo: 0x82, hi: 0x82}, - {value: 0x336a, lo: 0x83, hi: 0x83}, - {value: 0x33ea, lo: 0x84, hi: 0x84}, - {value: 0x346a, lo: 0x85, hi: 0x85}, - {value: 0x34ea, lo: 0x86, hi: 0x86}, - {value: 0x356a, lo: 0x87, hi: 0x87}, - {value: 0x35ea, lo: 0x88, hi: 0x88}, - {value: 0x8353, lo: 0x90, hi: 0xba}, - {value: 0x8353, lo: 0xbd, hi: 0xbf}, - // Block 0x5a, offset 0x276 - {value: 0x0024, lo: 0x90, hi: 0x92}, - {value: 0x0034, lo: 0x94, hi: 0x99}, - {value: 0x0024, lo: 0x9a, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9f}, - {value: 0x0024, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0034, lo: 0xa2, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xb3}, - {value: 0x0024, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb7}, - {value: 0x0024, lo: 0xb8, hi: 0xb9}, - {value: 0x0010, lo: 0xba, hi: 0xba}, - // Block 0x5b, offset 0x284 - {value: 0x0012, lo: 0x80, hi: 0xab}, - {value: 0x0015, lo: 0xac, hi: 0xbf}, - // Block 0x5c, offset 0x286 - {value: 0x0015, lo: 0x80, hi: 0xaa}, - {value: 0x0012, lo: 0xab, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb8}, - {value: 0x8752, lo: 0xb9, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbc}, - {value: 0x8b52, lo: 0xbd, hi: 0xbd}, - {value: 0x0012, lo: 0xbe, hi: 0xbf}, - // Block 0x5d, offset 0x28d - {value: 0x0012, lo: 0x80, hi: 0x8d}, - {value: 0x8f52, lo: 0x8e, hi: 0x8e}, - {value: 0x0012, lo: 0x8f, hi: 0x9a}, - {value: 0x0015, lo: 0x9b, hi: 0xbf}, - // Block 0x5e, offset 0x291 - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0024, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb9}, - {value: 0x0024, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbd}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x5f, offset 0x29d - {value: 0x0117, lo: 0x80, hi: 0xbf}, - // Block 0x60, offset 0x29e - {value: 0x0117, lo: 0x80, hi: 0x95}, - {value: 0x369a, lo: 0x96, hi: 0x96}, - {value: 0x374a, lo: 0x97, hi: 0x97}, - {value: 0x37fa, lo: 0x98, hi: 0x98}, - {value: 0x38aa, lo: 0x99, hi: 0x99}, - {value: 0x395a, lo: 0x9a, hi: 0x9a}, - {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, - {value: 0x0012, lo: 0x9c, hi: 0x9d}, - {value: 0x3abb, lo: 0x9e, hi: 0x9e}, - {value: 0x0012, lo: 0x9f, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x61, offset 0x2a9 - {value: 0x0812, lo: 0x80, hi: 0x87}, - {value: 0x0813, lo: 0x88, hi: 0x8f}, - {value: 0x0812, lo: 0x90, hi: 0x95}, - {value: 0x0813, lo: 0x98, hi: 0x9d}, - {value: 0x0812, lo: 0xa0, hi: 0xa7}, - {value: 0x0813, lo: 0xa8, hi: 0xaf}, - {value: 0x0812, lo: 0xb0, hi: 0xb7}, - {value: 0x0813, lo: 0xb8, hi: 0xbf}, - // Block 0x62, offset 0x2b1 - {value: 0x0004, lo: 0x8b, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8f}, - {value: 0x0054, lo: 0x98, hi: 0x99}, - {value: 0x0054, lo: 0xa4, hi: 0xa4}, - {value: 0x0054, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xaa, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xaf}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x63, offset 0x2b9 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x94, hi: 0x94}, - {value: 0x0014, lo: 0xa0, hi: 0xa4}, - {value: 0x0014, lo: 0xa6, hi: 0xaf}, - {value: 0x0015, lo: 0xb1, hi: 0xb1}, - {value: 0x0015, lo: 0xbf, hi: 0xbf}, - // Block 0x64, offset 0x2bf - {value: 0x0015, lo: 0x90, hi: 0x9c}, - // Block 0x65, offset 0x2c0 - {value: 0x0024, lo: 0x90, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x93}, - {value: 0x0024, lo: 0x94, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0xa0}, - {value: 0x0024, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa4}, - {value: 0x0034, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa7}, - {value: 0x0034, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xa9}, - {value: 0x0034, lo: 0xaa, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - // Block 0x66, offset 0x2ce - {value: 0x0016, lo: 0x85, hi: 0x86}, - {value: 0x0012, lo: 0x87, hi: 0x89}, - {value: 0xa452, lo: 0x8e, hi: 0x8e}, - {value: 0x1013, lo: 0xa0, hi: 0xaf}, - {value: 0x1012, lo: 0xb0, hi: 0xbf}, - // Block 0x67, offset 0x2d3 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x88}, - // Block 0x68, offset 0x2d6 - {value: 0xa753, lo: 0xb6, hi: 0xb7}, - {value: 0xaa53, lo: 0xb8, hi: 0xb9}, - {value: 0xad53, lo: 0xba, hi: 0xbb}, - {value: 0xaa53, lo: 0xbc, hi: 0xbd}, - {value: 0xa753, lo: 0xbe, hi: 0xbf}, - // Block 0x69, offset 0x2db - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6553, lo: 0x90, hi: 0x9f}, - {value: 0xb053, lo: 0xa0, hi: 0xae}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0x6a, offset 0x2df - {value: 0x0117, lo: 0x80, hi: 0xa3}, - {value: 0x0012, lo: 0xa4, hi: 0xa4}, - {value: 0x0716, lo: 0xab, hi: 0xac}, - {value: 0x0316, lo: 0xad, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb3}, - // Block 0x6b, offset 0x2e5 - {value: 0x6c52, lo: 0x80, hi: 0x9f}, - {value: 0x7052, lo: 0xa0, hi: 0xa5}, - {value: 0x7052, lo: 0xa7, hi: 0xa7}, - {value: 0x7052, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x6c, offset 0x2ea - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x6d, offset 0x2ed - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0010, lo: 0xb0, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x6e, offset 0x2f2 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9e}, - {value: 0x0024, lo: 0xa0, hi: 0xbf}, - // Block 0x6f, offset 0x2f7 - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - // Block 0x70, offset 0x2f8 - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0xaa, hi: 0xad}, - {value: 0x0030, lo: 0xae, hi: 0xaf}, - {value: 0x0004, lo: 0xb1, hi: 0xb5}, - {value: 0x0014, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - // Block 0x71, offset 0x2fe - {value: 0x0034, lo: 0x99, hi: 0x9a}, - {value: 0x0004, lo: 0x9b, hi: 0x9e}, - // Block 0x72, offset 0x300 - {value: 0x0004, lo: 0xbc, hi: 0xbe}, - // Block 0x73, offset 0x301 - {value: 0x0010, lo: 0x85, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x74, offset 0x303 - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x75, offset 0x305 - {value: 0x0010, lo: 0x80, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0xbf}, - // Block 0x76, offset 0x308 - {value: 0x0010, lo: 0x80, hi: 0x8c}, - // Block 0x77, offset 0x309 - {value: 0x0010, lo: 0x90, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x78, offset 0x30b - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0xab}, - // Block 0x79, offset 0x30e - {value: 0x0117, lo: 0x80, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb2}, - {value: 0x0024, lo: 0xb4, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x7a, offset 0x314 - {value: 0x0117, lo: 0x80, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9d}, - {value: 0x0024, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x7b, offset 0x318 - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb1}, - // Block 0x7c, offset 0x31a - {value: 0x0004, lo: 0x80, hi: 0x87}, - {value: 0x0014, lo: 0x88, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xaf}, - {value: 0x0012, lo: 0xb0, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xbf}, - // Block 0x7d, offset 0x31f - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x0015, lo: 0xb0, hi: 0xb0}, - {value: 0x0012, lo: 0xb1, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x8753, lo: 0xbd, hi: 0xbd}, - {value: 0x0117, lo: 0xbe, hi: 0xbf}, - // Block 0x7e, offset 0x326 - {value: 0x0117, lo: 0x82, hi: 0x83}, - {value: 0x6553, lo: 0x84, hi: 0x84}, - {value: 0x908b, lo: 0x85, hi: 0x85}, - {value: 0x8f53, lo: 0x86, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x0316, lo: 0x89, hi: 0x8a}, - {value: 0x0316, lo: 0xb5, hi: 0xb6}, - {value: 0x0010, lo: 0xb7, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbf}, - // Block 0x7f, offset 0x331 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x8c, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0034, lo: 0xac, hi: 0xac}, - // Block 0x80, offset 0x33b - {value: 0x0010, lo: 0x80, hi: 0xb3}, - // Block 0x81, offset 0x33c - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xa0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb7}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x82, offset 0x345 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x83, offset 0x349 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0x92}, - {value: 0x0030, lo: 0x93, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0x84, offset 0x34e - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb9}, - {value: 0x0010, lo: 0xba, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x85, offset 0x356 - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0004, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x86, offset 0x35c - {value: 0x0010, lo: 0x80, hi: 0xa8}, - {value: 0x0014, lo: 0xa9, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0x87, offset 0x362 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x88, offset 0x36c - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0024, lo: 0xbe, hi: 0xbf}, - // Block 0x89, offset 0x371 - {value: 0x0024, lo: 0x81, hi: 0x81}, - {value: 0x0004, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - // Block 0x8a, offset 0x37a - {value: 0x0010, lo: 0x81, hi: 0x86}, - {value: 0x0010, lo: 0x89, hi: 0x8e}, - {value: 0x0010, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x8b, offset 0x380 - {value: 0x0012, lo: 0x80, hi: 0x92}, - {value: 0xb352, lo: 0x93, hi: 0x93}, - {value: 0x0012, lo: 0x94, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9f}, - {value: 0x0012, lo: 0xa0, hi: 0xa8}, - {value: 0x0014, lo: 0xa9, hi: 0xa9}, - {value: 0x0004, lo: 0xaa, hi: 0xab}, - {value: 0x74d2, lo: 0xb0, hi: 0xbf}, - // Block 0x8c, offset 0x389 - {value: 0x78d2, lo: 0x80, hi: 0x8f}, - {value: 0x7cd2, lo: 0x90, hi: 0x9f}, - {value: 0x80d2, lo: 0xa0, hi: 0xaf}, - {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, - // Block 0x8d, offset 0x38d - {value: 0x0010, lo: 0x80, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x8e, offset 0x395 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x8f, offset 0x397 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x8b, hi: 0xbb}, - // Block 0x90, offset 0x399 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0xbf}, - // Block 0x91, offset 0x39c - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0004, lo: 0xb2, hi: 0xbf}, - // Block 0x92, offset 0x39e - {value: 0x0004, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x93, hi: 0xbf}, - // Block 0x93, offset 0x3a0 - {value: 0x0010, lo: 0x80, hi: 0xbd}, - // Block 0x94, offset 0x3a1 - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0x95, offset 0x3a2 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0xbf}, - // Block 0x96, offset 0x3a4 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0xb0, hi: 0xbb}, - // Block 0x97, offset 0x3a6 - {value: 0x0014, lo: 0x80, hi: 0x8f}, - {value: 0x0054, lo: 0x93, hi: 0x93}, - {value: 0x0024, lo: 0xa0, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xad}, - {value: 0x0024, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - // Block 0x98, offset 0x3ac - {value: 0x0010, lo: 0x8d, hi: 0x8f}, - {value: 0x0054, lo: 0x92, hi: 0x92}, - {value: 0x0054, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0xb0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0x99, offset 0x3b1 - {value: 0x0010, lo: 0x80, hi: 0xbc}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x9a, offset 0x3b3 - {value: 0x0054, lo: 0x87, hi: 0x87}, - {value: 0x0054, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0054, lo: 0x9a, hi: 0x9a}, - {value: 0x5f53, lo: 0xa1, hi: 0xba}, - {value: 0x0004, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9b, offset 0x3ba - {value: 0x0004, lo: 0x80, hi: 0x80}, - {value: 0x5f52, lo: 0x81, hi: 0x9a}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - // Block 0x9c, offset 0x3bd - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbe}, - // Block 0x9d, offset 0x3bf - {value: 0x0010, lo: 0x82, hi: 0x87}, - {value: 0x0010, lo: 0x8a, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0x97}, - {value: 0x0010, lo: 0x9a, hi: 0x9c}, - {value: 0x0004, lo: 0xa3, hi: 0xa3}, - {value: 0x0014, lo: 0xb9, hi: 0xbb}, - // Block 0x9e, offset 0x3c5 - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0010, lo: 0x8d, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xba}, - {value: 0x0010, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9f, offset 0x3ca - {value: 0x0010, lo: 0x80, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x9d}, - // Block 0xa0, offset 0x3cc - {value: 0x0010, lo: 0x80, hi: 0xba}, - // Block 0xa1, offset 0x3cd - {value: 0x0010, lo: 0x80, hi: 0xb4}, - // Block 0xa2, offset 0x3ce - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0xa3, offset 0x3cf - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa4, offset 0x3d1 - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - // Block 0xa5, offset 0x3d3 - {value: 0x0010, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xad, hi: 0xbf}, - // Block 0xa6, offset 0x3d5 - {value: 0x0010, lo: 0x80, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0xb5}, - {value: 0x0024, lo: 0xb6, hi: 0xba}, - // Block 0xa7, offset 0x3d8 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa8, offset 0x3da - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x91, hi: 0x95}, - // Block 0xa9, offset 0x3dd - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x97}, - {value: 0xb653, lo: 0x98, hi: 0x9f}, - {value: 0xb953, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbf}, - // Block 0xaa, offset 0x3e5 - {value: 0xb652, lo: 0x80, hi: 0x87}, - {value: 0xb952, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0xab, offset 0x3e8 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0xb953, lo: 0xb0, hi: 0xb7}, - {value: 0xb653, lo: 0xb8, hi: 0xbf}, - // Block 0xac, offset 0x3ec - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x93}, - {value: 0xb952, lo: 0x98, hi: 0x9f}, - {value: 0xb652, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbb}, - // Block 0xad, offset 0x3f4 - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xae, offset 0x3f6 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - // Block 0xaf, offset 0x3f7 - {value: 0x0010, lo: 0x80, hi: 0xb6}, - // Block 0xb0, offset 0x3f8 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xa7}, - // Block 0xb1, offset 0x3fa - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xb5}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xb2, offset 0x400 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xb3, offset 0x402 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - // Block 0xb4, offset 0x403 - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - // Block 0xb5, offset 0x405 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb9}, - // Block 0xb6, offset 0x407 - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0xb7, offset 0x409 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x8e, hi: 0x8e}, - {value: 0x0024, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x99, hi: 0xb5}, - {value: 0x0024, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xb8, offset 0x416 - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0xb9, offset 0x417 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - // Block 0xba, offset 0x418 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - // Block 0xbb, offset 0x41c - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - // Block 0xbc, offset 0x41e - {value: 0x0010, lo: 0x80, hi: 0x91}, - // Block 0xbd, offset 0x41f - {value: 0x0010, lo: 0x80, hi: 0x88}, - // Block 0xbe, offset 0x420 - {value: 0x5653, lo: 0x80, hi: 0xb2}, - // Block 0xbf, offset 0x421 - {value: 0x5652, lo: 0x80, hi: 0xb2}, - // Block 0xc0, offset 0x422 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xc1, offset 0x425 - {value: 0x0010, lo: 0x80, hi: 0xa9}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0010, lo: 0xb0, hi: 0xb1}, - // Block 0xc2, offset 0x428 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xc3, offset 0x42b - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x87}, - {value: 0x0024, lo: 0x88, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x8b}, - {value: 0x0024, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - // Block 0xc4, offset 0x431 - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xc5, offset 0x432 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xc6, offset 0x434 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xc7, offset 0x438 - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xc8, offset 0x43c - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb6}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - // Block 0xc9, offset 0x442 - {value: 0x0014, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xca, offset 0x445 - {value: 0x0024, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0xcb, offset 0x44c - {value: 0x0010, lo: 0x84, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - // Block 0xcc, offset 0x450 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xcd, offset 0x454 - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x89, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - // Block 0xce, offset 0x45d - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb4}, - {value: 0x0030, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xb7}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0xcf, offset 0x466 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xd0, offset 0x46c - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa2}, - {value: 0x0014, lo: 0xa3, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xd1, offset 0x472 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xd2, offset 0x47c - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0030, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9d, hi: 0xa3}, - {value: 0x0024, lo: 0xa6, hi: 0xac}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - // Block 0xd3, offset 0x486 - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xd4, offset 0x488 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - // Block 0xd5, offset 0x491 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xd6, offset 0x497 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd7, offset 0x49d - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd8, offset 0x4a3 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x98, hi: 0x9b}, - {value: 0x0014, lo: 0x9c, hi: 0x9d}, - // Block 0xd9, offset 0x4a6 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xda, offset 0x4ac - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xdb, offset 0x4af - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0014, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb5}, - {value: 0x0030, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - // Block 0xdc, offset 0x4b8 - {value: 0x0010, lo: 0x80, hi: 0x89}, - // Block 0xdd, offset 0x4b9 - {value: 0x0014, lo: 0x9d, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xde, offset 0x4c0 - {value: 0x0010, lo: 0x80, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - // Block 0xdf, offset 0x4c4 - {value: 0x5f53, lo: 0xa0, hi: 0xbf}, - // Block 0xe0, offset 0x4c5 - {value: 0x5f52, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xe1, offset 0x4c8 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x89, hi: 0x89}, - {value: 0x0010, lo: 0x8c, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0xb5}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0014, lo: 0xbb, hi: 0xbc}, - {value: 0x0030, lo: 0xbd, hi: 0xbd}, - {value: 0x0034, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xe2, offset 0x4d2 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0034, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xe3, offset 0x4d5 - {value: 0x0010, lo: 0xa0, hi: 0xa7}, - {value: 0x0010, lo: 0xaa, hi: 0xbf}, - // Block 0xe4, offset 0x4d7 - {value: 0x0010, lo: 0x80, hi: 0x93}, - {value: 0x0014, lo: 0x94, hi: 0x97}, - {value: 0x0014, lo: 0x9a, hi: 0x9b}, - {value: 0x0010, lo: 0x9c, hi: 0x9f}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - // Block 0xe5, offset 0x4de - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x8a}, - {value: 0x0010, lo: 0x8b, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbb, hi: 0xbe}, - // Block 0xe6, offset 0x4e6 - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0014, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x98}, - {value: 0x0014, lo: 0x99, hi: 0x9b}, - {value: 0x0010, lo: 0x9c, hi: 0xbf}, - // Block 0xe7, offset 0x4ec - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0014, lo: 0x8a, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x99}, - {value: 0x0010, lo: 0x9d, hi: 0x9d}, - // Block 0xe8, offset 0x4f2 - {value: 0x0010, lo: 0x80, hi: 0xb8}, - // Block 0xe9, offset 0x4f3 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb6}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xea, offset 0x4f9 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0xeb, offset 0x4fc - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0014, lo: 0x92, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xa9}, - {value: 0x0014, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0xec, offset 0x504 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb6}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xed, offset 0x50b - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa5}, - {value: 0x0010, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xbf}, - // Block 0xee, offset 0x515 - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0014, lo: 0x90, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0x96}, - {value: 0x0034, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xef, offset 0x51d - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - // Block 0xf0, offset 0x520 - {value: 0x0010, lo: 0xb0, hi: 0xb0}, - // Block 0xf1, offset 0x521 - {value: 0x0010, lo: 0x80, hi: 0x99}, - // Block 0xf2, offset 0x522 - {value: 0x0010, lo: 0x80, hi: 0xae}, - // Block 0xf3, offset 0x523 - {value: 0x0010, lo: 0x80, hi: 0x83}, - // Block 0xf4, offset 0x524 - {value: 0x0010, lo: 0x80, hi: 0xae}, - {value: 0x0014, lo: 0xb0, hi: 0xb8}, - // Block 0xf5, offset 0x526 - {value: 0x0010, lo: 0x80, hi: 0x86}, - // Block 0xf6, offset 0x527 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xf7, offset 0x529 - {value: 0x0010, lo: 0x90, hi: 0xad}, - {value: 0x0034, lo: 0xb0, hi: 0xb4}, - // Block 0xf8, offset 0x52b - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb6}, - // Block 0xf9, offset 0x52d - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa3, hi: 0xb7}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xfa, offset 0x531 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - // Block 0xfb, offset 0x532 - {value: 0x2013, lo: 0x80, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xbf}, - // Block 0xfc, offset 0x534 - {value: 0x0010, lo: 0x80, hi: 0x8a}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0xfd, offset 0x537 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0014, lo: 0x8f, hi: 0x9f}, - // Block 0xfe, offset 0x539 - {value: 0x0014, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa3, hi: 0xa4}, - {value: 0x0030, lo: 0xb0, hi: 0xb1}, - // Block 0xff, offset 0x53c - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbc}, - // Block 0x100, offset 0x53e - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0034, lo: 0x9e, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa3}, - // Block 0x101, offset 0x543 - {value: 0x0030, lo: 0xa5, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xa9}, - {value: 0x0030, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbf}, - // Block 0x102, offset 0x548 - {value: 0x0034, lo: 0x80, hi: 0x82}, - {value: 0x0024, lo: 0x85, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8b}, - {value: 0x0024, lo: 0xaa, hi: 0xad}, - // Block 0x103, offset 0x54c - {value: 0x0024, lo: 0x82, hi: 0x84}, - // Block 0x104, offset 0x54d - {value: 0x0013, lo: 0x80, hi: 0x99}, - {value: 0x0012, lo: 0x9a, hi: 0xb3}, - {value: 0x0013, lo: 0xb4, hi: 0xbf}, - // Block 0x105, offset 0x550 - {value: 0x0013, lo: 0x80, hi: 0x8d}, - {value: 0x0012, lo: 0x8e, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0xa7}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0x106, offset 0x554 - {value: 0x0013, lo: 0x80, hi: 0x81}, - {value: 0x0012, lo: 0x82, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0x9c}, - {value: 0x0013, lo: 0x9e, hi: 0x9f}, - {value: 0x0013, lo: 0xa2, hi: 0xa2}, - {value: 0x0013, lo: 0xa5, hi: 0xa6}, - {value: 0x0013, lo: 0xa9, hi: 0xac}, - {value: 0x0013, lo: 0xae, hi: 0xb5}, - {value: 0x0012, lo: 0xb6, hi: 0xb9}, - {value: 0x0012, lo: 0xbb, hi: 0xbb}, - {value: 0x0012, lo: 0xbd, hi: 0xbf}, - // Block 0x107, offset 0x55f - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0012, lo: 0x85, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0x108, offset 0x563 - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0013, lo: 0x84, hi: 0x85}, - {value: 0x0013, lo: 0x87, hi: 0x8a}, - {value: 0x0013, lo: 0x8d, hi: 0x94}, - {value: 0x0013, lo: 0x96, hi: 0x9c}, - {value: 0x0012, lo: 0x9e, hi: 0xb7}, - {value: 0x0013, lo: 0xb8, hi: 0xb9}, - {value: 0x0013, lo: 0xbb, hi: 0xbe}, - // Block 0x109, offset 0x56b - {value: 0x0013, lo: 0x80, hi: 0x84}, - {value: 0x0013, lo: 0x86, hi: 0x86}, - {value: 0x0013, lo: 0x8a, hi: 0x90}, - {value: 0x0012, lo: 0x92, hi: 0xab}, - {value: 0x0013, lo: 0xac, hi: 0xbf}, - // Block 0x10a, offset 0x570 - {value: 0x0013, lo: 0x80, hi: 0x85}, - {value: 0x0012, lo: 0x86, hi: 0x9f}, - {value: 0x0013, lo: 0xa0, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbf}, - // Block 0x10b, offset 0x574 - {value: 0x0012, lo: 0x80, hi: 0x93}, - {value: 0x0013, lo: 0x94, hi: 0xad}, - {value: 0x0012, lo: 0xae, hi: 0xbf}, - // Block 0x10c, offset 0x577 - {value: 0x0012, lo: 0x80, hi: 0x87}, - {value: 0x0013, lo: 0x88, hi: 0xa1}, - {value: 0x0012, lo: 0xa2, hi: 0xbb}, - {value: 0x0013, lo: 0xbc, hi: 0xbf}, - // Block 0x10d, offset 0x57b - {value: 0x0013, lo: 0x80, hi: 0x95}, - {value: 0x0012, lo: 0x96, hi: 0xaf}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x10e, offset 0x57e - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0012, lo: 0x8a, hi: 0xa5}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0x10f, offset 0x581 - {value: 0x0013, lo: 0x80, hi: 0x80}, - {value: 0x0012, lo: 0x82, hi: 0x9a}, - {value: 0x0012, lo: 0x9c, hi: 0xa1}, - {value: 0x0013, lo: 0xa2, hi: 0xba}, - {value: 0x0012, lo: 0xbc, hi: 0xbf}, - // Block 0x110, offset 0x586 - {value: 0x0012, lo: 0x80, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0xb4}, - {value: 0x0012, lo: 0xb6, hi: 0xbf}, - // Block 0x111, offset 0x58a - {value: 0x0012, lo: 0x80, hi: 0x8e}, - {value: 0x0012, lo: 0x90, hi: 0x95}, - {value: 0x0013, lo: 0x96, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x112, offset 0x58e - {value: 0x0012, lo: 0x80, hi: 0x88}, - {value: 0x0012, lo: 0x8a, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0x113, offset 0x592 - {value: 0x0012, lo: 0x80, hi: 0x82}, - {value: 0x0012, lo: 0x84, hi: 0x89}, - {value: 0x0017, lo: 0x8a, hi: 0x8b}, - {value: 0x0010, lo: 0x8e, hi: 0xbf}, - // Block 0x114, offset 0x596 - {value: 0x0014, lo: 0x80, hi: 0xb6}, - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x115, offset 0x598 - {value: 0x0014, lo: 0x80, hi: 0xac}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x116, offset 0x59a - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x9b, hi: 0x9f}, - {value: 0x0014, lo: 0xa1, hi: 0xaf}, - // Block 0x117, offset 0x59d - {value: 0x0024, lo: 0x80, hi: 0x86}, - {value: 0x0024, lo: 0x88, hi: 0x98}, - {value: 0x0024, lo: 0x9b, hi: 0xa1}, - {value: 0x0024, lo: 0xa3, hi: 0xa4}, - {value: 0x0024, lo: 0xa6, hi: 0xaa}, - // Block 0x118, offset 0x5a2 - {value: 0x0010, lo: 0x80, hi: 0xac}, - {value: 0x0024, lo: 0xb0, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xbd}, - // Block 0x119, offset 0x5a5 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - // Block 0x11a, offset 0x5a7 - {value: 0x0010, lo: 0x80, hi: 0xab}, - {value: 0x0024, lo: 0xac, hi: 0xaf}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x11b, offset 0x5aa - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0034, lo: 0x90, hi: 0x96}, - // Block 0x11c, offset 0x5ac - {value: 0xbc52, lo: 0x80, hi: 0x81}, - {value: 0xbf52, lo: 0x82, hi: 0x83}, - {value: 0x0024, lo: 0x84, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x11d, offset 0x5b2 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x9f}, - {value: 0x0010, lo: 0xa1, hi: 0xa2}, - {value: 0x0010, lo: 0xa4, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb7}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - // Block 0x11e, offset 0x5bb - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x9b}, - {value: 0x0010, lo: 0xa1, hi: 0xa3}, - {value: 0x0010, lo: 0xa5, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xbb}, - // Block 0x11f, offset 0x5c0 - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x120, offset 0x5c1 - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x121, offset 0x5c4 - {value: 0x0013, lo: 0x80, hi: 0x89}, - // Block 0x122, offset 0x5c5 - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x123, offset 0x5c6 - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x124, offset 0x5c7 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0014, lo: 0xa0, hi: 0xbf}, - // Block 0x125, offset 0x5c9 - {value: 0x0014, lo: 0x80, hi: 0xbf}, - // Block 0x126, offset 0x5ca - {value: 0x0014, lo: 0x80, hi: 0xaf}, -} - -// Total table size 15212 bytes (14KiB); checksum: 1EB13752 diff --git a/vendor/golang.org/x/text/cases/tables9.0.0.go b/vendor/golang.org/x/text/cases/tables9.0.0.go deleted file mode 100644 index 636d5d14df..0000000000 --- a/vendor/golang.org/x/text/cases/tables9.0.0.go +++ /dev/null @@ -1,2216 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -//go:build !go1.10 -// +build !go1.10 - -package cases - -// UnicodeVersion is the Unicode version from which the tables in this package are derived. -const UnicodeVersion = "9.0.0" - -var xorData string = "" + // Size: 185 bytes - "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + - "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + - "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + - "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + - "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + - "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + - "\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" + - "\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" + - "\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22" - -var exceptions string = "" + // Size: 2068 bytes - "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + - "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + - "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + - "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + - "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + - "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + - "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + - "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x12\x12вВВ\x12\x12дД" + - "Д\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" + - "\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" + - "ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" + - "ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + - "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + - "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + - "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + - "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + - "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + - "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + - "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + - "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" + - "\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" + - "ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" + - "̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" + - "ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" + - "\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" + - "\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" + - "\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFF" + - "Ff\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12" + - "stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄ" + - "ԽՄխ" - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// caseTrie. Total size: 11742 bytes (11.47 KiB). Checksum: 795fe57ee5135873. -type caseTrie struct{} - -func newCaseTrie(i int) *caseTrie { - return &caseTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { - switch { - case n < 18: - return uint16(caseValues[n<<6+uint32(b)]) - default: - n -= 18 - return uint16(sparse.lookup(n, b)) - } -} - -// caseValues: 20 blocks, 1280 entries, 2560 bytes -// The third block is the zero block. -var caseValues = [1280]uint16{ - // Block 0x0, offset 0x0 - 0x27: 0x0054, - 0x2e: 0x0054, - 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, - 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, - // Block 0x1, offset 0x40 - 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, - 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, - 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, - 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, - 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, - 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, - 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, - 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, - 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, - 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, - 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, - 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, - 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, - 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, - 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, - 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, - 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, - 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, - 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, - 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, - // Block 0x4, offset 0x100 - 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, - 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, - 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, - 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, - 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, - 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, - 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, - 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, - 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, - 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, - 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, - // Block 0x5, offset 0x140 - 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, - 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, - 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, - 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, - 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, - 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, - 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, - 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, - 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, - 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, - 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, - // Block 0x6, offset 0x180 - 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, - 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, - 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, - 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, - 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, - 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, - 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, - 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, - 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, - 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, - 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, - 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, - 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, - 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, - 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, - 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, - 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, - 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, - 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, - 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, - 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, - // Block 0x8, offset 0x200 - 0x204: 0x0004, 0x205: 0x0004, - 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, - 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, - 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, - 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, - 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, - 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, - 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, - 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, - 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, - 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, - // Block 0x9, offset 0x240 - 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, - 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, - 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, - 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, - 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, - 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, - 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, - 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, - 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, - 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, - 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, - // Block 0xa, offset 0x280 - 0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812, - 0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813, - 0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x239a, 0x291: 0x0812, - 0x292: 0x247a, 0x293: 0x0812, 0x294: 0x25ba, 0x295: 0x0812, 0x296: 0x26fa, 0x297: 0x0812, - 0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813, - 0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812, - 0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813, - 0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813, - 0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152, - 0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52, - 0x2bc: 0x4d52, 0x2bd: 0x4d52, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x283a, 0x2c1: 0x292a, 0x2c2: 0x2a1a, 0x2c3: 0x2b0a, 0x2c4: 0x2bfa, 0x2c5: 0x2cea, - 0x2c6: 0x2dda, 0x2c7: 0x2eca, 0x2c8: 0x2fb9, 0x2c9: 0x30a9, 0x2ca: 0x3199, 0x2cb: 0x3289, - 0x2cc: 0x3379, 0x2cd: 0x3469, 0x2ce: 0x3559, 0x2cf: 0x3649, 0x2d0: 0x373a, 0x2d1: 0x382a, - 0x2d2: 0x391a, 0x2d3: 0x3a0a, 0x2d4: 0x3afa, 0x2d5: 0x3bea, 0x2d6: 0x3cda, 0x2d7: 0x3dca, - 0x2d8: 0x3eb9, 0x2d9: 0x3fa9, 0x2da: 0x4099, 0x2db: 0x4189, 0x2dc: 0x4279, 0x2dd: 0x4369, - 0x2de: 0x4459, 0x2df: 0x4549, 0x2e0: 0x463a, 0x2e1: 0x472a, 0x2e2: 0x481a, 0x2e3: 0x490a, - 0x2e4: 0x49fa, 0x2e5: 0x4aea, 0x2e6: 0x4bda, 0x2e7: 0x4cca, 0x2e8: 0x4db9, 0x2e9: 0x4ea9, - 0x2ea: 0x4f99, 0x2eb: 0x5089, 0x2ec: 0x5179, 0x2ed: 0x5269, 0x2ee: 0x5359, 0x2ef: 0x5449, - 0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x553a, 0x2f3: 0x564a, 0x2f4: 0x571a, - 0x2f6: 0x57fa, 0x2f7: 0x58da, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53, - 0x2fc: 0x5a19, 0x2fd: 0x0004, 0x2fe: 0x5aea, 0x2ff: 0x0004, - // Block 0xc, offset 0x300 - 0x300: 0x0004, 0x301: 0x0004, 0x302: 0x5b6a, 0x303: 0x5c7a, 0x304: 0x5d4a, - 0x306: 0x5e2a, 0x307: 0x5f0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153, - 0x30c: 0x6049, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812, - 0x312: 0x611a, 0x313: 0x625a, 0x316: 0x639a, 0x317: 0x647a, - 0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004, - 0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x65ba, 0x323: 0x66fa, - 0x324: 0x683a, 0x325: 0x0912, 0x326: 0x691a, 0x327: 0x69fa, 0x328: 0x0813, 0x329: 0x0813, - 0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004, - 0x332: 0x6b3a, 0x333: 0x6c4a, 0x334: 0x6d1a, - 0x336: 0x6dfa, 0x337: 0x6eda, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53, - 0x33c: 0x7019, 0x33d: 0x0004, 0x33e: 0x0004, - // Block 0xd, offset 0x340 - 0x342: 0x0013, - 0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013, - 0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013, - 0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013, - 0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013, - 0x364: 0x0013, 0x366: 0x70eb, 0x368: 0x0013, - 0x36a: 0x714b, 0x36b: 0x718b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012, - 0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010, - 0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012, - 0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013, - // Block 0xe, offset 0x380 - 0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13, - 0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13, - 0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052, - 0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352, - 0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12, - 0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12, - 0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552, - 0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552, - 0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952, - 0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952, - 0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952, - 0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0x71eb, 0x3e3: 0x8853, - 0x3e4: 0x724b, 0x3e5: 0x72aa, 0x3e6: 0x730a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313, - 0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0x736b, 0x3ee: 0x73cb, 0x3ef: 0x742b, - 0x3f0: 0x748b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313, - 0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012, - 0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0x74eb, 0x3ff: 0x754b, - // Block 0x10, offset 0x400 - 0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112, - 0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0004, 0x40a: 0x0004, 0x40b: 0x0713, - 0x40c: 0x0712, 0x40d: 0x75ab, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112, - 0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112, - 0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112, - 0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112, - 0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112, - 0x42a: 0x760b, 0x42b: 0x766b, 0x42c: 0x76cb, 0x42d: 0x772b, 0x42e: 0x778b, - 0x430: 0x77eb, 0x431: 0x784b, 0x432: 0x78ab, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112, - 0x436: 0x0113, 0x437: 0x0112, - // Block 0x11, offset 0x440 - 0x440: 0x790a, 0x441: 0x798a, 0x442: 0x7a0a, 0x443: 0x7a8a, 0x444: 0x7b3a, 0x445: 0x7bea, - 0x446: 0x7c6a, - 0x453: 0x7cea, 0x454: 0x7dca, 0x455: 0x7eaa, 0x456: 0x7f8a, 0x457: 0x806a, - 0x45d: 0x0010, - 0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010, - 0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010, - 0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010, - 0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010, - 0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010, - 0x47c: 0x0010, 0x47e: 0x0010, - // Block 0x12, offset 0x480 - 0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213, - 0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613, - 0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213, - 0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13, - 0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213, - 0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212, - 0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12, - 0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212, - 0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612, - 0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212, - 0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212, - // Block 0x13, offset 0x4c0 - 0x4c2: 0x0010, - 0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010, - 0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010, - 0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010, - 0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010, - 0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, - 0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010, - 0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, - 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, - 0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, - 0x4fc: 0x0010, 0x4fe: 0x0010, -} - -// caseIndex: 25 blocks, 1600 entries, 3200 bytes -// Block 0 is the zero block. -var caseIndex = [1600]uint16{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02, - 0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, - 0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20, - 0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, - 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, - 0xf0: 0x14, 0xf3: 0x16, - // Block 0x4, offset 0x100 - 0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30, - 0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38, - 0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40, - 0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48, - // Block 0x5, offset 0x140 - 0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23, - 0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, - 0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23, - 0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, - 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, - 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, - 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, - 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a, - // Block 0x6, offset 0x180 - 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a, - 0x192: 0x7b, 0x193: 0x0c, - 0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, - 0x1b8: 0x82, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87, - // Block 0x8, offset 0x200 - 0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23, - 0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23, - 0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23, - 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91, - 0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, - 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, - 0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23, - 0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23, - // Block 0x9, offset 0x240 - 0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23, - 0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23, - 0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23, - 0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23, - 0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23, - 0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23, - 0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23, - 0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23, - // Block 0xa, offset 0x280 - 0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23, - 0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23, - 0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23, - 0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2, - // Block 0xb, offset 0x2c0 - 0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, - 0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, - 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, - // Block 0xc, offset 0x300 - 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, - 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, - 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, - 0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3, - 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, - 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, - 0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, - // Block 0xd, offset 0x340 - 0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda, - 0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf, - 0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5, - 0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea, - 0x362: 0xeb, 0x363: 0xec, - 0x36b: 0xed, - 0x370: 0xee, 0x371: 0xef, 0x372: 0xf0, - // Block 0xe, offset 0x380 - 0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23, - 0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf1, - 0x390: 0x23, 0x391: 0xf2, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf3, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23, - 0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23, - 0x3d0: 0xf2, - // Block 0x10, offset 0x400 - 0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23, - 0x418: 0x23, 0x419: 0xf4, - // Block 0x11, offset 0x440 - 0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23, - 0x468: 0xed, 0x469: 0xf5, 0x46b: 0xf6, 0x46c: 0xf7, 0x46d: 0xf8, 0x46e: 0xf9, - 0x47c: 0x23, 0x47d: 0xfa, 0x47e: 0xfb, 0x47f: 0xfc, - // Block 0x12, offset 0x480 - 0x4b0: 0x23, 0x4b1: 0xfd, 0x4b2: 0xfe, - // Block 0x13, offset 0x4c0 - 0x4c5: 0xff, 0x4c6: 0x100, - 0x4c9: 0x101, - 0x4d0: 0x102, 0x4d1: 0x103, 0x4d2: 0x104, 0x4d3: 0x105, 0x4d4: 0x106, 0x4d5: 0x107, 0x4d6: 0x108, 0x4d7: 0x109, - 0x4d8: 0x10a, 0x4d9: 0x10b, 0x4da: 0x10c, 0x4db: 0x10d, 0x4dc: 0x10e, 0x4dd: 0x10f, 0x4de: 0x110, 0x4df: 0x111, - 0x4e8: 0x112, 0x4e9: 0x113, 0x4ea: 0x114, - // Block 0x14, offset 0x500 - 0x500: 0x115, - 0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x116, 0x524: 0x10, 0x525: 0x117, - 0x538: 0x118, 0x539: 0x11, 0x53a: 0x119, - // Block 0x15, offset 0x540 - 0x544: 0x11a, 0x545: 0x11b, 0x546: 0x11c, - 0x54f: 0x11d, - // Block 0x16, offset 0x580 - 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, - 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, - // Block 0x17, offset 0x5c0 - 0x5c0: 0x11e, 0x5c1: 0x11f, 0x5c4: 0x11f, 0x5c5: 0x11f, 0x5c6: 0x11f, 0x5c7: 0x120, - // Block 0x18, offset 0x600 - 0x620: 0x15, -} - -// sparseOffsets: 272 entries, 544 bytes -var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x3a, 0x3d, 0x41, 0x44, 0x48, 0x52, 0x54, 0x59, 0x69, 0x70, 0x75, 0x83, 0x84, 0x92, 0xa1, 0xab, 0xae, 0xb4, 0xbc, 0xbe, 0xc0, 0xce, 0xd4, 0xe2, 0xed, 0xf8, 0x103, 0x10f, 0x119, 0x124, 0x12f, 0x13b, 0x147, 0x14f, 0x157, 0x161, 0x16c, 0x178, 0x17e, 0x189, 0x18e, 0x196, 0x199, 0x19e, 0x1a2, 0x1a6, 0x1ad, 0x1b6, 0x1be, 0x1bf, 0x1c8, 0x1cf, 0x1d7, 0x1dd, 0x1e3, 0x1e8, 0x1ec, 0x1ef, 0x1f1, 0x1f4, 0x1f9, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x207, 0x20c, 0x210, 0x219, 0x21c, 0x21f, 0x225, 0x226, 0x231, 0x232, 0x233, 0x238, 0x245, 0x24d, 0x255, 0x25e, 0x267, 0x270, 0x275, 0x278, 0x281, 0x28e, 0x290, 0x297, 0x299, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x327, 0x32e, 0x332, 0x33b, 0x33c, 0x344, 0x348, 0x34d, 0x355, 0x35b, 0x361, 0x36b, 0x370, 0x379, 0x37f, 0x386, 0x38a, 0x392, 0x394, 0x396, 0x399, 0x39b, 0x39d, 0x39e, 0x39f, 0x3a1, 0x3a3, 0x3a9, 0x3ae, 0x3b0, 0x3b6, 0x3b9, 0x3bb, 0x3c1, 0x3c6, 0x3c8, 0x3c9, 0x3ca, 0x3cb, 0x3cd, 0x3cf, 0x3d1, 0x3d4, 0x3d6, 0x3d9, 0x3e1, 0x3e4, 0x3e8, 0x3f0, 0x3f2, 0x3f3, 0x3f4, 0x3f6, 0x3fc, 0x3fe, 0x3ff, 0x401, 0x403, 0x405, 0x412, 0x413, 0x414, 0x418, 0x41a, 0x41b, 0x41c, 0x41d, 0x41e, 0x422, 0x426, 0x42c, 0x42e, 0x435, 0x438, 0x43c, 0x442, 0x44b, 0x451, 0x457, 0x461, 0x46b, 0x46d, 0x474, 0x47a, 0x480, 0x486, 0x489, 0x48f, 0x492, 0x49a, 0x49b, 0x4a2, 0x4a3, 0x4a6, 0x4a7, 0x4ad, 0x4b0, 0x4b8, 0x4b9, 0x4ba, 0x4bb, 0x4bc, 0x4be, 0x4c0, 0x4c2, 0x4c6, 0x4c7, 0x4c9, 0x4ca, 0x4cb, 0x4cd, 0x4d2, 0x4d7, 0x4db, 0x4dc, 0x4df, 0x4e3, 0x4ee, 0x4f2, 0x4fa, 0x4ff, 0x503, 0x506, 0x50a, 0x50d, 0x510, 0x515, 0x519, 0x51d, 0x521, 0x525, 0x527, 0x529, 0x52c, 0x531, 0x533, 0x538, 0x541, 0x546, 0x547, 0x54a, 0x54b, 0x54c, 0x54e, 0x54f, 0x550} - -// sparseValues: 1360 entries, 5440 bytes -var sparseValues = [1360]valueRange{ - // Block 0x0, offset 0x0 - {value: 0x0004, lo: 0xa8, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xaa}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0004, lo: 0xaf, hi: 0xaf}, - {value: 0x0004, lo: 0xb4, hi: 0xb4}, - {value: 0x001a, lo: 0xb5, hi: 0xb5}, - {value: 0x0054, lo: 0xb7, hi: 0xb7}, - {value: 0x0004, lo: 0xb8, hi: 0xb8}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - // Block 0x1, offset 0x9 - {value: 0x2013, lo: 0x80, hi: 0x96}, - {value: 0x2013, lo: 0x98, hi: 0x9e}, - {value: 0x009a, lo: 0x9f, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xb6}, - {value: 0x2012, lo: 0xb8, hi: 0xbe}, - {value: 0x0252, lo: 0xbf, hi: 0xbf}, - // Block 0x2, offset 0xf - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x011b, lo: 0xb0, hi: 0xb0}, - {value: 0x019a, lo: 0xb1, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb7}, - {value: 0x0012, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x0553, lo: 0xbf, hi: 0xbf}, - // Block 0x3, offset 0x18 - {value: 0x0552, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x01da, lo: 0x89, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xb7}, - {value: 0x0253, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x028a, lo: 0xbf, hi: 0xbf}, - // Block 0x4, offset 0x24 - {value: 0x0117, lo: 0x80, hi: 0x9f}, - {value: 0x2f53, lo: 0xa0, hi: 0xa0}, - {value: 0x0012, lo: 0xa1, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xb3}, - {value: 0x0012, lo: 0xb4, hi: 0xb9}, - {value: 0x090b, lo: 0xba, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x2953, lo: 0xbd, hi: 0xbd}, - {value: 0x098b, lo: 0xbe, hi: 0xbe}, - {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, - // Block 0x5, offset 0x2e - {value: 0x0015, lo: 0x80, hi: 0x81}, - {value: 0x0004, lo: 0x82, hi: 0x85}, - {value: 0x0014, lo: 0x86, hi: 0x91}, - {value: 0x0004, lo: 0x92, hi: 0x96}, - {value: 0x0054, lo: 0x97, hi: 0x97}, - {value: 0x0004, lo: 0x98, hi: 0x9f}, - {value: 0x0015, lo: 0xa0, hi: 0xa4}, - {value: 0x0004, lo: 0xa5, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xac}, - {value: 0x0004, lo: 0xad, hi: 0xad}, - {value: 0x0014, lo: 0xae, hi: 0xae}, - {value: 0x0004, lo: 0xaf, hi: 0xbf}, - // Block 0x6, offset 0x3a - {value: 0x0024, lo: 0x80, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbf}, - // Block 0x7, offset 0x3d - {value: 0x6553, lo: 0x80, hi: 0x8f}, - {value: 0x2013, lo: 0x90, hi: 0x9f}, - {value: 0x5f53, lo: 0xa0, hi: 0xaf}, - {value: 0x2012, lo: 0xb0, hi: 0xbf}, - // Block 0x8, offset 0x41 - {value: 0x5f52, lo: 0x80, hi: 0x8f}, - {value: 0x6552, lo: 0x90, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x9, offset 0x44 - {value: 0x0117, lo: 0x80, hi: 0x81}, - {value: 0x0024, lo: 0x83, hi: 0x87}, - {value: 0x0014, lo: 0x88, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xbf}, - // Block 0xa, offset 0x48 - {value: 0x0f13, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x0316, lo: 0x89, hi: 0x8a}, - {value: 0x0716, lo: 0x8b, hi: 0x8c}, - {value: 0x0316, lo: 0x8d, hi: 0x8e}, - {value: 0x0f12, lo: 0x8f, hi: 0x8f}, - {value: 0x0117, lo: 0x90, hi: 0xbf}, - // Block 0xb, offset 0x52 - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x6553, lo: 0xb1, hi: 0xbf}, - // Block 0xc, offset 0x54 - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6853, lo: 0x90, hi: 0x96}, - {value: 0x0014, lo: 0x99, hi: 0x99}, - {value: 0x6552, lo: 0xa1, hi: 0xaf}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0xd, offset 0x59 - {value: 0x6852, lo: 0x80, hi: 0x86}, - {value: 0x198a, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x91, hi: 0x91}, - {value: 0x0024, lo: 0x92, hi: 0x95}, - {value: 0x0034, lo: 0x96, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x99}, - {value: 0x0034, lo: 0x9a, hi: 0x9b}, - {value: 0x0024, lo: 0x9c, hi: 0xa1}, - {value: 0x0034, lo: 0xa2, hi: 0xa7}, - {value: 0x0024, lo: 0xa8, hi: 0xa9}, - {value: 0x0034, lo: 0xaa, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xbd}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xe, offset 0x69 - {value: 0x0034, lo: 0x81, hi: 0x82}, - {value: 0x0024, lo: 0x84, hi: 0x84}, - {value: 0x0034, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xb3}, - {value: 0x0054, lo: 0xb4, hi: 0xb4}, - // Block 0xf, offset 0x70 - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0024, lo: 0x90, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0014, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x10, offset 0x75 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9c}, - {value: 0x0024, lo: 0x9d, hi: 0x9e}, - {value: 0x0034, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x11, offset 0x83 - {value: 0x0010, lo: 0x80, hi: 0xbf}, - // Block 0x12, offset 0x84 - {value: 0x0010, lo: 0x80, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0024, lo: 0x9f, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xaa, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x13, offset 0x92 - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0034, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0034, lo: 0xb1, hi: 0xb1}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbd}, - {value: 0x0034, lo: 0xbe, hi: 0xbe}, - {value: 0x0024, lo: 0xbf, hi: 0xbf}, - // Block 0x14, offset 0xa1 - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0024, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x88}, - {value: 0x0024, lo: 0x89, hi: 0x8a}, - {value: 0x0010, lo: 0x8d, hi: 0xbf}, - // Block 0x15, offset 0xab - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x16, offset 0xae - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xb1}, - {value: 0x0034, lo: 0xb2, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - // Block 0x17, offset 0xb4 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x99}, - {value: 0x0014, lo: 0x9a, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0xa3}, - {value: 0x0014, lo: 0xa4, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xad}, - // Block 0x18, offset 0xbc - {value: 0x0010, lo: 0x80, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x9b}, - // Block 0x19, offset 0xbe - {value: 0x0010, lo: 0xa0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbd}, - // Block 0x1a, offset 0xc0 - {value: 0x0024, lo: 0x94, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0024, lo: 0xaa, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbf}, - // Block 0x1b, offset 0xce - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1c, offset 0xd4 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0x1d, offset 0xe2 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb6, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1e, offset 0xed - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xb1}, - // Block 0x1f, offset 0xf8 - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x20, offset 0x103 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x99, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x21, offset 0x10f - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x22, offset 0x119 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x85}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - // Block 0x23, offset 0x124 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x24, offset 0x12f - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x25, offset 0x13b - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0010, lo: 0xa8, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x26, offset 0x147 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x27, offset 0x14f - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb9}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbf}, - // Block 0x28, offset 0x157 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x88}, - {value: 0x0014, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x29, offset 0x161 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x2a, offset 0x16c - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb2}, - // Block 0x2b, offset 0x178 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xba}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x2c, offset 0x17e - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x94, hi: 0x97}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xba, hi: 0xbf}, - // Block 0x2d, offset 0x189 - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x96}, - {value: 0x0010, lo: 0x9a, hi: 0xb1}, - {value: 0x0010, lo: 0xb3, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x2e, offset 0x18e - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x94}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9f}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - // Block 0x2f, offset 0x196 - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xba}, - // Block 0x30, offset 0x199 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x31, offset 0x19e - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xb9}, - {value: 0x0014, lo: 0xbb, hi: 0xbc}, - // Block 0x32, offset 0x1a2 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x33, offset 0x1a6 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0034, lo: 0x98, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0034, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x34, offset 0x1ad - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xac}, - {value: 0x0034, lo: 0xb1, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xba, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x35, offset 0x1b6 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0024, lo: 0x82, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x86, hi: 0x87}, - {value: 0x0010, lo: 0x88, hi: 0x8c}, - {value: 0x0014, lo: 0x8d, hi: 0x97}, - {value: 0x0014, lo: 0x99, hi: 0xbc}, - // Block 0x36, offset 0x1be - {value: 0x0034, lo: 0x86, hi: 0x86}, - // Block 0x37, offset 0x1bf - {value: 0x0010, lo: 0xab, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbe}, - // Block 0x38, offset 0x1c8 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x96, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x99}, - {value: 0x0014, lo: 0x9e, hi: 0xa0}, - {value: 0x0010, lo: 0xa2, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xad}, - {value: 0x0014, lo: 0xb1, hi: 0xb4}, - // Block 0x39, offset 0x1cf - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x6c53, lo: 0xa0, hi: 0xbf}, - // Block 0x3a, offset 0x1d7 - {value: 0x7053, lo: 0x80, hi: 0x85}, - {value: 0x7053, lo: 0x87, hi: 0x87}, - {value: 0x7053, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xba}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x3b, offset 0x1dd - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x9a, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x3c, offset 0x1e3 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x3d, offset 0x1e8 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x82, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3e, offset 0x1ec - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3f, offset 0x1ef - {value: 0x0010, lo: 0x80, hi: 0x9a}, - {value: 0x0024, lo: 0x9d, hi: 0x9f}, - // Block 0x40, offset 0x1f1 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x7453, lo: 0xa0, hi: 0xaf}, - {value: 0x7853, lo: 0xb0, hi: 0xbf}, - // Block 0x41, offset 0x1f4 - {value: 0x7c53, lo: 0x80, hi: 0x8f}, - {value: 0x8053, lo: 0x90, hi: 0x9f}, - {value: 0x7c53, lo: 0xa0, hi: 0xaf}, - {value: 0x0813, lo: 0xb0, hi: 0xb5}, - {value: 0x0892, lo: 0xb8, hi: 0xbd}, - // Block 0x42, offset 0x1f9 - {value: 0x0010, lo: 0x81, hi: 0xbf}, - // Block 0x43, offset 0x1fa - {value: 0x0010, lo: 0x80, hi: 0xac}, - {value: 0x0010, lo: 0xaf, hi: 0xbf}, - // Block 0x44, offset 0x1fc - {value: 0x0010, lo: 0x81, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x45, offset 0x1fe - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb8}, - // Block 0x46, offset 0x200 - {value: 0x0010, lo: 0x80, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0034, lo: 0x94, hi: 0x94}, - {value: 0x0010, lo: 0xa0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - // Block 0x47, offset 0x207 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xac}, - {value: 0x0010, lo: 0xae, hi: 0xb0}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - // Block 0x48, offset 0x20c - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x49, offset 0x210 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x89, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0014, lo: 0x93, hi: 0x93}, - {value: 0x0004, lo: 0x97, hi: 0x97}, - {value: 0x0024, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0x4a, offset 0x219 - {value: 0x0014, lo: 0x8b, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x4b, offset 0x21c - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb7}, - // Block 0x4c, offset 0x21f - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x4d, offset 0x225 - {value: 0x0010, lo: 0x80, hi: 0xb5}, - // Block 0x4e, offset 0x226 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbb}, - // Block 0x4f, offset 0x231 - {value: 0x0010, lo: 0x86, hi: 0x8f}, - // Block 0x50, offset 0x232 - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x51, offset 0x233 - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - // Block 0x52, offset 0x238 - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x9e}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xac}, - {value: 0x0010, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xbc}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x53, offset 0x245 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xa7, hi: 0xa7}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - {value: 0x0034, lo: 0xb5, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbc}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0x54, offset 0x24d - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x55, offset 0x255 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0030, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8b}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xab, hi: 0xab}, - {value: 0x0034, lo: 0xac, hi: 0xac}, - {value: 0x0024, lo: 0xad, hi: 0xb3}, - // Block 0x56, offset 0x25e - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0030, lo: 0xaa, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbf}, - // Block 0x57, offset 0x267 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0030, lo: 0xb2, hi: 0xb3}, - // Block 0x58, offset 0x270 - {value: 0x0010, lo: 0x80, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0x59, offset 0x275 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8d, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x5a, offset 0x278 - {value: 0x1a6a, lo: 0x80, hi: 0x80}, - {value: 0x1aea, lo: 0x81, hi: 0x81}, - {value: 0x1b6a, lo: 0x82, hi: 0x82}, - {value: 0x1bea, lo: 0x83, hi: 0x83}, - {value: 0x1c6a, lo: 0x84, hi: 0x84}, - {value: 0x1cea, lo: 0x85, hi: 0x85}, - {value: 0x1d6a, lo: 0x86, hi: 0x86}, - {value: 0x1dea, lo: 0x87, hi: 0x87}, - {value: 0x1e6a, lo: 0x88, hi: 0x88}, - // Block 0x5b, offset 0x281 - {value: 0x0024, lo: 0x90, hi: 0x92}, - {value: 0x0034, lo: 0x94, hi: 0x99}, - {value: 0x0024, lo: 0x9a, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9f}, - {value: 0x0024, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0034, lo: 0xa2, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xb3}, - {value: 0x0024, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - {value: 0x0024, lo: 0xb8, hi: 0xb9}, - // Block 0x5c, offset 0x28e - {value: 0x0012, lo: 0x80, hi: 0xab}, - {value: 0x0015, lo: 0xac, hi: 0xbf}, - // Block 0x5d, offset 0x290 - {value: 0x0015, lo: 0x80, hi: 0xaa}, - {value: 0x0012, lo: 0xab, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb8}, - {value: 0x8452, lo: 0xb9, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbc}, - {value: 0x8852, lo: 0xbd, hi: 0xbd}, - {value: 0x0012, lo: 0xbe, hi: 0xbf}, - // Block 0x5e, offset 0x297 - {value: 0x0012, lo: 0x80, hi: 0x9a}, - {value: 0x0015, lo: 0x9b, hi: 0xbf}, - // Block 0x5f, offset 0x299 - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0024, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0xb5}, - {value: 0x0024, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbd}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x60, offset 0x2a4 - {value: 0x0117, lo: 0x80, hi: 0xbf}, - // Block 0x61, offset 0x2a5 - {value: 0x0117, lo: 0x80, hi: 0x95}, - {value: 0x1f1a, lo: 0x96, hi: 0x96}, - {value: 0x1fca, lo: 0x97, hi: 0x97}, - {value: 0x207a, lo: 0x98, hi: 0x98}, - {value: 0x212a, lo: 0x99, hi: 0x99}, - {value: 0x21da, lo: 0x9a, hi: 0x9a}, - {value: 0x228a, lo: 0x9b, hi: 0x9b}, - {value: 0x0012, lo: 0x9c, hi: 0x9d}, - {value: 0x233b, lo: 0x9e, hi: 0x9e}, - {value: 0x0012, lo: 0x9f, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x62, offset 0x2b0 - {value: 0x0812, lo: 0x80, hi: 0x87}, - {value: 0x0813, lo: 0x88, hi: 0x8f}, - {value: 0x0812, lo: 0x90, hi: 0x95}, - {value: 0x0813, lo: 0x98, hi: 0x9d}, - {value: 0x0812, lo: 0xa0, hi: 0xa7}, - {value: 0x0813, lo: 0xa8, hi: 0xaf}, - {value: 0x0812, lo: 0xb0, hi: 0xb7}, - {value: 0x0813, lo: 0xb8, hi: 0xbf}, - // Block 0x63, offset 0x2b8 - {value: 0x0004, lo: 0x8b, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8f}, - {value: 0x0054, lo: 0x98, hi: 0x99}, - {value: 0x0054, lo: 0xa4, hi: 0xa4}, - {value: 0x0054, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xaa, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xaf}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x64, offset 0x2c0 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x94, hi: 0x94}, - {value: 0x0014, lo: 0xa0, hi: 0xa4}, - {value: 0x0014, lo: 0xa6, hi: 0xaf}, - {value: 0x0015, lo: 0xb1, hi: 0xb1}, - {value: 0x0015, lo: 0xbf, hi: 0xbf}, - // Block 0x65, offset 0x2c6 - {value: 0x0015, lo: 0x90, hi: 0x9c}, - // Block 0x66, offset 0x2c7 - {value: 0x0024, lo: 0x90, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x93}, - {value: 0x0024, lo: 0x94, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0xa0}, - {value: 0x0024, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa4}, - {value: 0x0034, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa7}, - {value: 0x0034, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xa9}, - {value: 0x0034, lo: 0xaa, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - // Block 0x67, offset 0x2d5 - {value: 0x0016, lo: 0x85, hi: 0x86}, - {value: 0x0012, lo: 0x87, hi: 0x89}, - {value: 0x9d52, lo: 0x8e, hi: 0x8e}, - {value: 0x1013, lo: 0xa0, hi: 0xaf}, - {value: 0x1012, lo: 0xb0, hi: 0xbf}, - // Block 0x68, offset 0x2da - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x88}, - // Block 0x69, offset 0x2dd - {value: 0xa053, lo: 0xb6, hi: 0xb7}, - {value: 0xa353, lo: 0xb8, hi: 0xb9}, - {value: 0xa653, lo: 0xba, hi: 0xbb}, - {value: 0xa353, lo: 0xbc, hi: 0xbd}, - {value: 0xa053, lo: 0xbe, hi: 0xbf}, - // Block 0x6a, offset 0x2e2 - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6553, lo: 0x90, hi: 0x9f}, - {value: 0xa953, lo: 0xa0, hi: 0xae}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0x6b, offset 0x2e6 - {value: 0x0117, lo: 0x80, hi: 0xa3}, - {value: 0x0012, lo: 0xa4, hi: 0xa4}, - {value: 0x0716, lo: 0xab, hi: 0xac}, - {value: 0x0316, lo: 0xad, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb3}, - // Block 0x6c, offset 0x2ec - {value: 0x6c52, lo: 0x80, hi: 0x9f}, - {value: 0x7052, lo: 0xa0, hi: 0xa5}, - {value: 0x7052, lo: 0xa7, hi: 0xa7}, - {value: 0x7052, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x6d, offset 0x2f1 - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x6e, offset 0x2f4 - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0010, lo: 0xb0, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x6f, offset 0x2f9 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9e}, - {value: 0x0024, lo: 0xa0, hi: 0xbf}, - // Block 0x70, offset 0x2fe - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - // Block 0x71, offset 0x2ff - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0xaa, hi: 0xad}, - {value: 0x0030, lo: 0xae, hi: 0xaf}, - {value: 0x0004, lo: 0xb1, hi: 0xb5}, - {value: 0x0014, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - // Block 0x72, offset 0x305 - {value: 0x0034, lo: 0x99, hi: 0x9a}, - {value: 0x0004, lo: 0x9b, hi: 0x9e}, - // Block 0x73, offset 0x307 - {value: 0x0004, lo: 0xbc, hi: 0xbe}, - // Block 0x74, offset 0x308 - {value: 0x0010, lo: 0x85, hi: 0xad}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x75, offset 0x30a - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0010, lo: 0xa0, hi: 0xba}, - // Block 0x76, offset 0x30c - {value: 0x0010, lo: 0x80, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0xbf}, - // Block 0x77, offset 0x30f - {value: 0x0010, lo: 0x80, hi: 0x8c}, - // Block 0x78, offset 0x310 - {value: 0x0010, lo: 0x90, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x79, offset 0x312 - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0xab}, - // Block 0x7a, offset 0x315 - {value: 0x0117, lo: 0x80, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb2}, - {value: 0x0024, lo: 0xb4, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x7b, offset 0x31b - {value: 0x0117, lo: 0x80, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9d}, - {value: 0x0024, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x7c, offset 0x31f - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb1}, - // Block 0x7d, offset 0x321 - {value: 0x0004, lo: 0x80, hi: 0x96}, - {value: 0x0014, lo: 0x97, hi: 0x9f}, - {value: 0x0004, lo: 0xa0, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xaf}, - {value: 0x0012, lo: 0xb0, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xbf}, - // Block 0x7e, offset 0x327 - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x0015, lo: 0xb0, hi: 0xb0}, - {value: 0x0012, lo: 0xb1, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x8453, lo: 0xbd, hi: 0xbd}, - {value: 0x0117, lo: 0xbe, hi: 0xbf}, - // Block 0x7f, offset 0x32e - {value: 0x0010, lo: 0xb7, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbf}, - // Block 0x80, offset 0x332 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x8c, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - // Block 0x81, offset 0x33b - {value: 0x0010, lo: 0x80, hi: 0xb3}, - // Block 0x82, offset 0x33c - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xa0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb7}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x83, offset 0x344 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x84, offset 0x348 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0x92}, - {value: 0x0030, lo: 0x93, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0x85, offset 0x34d - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb9}, - {value: 0x0010, lo: 0xba, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x86, offset 0x355 - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0004, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x87, offset 0x35b - {value: 0x0010, lo: 0x80, hi: 0xa8}, - {value: 0x0014, lo: 0xa9, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0x88, offset 0x361 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x89, offset 0x36b - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0024, lo: 0xbe, hi: 0xbf}, - // Block 0x8a, offset 0x370 - {value: 0x0024, lo: 0x81, hi: 0x81}, - {value: 0x0004, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - // Block 0x8b, offset 0x379 - {value: 0x0010, lo: 0x81, hi: 0x86}, - {value: 0x0010, lo: 0x89, hi: 0x8e}, - {value: 0x0010, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x8c, offset 0x37f - {value: 0x0012, lo: 0x80, hi: 0x92}, - {value: 0xac52, lo: 0x93, hi: 0x93}, - {value: 0x0012, lo: 0x94, hi: 0x9a}, - {value: 0x0004, lo: 0x9b, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9f}, - {value: 0x0012, lo: 0xa0, hi: 0xa5}, - {value: 0x74d2, lo: 0xb0, hi: 0xbf}, - // Block 0x8d, offset 0x386 - {value: 0x78d2, lo: 0x80, hi: 0x8f}, - {value: 0x7cd2, lo: 0x90, hi: 0x9f}, - {value: 0x80d2, lo: 0xa0, hi: 0xaf}, - {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, - // Block 0x8e, offset 0x38a - {value: 0x0010, lo: 0x80, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x8f, offset 0x392 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x90, offset 0x394 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x8b, hi: 0xbb}, - // Block 0x91, offset 0x396 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0xbf}, - // Block 0x92, offset 0x399 - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0004, lo: 0xb2, hi: 0xbf}, - // Block 0x93, offset 0x39b - {value: 0x0004, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x93, hi: 0xbf}, - // Block 0x94, offset 0x39d - {value: 0x0010, lo: 0x80, hi: 0xbd}, - // Block 0x95, offset 0x39e - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0x96, offset 0x39f - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0xbf}, - // Block 0x97, offset 0x3a1 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0xb0, hi: 0xbb}, - // Block 0x98, offset 0x3a3 - {value: 0x0014, lo: 0x80, hi: 0x8f}, - {value: 0x0054, lo: 0x93, hi: 0x93}, - {value: 0x0024, lo: 0xa0, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xad}, - {value: 0x0024, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - // Block 0x99, offset 0x3a9 - {value: 0x0010, lo: 0x8d, hi: 0x8f}, - {value: 0x0054, lo: 0x92, hi: 0x92}, - {value: 0x0054, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0xb0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0x9a, offset 0x3ae - {value: 0x0010, lo: 0x80, hi: 0xbc}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x9b, offset 0x3b0 - {value: 0x0054, lo: 0x87, hi: 0x87}, - {value: 0x0054, lo: 0x8e, hi: 0x8e}, - {value: 0x0054, lo: 0x9a, hi: 0x9a}, - {value: 0x5f53, lo: 0xa1, hi: 0xba}, - {value: 0x0004, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9c, offset 0x3b6 - {value: 0x0004, lo: 0x80, hi: 0x80}, - {value: 0x5f52, lo: 0x81, hi: 0x9a}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - // Block 0x9d, offset 0x3b9 - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbe}, - // Block 0x9e, offset 0x3bb - {value: 0x0010, lo: 0x82, hi: 0x87}, - {value: 0x0010, lo: 0x8a, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0x97}, - {value: 0x0010, lo: 0x9a, hi: 0x9c}, - {value: 0x0004, lo: 0xa3, hi: 0xa3}, - {value: 0x0014, lo: 0xb9, hi: 0xbb}, - // Block 0x9f, offset 0x3c1 - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0010, lo: 0x8d, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xba}, - {value: 0x0010, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xa0, offset 0x3c6 - {value: 0x0010, lo: 0x80, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x9d}, - // Block 0xa1, offset 0x3c8 - {value: 0x0010, lo: 0x80, hi: 0xba}, - // Block 0xa2, offset 0x3c9 - {value: 0x0010, lo: 0x80, hi: 0xb4}, - // Block 0xa3, offset 0x3ca - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0xa4, offset 0x3cb - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa5, offset 0x3cd - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - // Block 0xa6, offset 0x3cf - {value: 0x0010, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xa7, offset 0x3d1 - {value: 0x0010, lo: 0x80, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0xb5}, - {value: 0x0024, lo: 0xb6, hi: 0xba}, - // Block 0xa8, offset 0x3d4 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa9, offset 0x3d6 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x91, hi: 0x95}, - // Block 0xaa, offset 0x3d9 - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x97}, - {value: 0xaf53, lo: 0x98, hi: 0x9f}, - {value: 0xb253, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbf}, - // Block 0xab, offset 0x3e1 - {value: 0xaf52, lo: 0x80, hi: 0x87}, - {value: 0xb252, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0xac, offset 0x3e4 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0xb253, lo: 0xb0, hi: 0xb7}, - {value: 0xaf53, lo: 0xb8, hi: 0xbf}, - // Block 0xad, offset 0x3e8 - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x93}, - {value: 0xb252, lo: 0x98, hi: 0x9f}, - {value: 0xaf52, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbb}, - // Block 0xae, offset 0x3f0 - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xaf, offset 0x3f2 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - // Block 0xb0, offset 0x3f3 - {value: 0x0010, lo: 0x80, hi: 0xb6}, - // Block 0xb1, offset 0x3f4 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xa7}, - // Block 0xb2, offset 0x3f6 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xb5}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xb3, offset 0x3fc - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xb4, offset 0x3fe - {value: 0x0010, lo: 0x80, hi: 0x9e}, - // Block 0xb5, offset 0x3ff - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - // Block 0xb6, offset 0x401 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb9}, - // Block 0xb7, offset 0x403 - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0xb8, offset 0x405 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x8e, hi: 0x8e}, - {value: 0x0024, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x99, hi: 0xb3}, - {value: 0x0024, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xb9, offset 0x412 - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0xba, offset 0x413 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - // Block 0xbb, offset 0x414 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - // Block 0xbc, offset 0x418 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - // Block 0xbd, offset 0x41a - {value: 0x0010, lo: 0x80, hi: 0x91}, - // Block 0xbe, offset 0x41b - {value: 0x0010, lo: 0x80, hi: 0x88}, - // Block 0xbf, offset 0x41c - {value: 0x5653, lo: 0x80, hi: 0xb2}, - // Block 0xc0, offset 0x41d - {value: 0x5652, lo: 0x80, hi: 0xb2}, - // Block 0xc1, offset 0x41e - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xc2, offset 0x422 - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xc3, offset 0x426 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb6}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - // Block 0xc4, offset 0x42c - {value: 0x0010, lo: 0x90, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xc5, offset 0x42e - {value: 0x0024, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0xc6, offset 0x435 - {value: 0x0010, lo: 0x90, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - // Block 0xc7, offset 0x438 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xc8, offset 0x43c - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - // Block 0xc9, offset 0x442 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb4}, - {value: 0x0030, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xb7}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0xca, offset 0x44b - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xcb, offset 0x451 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa2}, - {value: 0x0014, lo: 0xa3, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xcc, offset 0x457 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xcd, offset 0x461 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0030, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9d, hi: 0xa3}, - {value: 0x0024, lo: 0xa6, hi: 0xac}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - // Block 0xce, offset 0x46b - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xcf, offset 0x46d - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd0, offset 0x474 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xd1, offset 0x47a - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd2, offset 0x480 - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd3, offset 0x486 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x98, hi: 0x9b}, - {value: 0x0014, lo: 0x9c, hi: 0x9d}, - // Block 0xd4, offset 0x489 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd5, offset 0x48f - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd6, offset 0x492 - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0014, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb5}, - {value: 0x0030, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0xd7, offset 0x49a - {value: 0x0010, lo: 0x80, hi: 0x89}, - // Block 0xd8, offset 0x49b - {value: 0x0014, lo: 0x9d, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xd9, offset 0x4a2 - {value: 0x5f53, lo: 0xa0, hi: 0xbf}, - // Block 0xda, offset 0x4a3 - {value: 0x5f52, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xdb, offset 0x4a6 - {value: 0x0010, lo: 0x80, hi: 0xb8}, - // Block 0xdc, offset 0x4a7 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb6}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xdd, offset 0x4ad - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0xde, offset 0x4b0 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0014, lo: 0x92, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xa9}, - {value: 0x0014, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0xdf, offset 0x4b8 - {value: 0x0010, lo: 0x80, hi: 0x99}, - // Block 0xe0, offset 0x4b9 - {value: 0x0010, lo: 0x80, hi: 0xae}, - // Block 0xe1, offset 0x4ba - {value: 0x0010, lo: 0x80, hi: 0x83}, - // Block 0xe2, offset 0x4bb - {value: 0x0010, lo: 0x80, hi: 0x86}, - // Block 0xe3, offset 0x4bc - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xe4, offset 0x4be - {value: 0x0010, lo: 0x90, hi: 0xad}, - {value: 0x0034, lo: 0xb0, hi: 0xb4}, - // Block 0xe5, offset 0x4c0 - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb6}, - // Block 0xe6, offset 0x4c2 - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa3, hi: 0xb7}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xe7, offset 0x4c6 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - // Block 0xe8, offset 0x4c7 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0010, lo: 0x90, hi: 0xbe}, - // Block 0xe9, offset 0x4c9 - {value: 0x0014, lo: 0x8f, hi: 0x9f}, - // Block 0xea, offset 0x4ca - {value: 0x0014, lo: 0xa0, hi: 0xa0}, - // Block 0xeb, offset 0x4cb - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbc}, - // Block 0xec, offset 0x4cd - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0034, lo: 0x9e, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa3}, - // Block 0xed, offset 0x4d2 - {value: 0x0030, lo: 0xa5, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xa9}, - {value: 0x0030, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbf}, - // Block 0xee, offset 0x4d7 - {value: 0x0034, lo: 0x80, hi: 0x82}, - {value: 0x0024, lo: 0x85, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8b}, - {value: 0x0024, lo: 0xaa, hi: 0xad}, - // Block 0xef, offset 0x4db - {value: 0x0024, lo: 0x82, hi: 0x84}, - // Block 0xf0, offset 0x4dc - {value: 0x0013, lo: 0x80, hi: 0x99}, - {value: 0x0012, lo: 0x9a, hi: 0xb3}, - {value: 0x0013, lo: 0xb4, hi: 0xbf}, - // Block 0xf1, offset 0x4df - {value: 0x0013, lo: 0x80, hi: 0x8d}, - {value: 0x0012, lo: 0x8e, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0xa7}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0xf2, offset 0x4e3 - {value: 0x0013, lo: 0x80, hi: 0x81}, - {value: 0x0012, lo: 0x82, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0x9c}, - {value: 0x0013, lo: 0x9e, hi: 0x9f}, - {value: 0x0013, lo: 0xa2, hi: 0xa2}, - {value: 0x0013, lo: 0xa5, hi: 0xa6}, - {value: 0x0013, lo: 0xa9, hi: 0xac}, - {value: 0x0013, lo: 0xae, hi: 0xb5}, - {value: 0x0012, lo: 0xb6, hi: 0xb9}, - {value: 0x0012, lo: 0xbb, hi: 0xbb}, - {value: 0x0012, lo: 0xbd, hi: 0xbf}, - // Block 0xf3, offset 0x4ee - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0012, lo: 0x85, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0xf4, offset 0x4f2 - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0013, lo: 0x84, hi: 0x85}, - {value: 0x0013, lo: 0x87, hi: 0x8a}, - {value: 0x0013, lo: 0x8d, hi: 0x94}, - {value: 0x0013, lo: 0x96, hi: 0x9c}, - {value: 0x0012, lo: 0x9e, hi: 0xb7}, - {value: 0x0013, lo: 0xb8, hi: 0xb9}, - {value: 0x0013, lo: 0xbb, hi: 0xbe}, - // Block 0xf5, offset 0x4fa - {value: 0x0013, lo: 0x80, hi: 0x84}, - {value: 0x0013, lo: 0x86, hi: 0x86}, - {value: 0x0013, lo: 0x8a, hi: 0x90}, - {value: 0x0012, lo: 0x92, hi: 0xab}, - {value: 0x0013, lo: 0xac, hi: 0xbf}, - // Block 0xf6, offset 0x4ff - {value: 0x0013, lo: 0x80, hi: 0x85}, - {value: 0x0012, lo: 0x86, hi: 0x9f}, - {value: 0x0013, lo: 0xa0, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbf}, - // Block 0xf7, offset 0x503 - {value: 0x0012, lo: 0x80, hi: 0x93}, - {value: 0x0013, lo: 0x94, hi: 0xad}, - {value: 0x0012, lo: 0xae, hi: 0xbf}, - // Block 0xf8, offset 0x506 - {value: 0x0012, lo: 0x80, hi: 0x87}, - {value: 0x0013, lo: 0x88, hi: 0xa1}, - {value: 0x0012, lo: 0xa2, hi: 0xbb}, - {value: 0x0013, lo: 0xbc, hi: 0xbf}, - // Block 0xf9, offset 0x50a - {value: 0x0013, lo: 0x80, hi: 0x95}, - {value: 0x0012, lo: 0x96, hi: 0xaf}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0xfa, offset 0x50d - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0012, lo: 0x8a, hi: 0xa5}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0xfb, offset 0x510 - {value: 0x0013, lo: 0x80, hi: 0x80}, - {value: 0x0012, lo: 0x82, hi: 0x9a}, - {value: 0x0012, lo: 0x9c, hi: 0xa1}, - {value: 0x0013, lo: 0xa2, hi: 0xba}, - {value: 0x0012, lo: 0xbc, hi: 0xbf}, - // Block 0xfc, offset 0x515 - {value: 0x0012, lo: 0x80, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0xb4}, - {value: 0x0012, lo: 0xb6, hi: 0xbf}, - // Block 0xfd, offset 0x519 - {value: 0x0012, lo: 0x80, hi: 0x8e}, - {value: 0x0012, lo: 0x90, hi: 0x95}, - {value: 0x0013, lo: 0x96, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0xfe, offset 0x51d - {value: 0x0012, lo: 0x80, hi: 0x88}, - {value: 0x0012, lo: 0x8a, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0xff, offset 0x521 - {value: 0x0012, lo: 0x80, hi: 0x82}, - {value: 0x0012, lo: 0x84, hi: 0x89}, - {value: 0x0017, lo: 0x8a, hi: 0x8b}, - {value: 0x0010, lo: 0x8e, hi: 0xbf}, - // Block 0x100, offset 0x525 - {value: 0x0014, lo: 0x80, hi: 0xb6}, - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x101, offset 0x527 - {value: 0x0014, lo: 0x80, hi: 0xac}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x102, offset 0x529 - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x9b, hi: 0x9f}, - {value: 0x0014, lo: 0xa1, hi: 0xaf}, - // Block 0x103, offset 0x52c - {value: 0x0024, lo: 0x80, hi: 0x86}, - {value: 0x0024, lo: 0x88, hi: 0x98}, - {value: 0x0024, lo: 0x9b, hi: 0xa1}, - {value: 0x0024, lo: 0xa3, hi: 0xa4}, - {value: 0x0024, lo: 0xa6, hi: 0xaa}, - // Block 0x104, offset 0x531 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0034, lo: 0x90, hi: 0x96}, - // Block 0x105, offset 0x533 - {value: 0xb552, lo: 0x80, hi: 0x81}, - {value: 0xb852, lo: 0x82, hi: 0x83}, - {value: 0x0024, lo: 0x84, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x106, offset 0x538 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x9f}, - {value: 0x0010, lo: 0xa1, hi: 0xa2}, - {value: 0x0010, lo: 0xa4, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb7}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - // Block 0x107, offset 0x541 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x9b}, - {value: 0x0010, lo: 0xa1, hi: 0xa3}, - {value: 0x0010, lo: 0xa5, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xbb}, - // Block 0x108, offset 0x546 - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x109, offset 0x547 - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x10a, offset 0x54a - {value: 0x0013, lo: 0x80, hi: 0x89}, - // Block 0x10b, offset 0x54b - {value: 0x0004, lo: 0xbb, hi: 0xbf}, - // Block 0x10c, offset 0x54c - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0014, lo: 0xa0, hi: 0xbf}, - // Block 0x10d, offset 0x54e - {value: 0x0014, lo: 0x80, hi: 0xbf}, - // Block 0x10e, offset 0x54f - {value: 0x0014, lo: 0x80, hi: 0xaf}, -} - -// Total table size 14027 bytes (13KiB); checksum: F17D40E8 diff --git a/vendor/golang.org/x/text/cases/trieval.go b/vendor/golang.org/x/text/cases/trieval.go deleted file mode 100644 index 4e4d13fe5d..0000000000 --- a/vendor/golang.org/x/text/cases/trieval.go +++ /dev/null @@ -1,217 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package cases - -// This file contains definitions for interpreting the trie value of the case -// trie generated by "go run gen*.go". It is shared by both the generator -// program and the resultant package. Sharing is achieved by the generator -// copying gen_trieval.go to trieval.go and changing what's above this comment. - -// info holds case information for a single rune. It is the value returned -// by a trie lookup. Most mapping information can be stored in a single 16-bit -// value. If not, for example when a rune is mapped to multiple runes, the value -// stores some basic case data and an index into an array with additional data. -// -// The per-rune values have the following format: -// -// if (exception) { -// 15..4 unsigned exception index -// } else { -// 15..8 XOR pattern or index to XOR pattern for case mapping -// Only 13..8 are used for XOR patterns. -// 7 inverseFold (fold to upper, not to lower) -// 6 index: interpret the XOR pattern as an index -// or isMid if case mode is cIgnorableUncased. -// 5..4 CCC: zero (normal or break), above or other -// } -// 3 exception: interpret this value as an exception index -// (TODO: is this bit necessary? Probably implied from case mode.) -// 2..0 case mode -// -// For the non-exceptional cases, a rune must be either uncased, lowercase or -// uppercase. If the rune is cased, the XOR pattern maps either a lowercase -// rune to uppercase or an uppercase rune to lowercase (applied to the 10 -// least-significant bits of the rune). -// -// See the definitions below for a more detailed description of the various -// bits. -type info uint16 - -const ( - casedMask = 0x0003 - fullCasedMask = 0x0007 - ignorableMask = 0x0006 - ignorableValue = 0x0004 - - inverseFoldBit = 1 << 7 - isMidBit = 1 << 6 - - exceptionBit = 1 << 3 - exceptionShift = 4 - numExceptionBits = 12 - - xorIndexBit = 1 << 6 - xorShift = 8 - - // There is no mapping if all xor bits and the exception bit are zero. - hasMappingMask = 0xff80 | exceptionBit -) - -// The case mode bits encodes the case type of a rune. This includes uncased, -// title, upper and lower case and case ignorable. (For a definition of these -// terms see Chapter 3 of The Unicode Standard Core Specification.) In some rare -// cases, a rune can be both cased and case-ignorable. This is encoded by -// cIgnorableCased. A rune of this type is always lower case. Some runes are -// cased while not having a mapping. -// -// A common pattern for scripts in the Unicode standard is for upper and lower -// case runes to alternate for increasing rune values (e.g. the accented Latin -// ranges starting from U+0100 and U+1E00 among others and some Cyrillic -// characters). We use this property by defining a cXORCase mode, where the case -// mode (always upper or lower case) is derived from the rune value. As the XOR -// pattern for case mappings is often identical for successive runes, using -// cXORCase can result in large series of identical trie values. This, in turn, -// allows us to better compress the trie blocks. -const ( - cUncased info = iota // 000 - cTitle // 001 - cLower // 010 - cUpper // 011 - cIgnorableUncased // 100 - cIgnorableCased // 101 // lower case if mappings exist - cXORCase // 11x // case is cLower | ((rune&1) ^ x) - - maxCaseMode = cUpper -) - -func (c info) isCased() bool { - return c&casedMask != 0 -} - -func (c info) isCaseIgnorable() bool { - return c&ignorableMask == ignorableValue -} - -func (c info) isNotCasedAndNotCaseIgnorable() bool { - return c&fullCasedMask == 0 -} - -func (c info) isCaseIgnorableAndNotCased() bool { - return c&fullCasedMask == cIgnorableUncased -} - -func (c info) isMid() bool { - return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased -} - -// The case mapping implementation will need to know about various Canonical -// Combining Class (CCC) values. We encode two of these in the trie value: -// cccZero (0) and cccAbove (230). If the value is cccOther, it means that -// CCC(r) > 0, but not 230. A value of cccBreak means that CCC(r) == 0 and that -// the rune also has the break category Break (see below). -const ( - cccBreak info = iota << 4 - cccZero - cccAbove - cccOther - - cccMask = cccBreak | cccZero | cccAbove | cccOther -) - -const ( - starter = 0 - above = 230 - iotaSubscript = 240 -) - -// The exceptions slice holds data that does not fit in a normal info entry. -// The entry is pointed to by the exception index in an entry. It has the -// following format: -// -// Header: -// -// byte 0: -// 7..6 unused -// 5..4 CCC type (same bits as entry) -// 3 unused -// 2..0 length of fold -// -// byte 1: -// 7..6 unused -// 5..3 length of 1st mapping of case type -// 2..0 length of 2nd mapping of case type -// -// case 1st 2nd -// lower -> upper, title -// upper -> lower, title -// title -> lower, upper -// -// Lengths with the value 0x7 indicate no value and implies no change. -// A length of 0 indicates a mapping to zero-length string. -// -// Body bytes: -// -// case folding bytes -// lowercase mapping bytes -// uppercase mapping bytes -// titlecase mapping bytes -// closure mapping bytes (for NFKC_Casefold). (TODO) -// -// Fallbacks: -// -// missing fold -> lower -// missing title -> upper -// all missing -> original rune -// -// exceptions starts with a dummy byte to enforce that there is no zero index -// value. -const ( - lengthMask = 0x07 - lengthBits = 3 - noChange = 0 -) - -// References to generated trie. - -var trie = newCaseTrie(0) - -var sparse = sparseBlocks{ - values: sparseValues[:], - offsets: sparseOffsets[:], -} - -// Sparse block lookup code. - -// valueRange is an entry in a sparse block. -type valueRange struct { - value uint16 - lo, hi byte -} - -type sparseBlocks struct { - values []valueRange - offsets []uint16 -} - -// lookup returns the value from values block n for byte b using binary search. -func (s *sparseBlocks) lookup(n uint32, b byte) uint16 { - lo := s.offsets[n] - hi := s.offsets[n+1] - for lo < hi { - m := lo + (hi-lo)/2 - r := s.values[m] - if r.lo <= b && b <= r.hi { - return r.value - } - if b < r.lo { - hi = m - } else { - lo = m + 1 - } - } - return 0 -} - -// lastRuneForTesting is the last rune used for testing. Everything after this -// is boring. -const lastRuneForTesting = rune(0x1FFFF) diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go deleted file mode 100644 index 3cddbbdda8..0000000000 --- a/vendor/golang.org/x/text/internal/internal.go +++ /dev/null @@ -1,49 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package internal contains non-exported functionality that are used by -// packages in the text repository. -package internal // import "golang.org/x/text/internal" - -import ( - "sort" - - "golang.org/x/text/language" -) - -// SortTags sorts tags in place. -func SortTags(tags []language.Tag) { - sort.Sort(sorter(tags)) -} - -type sorter []language.Tag - -func (s sorter) Len() int { - return len(s) -} - -func (s sorter) Swap(i, j int) { - s[i], s[j] = s[j], s[i] -} - -func (s sorter) Less(i, j int) bool { - return s[i].String() < s[j].String() -} - -// UniqueTags sorts and filters duplicate tags in place and returns a slice with -// only unique tags. -func UniqueTags(tags []language.Tag) []language.Tag { - if len(tags) <= 1 { - return tags - } - SortTags(tags) - k := 0 - for i := 1; i < len(tags); i++ { - if tags[k].String() < tags[i].String() { - k++ - tags[k] = tags[i] - } - } - return tags[:k+1] -} diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go deleted file mode 100644 index cdfdb74971..0000000000 --- a/vendor/golang.org/x/text/internal/language/common.go +++ /dev/null @@ -1,16 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// This file contains code common to the maketables.go and the package code. - -// AliasType is the type of an alias in AliasMap. -type AliasType int8 - -const ( - Deprecated AliasType = iota - Macro - Legacy - - AliasTypeUnknown AliasType = -1 -) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go deleted file mode 100644 index 46a0015074..0000000000 --- a/vendor/golang.org/x/text/internal/language/compact.go +++ /dev/null @@ -1,29 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// CompactCoreInfo is a compact integer with the three core tags encoded. -type CompactCoreInfo uint32 - -// GetCompactCore generates a uint32 value that is guaranteed to be unique for -// different language, region, and script values. -func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { - if t.LangID > langNoIndexOffset { - return 0, false - } - cci |= CompactCoreInfo(t.LangID) << (8 + 12) - cci |= CompactCoreInfo(t.ScriptID) << 12 - cci |= CompactCoreInfo(t.RegionID) - return cci, true -} - -// Tag generates a tag from c. -func (c CompactCoreInfo) Tag() Tag { - return Tag{ - LangID: Language(c >> 20), - RegionID: Region(c & 0x3ff), - ScriptID: Script(c>>12) & 0xff, - } -} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go deleted file mode 100644 index 1b36935ef7..0000000000 --- a/vendor/golang.org/x/text/internal/language/compact/compact.go +++ /dev/null @@ -1,61 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package compact defines a compact representation of language tags. -// -// Common language tags (at least all for which locale information is defined -// in CLDR) are assigned a unique index. Each Tag is associated with such an -// ID for selecting language-related resources (such as translations) as well -// as one for selecting regional defaults (currency, number formatting, etc.) -// -// It may want to export this functionality at some point, but at this point -// this is only available for use within x/text. -package compact // import "golang.org/x/text/internal/language/compact" - -import ( - "sort" - "strings" - - "golang.org/x/text/internal/language" -) - -// ID is an integer identifying a single tag. -type ID uint16 - -func getCoreIndex(t language.Tag) (id ID, ok bool) { - cci, ok := language.GetCompactCore(t) - if !ok { - return 0, false - } - i := sort.Search(len(coreTags), func(i int) bool { - return cci <= coreTags[i] - }) - if i == len(coreTags) || coreTags[i] != cci { - return 0, false - } - return ID(i), true -} - -// Parent returns the ID of the parent or the root ID if id is already the root. -func (id ID) Parent() ID { - return parents[id] -} - -// Tag converts id to an internal language Tag. -func (id ID) Tag() language.Tag { - if int(id) >= len(coreTags) { - return specialTags[int(id)-len(coreTags)] - } - return coreTags[id].Tag() -} - -var specialTags []language.Tag - -func init() { - tags := strings.Split(specialTagsStr, " ") - specialTags = make([]language.Tag, len(tags)) - for i, t := range tags { - specialTags[i] = language.MustParse(t) - } -} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go deleted file mode 100644 index 8c1b6666fb..0000000000 --- a/vendor/golang.org/x/text/internal/language/compact/language.go +++ /dev/null @@ -1,260 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_index.go -output tables.go -//go:generate go run gen_parents.go - -package compact - -// TODO: Remove above NOTE after: -// - verifying that tables are dropped correctly (most notably matcher tables). - -import ( - "strings" - - "golang.org/x/text/internal/language" -) - -// Tag represents a BCP 47 language tag. It is used to specify an instance of a -// specific language or locale. All language tag values are guaranteed to be -// well-formed. -type Tag struct { - // NOTE: exported tags will become part of the public API. - language ID - locale ID - full fullTag // always a language.Tag for now. -} - -const _und = 0 - -type fullTag interface { - IsRoot() bool - Parent() language.Tag -} - -// Make a compact Tag from a fully specified internal language Tag. -func Make(t language.Tag) (tag Tag) { - if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { - if r, err := language.ParseRegion(region[:2]); err == nil { - tFull := t - t, _ = t.SetTypeForKey("rg", "") - // TODO: should we not consider "va" for the language tag? - var exact1, exact2 bool - tag.language, exact1 = FromTag(t) - t.RegionID = r - tag.locale, exact2 = FromTag(t) - if !exact1 || !exact2 { - tag.full = tFull - } - return tag - } - } - lang, ok := FromTag(t) - tag.language = lang - tag.locale = lang - if !ok { - tag.full = t - } - return tag -} - -// Tag returns an internal language Tag version of this tag. -func (t Tag) Tag() language.Tag { - if t.full != nil { - return t.full.(language.Tag) - } - tag := t.language.Tag() - if t.language != t.locale { - loc := t.locale.Tag() - tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") - } - return tag -} - -// IsCompact reports whether this tag is fully defined in terms of ID. -func (t *Tag) IsCompact() bool { - return t.full == nil -} - -// MayHaveVariants reports whether a tag may have variants. If it returns false -// it is guaranteed the tag does not have variants. -func (t Tag) MayHaveVariants() bool { - return t.full != nil || int(t.language) >= len(coreTags) -} - -// MayHaveExtensions reports whether a tag may have extensions. If it returns -// false it is guaranteed the tag does not have them. -func (t Tag) MayHaveExtensions() bool { - return t.full != nil || - int(t.language) >= len(coreTags) || - t.language != t.locale -} - -// IsRoot returns true if t is equal to language "und". -func (t Tag) IsRoot() bool { - if t.full != nil { - return t.full.IsRoot() - } - return t.language == _und -} - -// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a -// specific language are substituted with fields from the parent language. -// The parent for a language may change for newer versions of CLDR. -func (t Tag) Parent() Tag { - if t.full != nil { - return Make(t.full.Parent()) - } - if t.language != t.locale { - // Simulate stripping -u-rg-xxxxxx - return Tag{language: t.language, locale: t.language} - } - // TODO: use parent lookup table once cycle from internal package is - // removed. Probably by internalizing the table and declaring this fast - // enough. - // lang := compactID(internal.Parent(uint16(t.language))) - lang, _ := FromTag(t.language.Tag().Parent()) - return Tag{language: lang, locale: lang} -} - -// nextToken returns token t and the rest of the string. -func nextToken(s string) (t, tail string) { - p := strings.Index(s[1:], "-") - if p == -1 { - return s[1:], "" - } - p++ - return s[1:p], s[p:] -} - -// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags -// for which data exists in the text repository.The index will change over time -// and should not be stored in persistent storage. If t does not match a compact -// index, exact will be false and the compact index will be returned for the -// first match after repeatedly taking the Parent of t. -func LanguageID(t Tag) (id ID, exact bool) { - return t.language, t.full == nil -} - -// RegionalID returns the ID for the regional variant of this tag. This index is -// used to indicate region-specific overrides, such as default currency, default -// calendar and week data, default time cycle, and default measurement system -// and unit preferences. -// -// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US -// settings for currency, number formatting, etc. The CompactIndex for this tag -// will be that for en-GB, while the RegionalID will be the one corresponding to -// en-US. -func RegionalID(t Tag) (id ID, exact bool) { - return t.locale, t.full == nil -} - -// LanguageTag returns t stripped of regional variant indicators. -// -// At the moment this means it is stripped of a regional and variant subtag "rg" -// and "va" in the "u" extension. -func (t Tag) LanguageTag() Tag { - if t.full == nil { - return Tag{language: t.language, locale: t.language} - } - tt := t.Tag() - tt.SetTypeForKey("rg", "") - tt.SetTypeForKey("va", "") - return Make(tt) -} - -// RegionalTag returns the regional variant of the tag. -// -// At the moment this means that the region is set from the regional subtag -// "rg" in the "u" extension. -func (t Tag) RegionalTag() Tag { - rt := Tag{language: t.locale, locale: t.locale} - if t.full == nil { - return rt - } - b := language.Builder{} - tag := t.Tag() - // tag, _ = tag.SetTypeForKey("rg", "") - b.SetTag(t.locale.Tag()) - if v := tag.Variants(); v != "" { - for _, v := range strings.Split(v, "-") { - b.AddVariant(v) - } - } - for _, e := range tag.Extensions() { - b.AddExt(e) - } - return t -} - -// FromTag reports closest matching ID for an internal language Tag. -func FromTag(t language.Tag) (id ID, exact bool) { - // TODO: perhaps give more frequent tags a lower index. - // TODO: we could make the indexes stable. This will excluded some - // possibilities for optimization, so don't do this quite yet. - exact = true - - b, s, r := t.Raw() - if t.HasString() { - if t.IsPrivateUse() { - // We have no entries for user-defined tags. - return 0, false - } - hasExtra := false - if t.HasVariants() { - if t.HasExtensions() { - build := language.Builder{} - build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) - build.AddVariant(t.Variants()) - exact = false - t = build.Make() - } - hasExtra = true - } else if _, ok := t.Extension('u'); ok { - // TODO: va may mean something else. Consider not considering it. - // Strip all but the 'va' entry. - old := t - variant := t.TypeForKey("va") - t = language.Tag{LangID: b, ScriptID: s, RegionID: r} - if variant != "" { - t, _ = t.SetTypeForKey("va", variant) - hasExtra = true - } - exact = old == t - } else { - exact = false - } - if hasExtra { - // We have some variants. - for i, s := range specialTags { - if s == t { - return ID(i + len(coreTags)), exact - } - } - exact = false - } - } - if x, ok := getCoreIndex(t); ok { - return x, exact - } - exact = false - if r != 0 && s == 0 { - // Deal with cases where an extra script is inserted for the region. - t, _ := t.Maximize() - if x, ok := getCoreIndex(t); ok { - return x, exact - } - } - for t = t.Parent(); t != root; t = t.Parent() { - // No variants specified: just compare core components. - // The key has the form lllssrrr, where l, s, and r are nibbles for - // respectively the langID, scriptID, and regionID. - if x, ok := getCoreIndex(t); ok { - return x, exact - } - } - return 0, exact -} - -var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go deleted file mode 100644 index 8d810723c7..0000000000 --- a/vendor/golang.org/x/text/internal/language/compact/parents.go +++ /dev/null @@ -1,120 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package compact - -// parents maps a compact index of a tag to the compact index of the parent of -// this tag. -var parents = []ID{ // 775 elements - // Entry 0 - 3F - 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, - 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, - 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, - 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, - 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, - 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, - 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, - 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, - // Entry 40 - 7F - 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, - 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, - 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, - 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, - 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, - 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, - 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, - 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, - // Entry 80 - BF - 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, - 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, - 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, - 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, - // Entry C0 - FF - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, - 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, - 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, - 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, - 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, - // Entry 100 - 13F - 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, - 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, - 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, - 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, - 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - // Entry 140 - 17F - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, - 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, - 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, - 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, - 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, - 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, - // Entry 180 - 1BF - 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, - 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, - 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, - 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, - 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, - 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, - 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, - 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, - // Entry 1C0 - 1FF - 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, - 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, - 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, - 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, - 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, - 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, - 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, - 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, - // Entry 200 - 23F - 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, - 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, - 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, - 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, - 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, - 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, - 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, - // Entry 240 - 27F - 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, - 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, - 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, - 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, - 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, - 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, - 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, - 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, - // Entry 280 - 2BF - 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, - 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, - 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, - 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, - 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, - 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, - 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, - 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, - // Entry 2C0 - 2FF - 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, - 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, - 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, - 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, - 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, - 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, - 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, - 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, - // Entry 300 - 33F - 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, -} // Size: 1574 bytes - -// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go deleted file mode 100644 index 32af9de599..0000000000 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ /dev/null @@ -1,1015 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package compact - -import "golang.org/x/text/internal/language" - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "32" - -// NumCompactTags is the number of common tags. The maximum tag is -// NumCompactTags-1. -const NumCompactTags = 775 -const ( - undIndex ID = 0 - afIndex ID = 1 - afNAIndex ID = 2 - afZAIndex ID = 3 - agqIndex ID = 4 - agqCMIndex ID = 5 - akIndex ID = 6 - akGHIndex ID = 7 - amIndex ID = 8 - amETIndex ID = 9 - arIndex ID = 10 - ar001Index ID = 11 - arAEIndex ID = 12 - arBHIndex ID = 13 - arDJIndex ID = 14 - arDZIndex ID = 15 - arEGIndex ID = 16 - arEHIndex ID = 17 - arERIndex ID = 18 - arILIndex ID = 19 - arIQIndex ID = 20 - arJOIndex ID = 21 - arKMIndex ID = 22 - arKWIndex ID = 23 - arLBIndex ID = 24 - arLYIndex ID = 25 - arMAIndex ID = 26 - arMRIndex ID = 27 - arOMIndex ID = 28 - arPSIndex ID = 29 - arQAIndex ID = 30 - arSAIndex ID = 31 - arSDIndex ID = 32 - arSOIndex ID = 33 - arSSIndex ID = 34 - arSYIndex ID = 35 - arTDIndex ID = 36 - arTNIndex ID = 37 - arYEIndex ID = 38 - arsIndex ID = 39 - asIndex ID = 40 - asINIndex ID = 41 - asaIndex ID = 42 - asaTZIndex ID = 43 - astIndex ID = 44 - astESIndex ID = 45 - azIndex ID = 46 - azCyrlIndex ID = 47 - azCyrlAZIndex ID = 48 - azLatnIndex ID = 49 - azLatnAZIndex ID = 50 - basIndex ID = 51 - basCMIndex ID = 52 - beIndex ID = 53 - beBYIndex ID = 54 - bemIndex ID = 55 - bemZMIndex ID = 56 - bezIndex ID = 57 - bezTZIndex ID = 58 - bgIndex ID = 59 - bgBGIndex ID = 60 - bhIndex ID = 61 - bmIndex ID = 62 - bmMLIndex ID = 63 - bnIndex ID = 64 - bnBDIndex ID = 65 - bnINIndex ID = 66 - boIndex ID = 67 - boCNIndex ID = 68 - boINIndex ID = 69 - brIndex ID = 70 - brFRIndex ID = 71 - brxIndex ID = 72 - brxINIndex ID = 73 - bsIndex ID = 74 - bsCyrlIndex ID = 75 - bsCyrlBAIndex ID = 76 - bsLatnIndex ID = 77 - bsLatnBAIndex ID = 78 - caIndex ID = 79 - caADIndex ID = 80 - caESIndex ID = 81 - caFRIndex ID = 82 - caITIndex ID = 83 - ccpIndex ID = 84 - ccpBDIndex ID = 85 - ccpINIndex ID = 86 - ceIndex ID = 87 - ceRUIndex ID = 88 - cggIndex ID = 89 - cggUGIndex ID = 90 - chrIndex ID = 91 - chrUSIndex ID = 92 - ckbIndex ID = 93 - ckbIQIndex ID = 94 - ckbIRIndex ID = 95 - csIndex ID = 96 - csCZIndex ID = 97 - cuIndex ID = 98 - cuRUIndex ID = 99 - cyIndex ID = 100 - cyGBIndex ID = 101 - daIndex ID = 102 - daDKIndex ID = 103 - daGLIndex ID = 104 - davIndex ID = 105 - davKEIndex ID = 106 - deIndex ID = 107 - deATIndex ID = 108 - deBEIndex ID = 109 - deCHIndex ID = 110 - deDEIndex ID = 111 - deITIndex ID = 112 - deLIIndex ID = 113 - deLUIndex ID = 114 - djeIndex ID = 115 - djeNEIndex ID = 116 - dsbIndex ID = 117 - dsbDEIndex ID = 118 - duaIndex ID = 119 - duaCMIndex ID = 120 - dvIndex ID = 121 - dyoIndex ID = 122 - dyoSNIndex ID = 123 - dzIndex ID = 124 - dzBTIndex ID = 125 - ebuIndex ID = 126 - ebuKEIndex ID = 127 - eeIndex ID = 128 - eeGHIndex ID = 129 - eeTGIndex ID = 130 - elIndex ID = 131 - elCYIndex ID = 132 - elGRIndex ID = 133 - enIndex ID = 134 - en001Index ID = 135 - en150Index ID = 136 - enAGIndex ID = 137 - enAIIndex ID = 138 - enASIndex ID = 139 - enATIndex ID = 140 - enAUIndex ID = 141 - enBBIndex ID = 142 - enBEIndex ID = 143 - enBIIndex ID = 144 - enBMIndex ID = 145 - enBSIndex ID = 146 - enBWIndex ID = 147 - enBZIndex ID = 148 - enCAIndex ID = 149 - enCCIndex ID = 150 - enCHIndex ID = 151 - enCKIndex ID = 152 - enCMIndex ID = 153 - enCXIndex ID = 154 - enCYIndex ID = 155 - enDEIndex ID = 156 - enDGIndex ID = 157 - enDKIndex ID = 158 - enDMIndex ID = 159 - enERIndex ID = 160 - enFIIndex ID = 161 - enFJIndex ID = 162 - enFKIndex ID = 163 - enFMIndex ID = 164 - enGBIndex ID = 165 - enGDIndex ID = 166 - enGGIndex ID = 167 - enGHIndex ID = 168 - enGIIndex ID = 169 - enGMIndex ID = 170 - enGUIndex ID = 171 - enGYIndex ID = 172 - enHKIndex ID = 173 - enIEIndex ID = 174 - enILIndex ID = 175 - enIMIndex ID = 176 - enINIndex ID = 177 - enIOIndex ID = 178 - enJEIndex ID = 179 - enJMIndex ID = 180 - enKEIndex ID = 181 - enKIIndex ID = 182 - enKNIndex ID = 183 - enKYIndex ID = 184 - enLCIndex ID = 185 - enLRIndex ID = 186 - enLSIndex ID = 187 - enMGIndex ID = 188 - enMHIndex ID = 189 - enMOIndex ID = 190 - enMPIndex ID = 191 - enMSIndex ID = 192 - enMTIndex ID = 193 - enMUIndex ID = 194 - enMWIndex ID = 195 - enMYIndex ID = 196 - enNAIndex ID = 197 - enNFIndex ID = 198 - enNGIndex ID = 199 - enNLIndex ID = 200 - enNRIndex ID = 201 - enNUIndex ID = 202 - enNZIndex ID = 203 - enPGIndex ID = 204 - enPHIndex ID = 205 - enPKIndex ID = 206 - enPNIndex ID = 207 - enPRIndex ID = 208 - enPWIndex ID = 209 - enRWIndex ID = 210 - enSBIndex ID = 211 - enSCIndex ID = 212 - enSDIndex ID = 213 - enSEIndex ID = 214 - enSGIndex ID = 215 - enSHIndex ID = 216 - enSIIndex ID = 217 - enSLIndex ID = 218 - enSSIndex ID = 219 - enSXIndex ID = 220 - enSZIndex ID = 221 - enTCIndex ID = 222 - enTKIndex ID = 223 - enTOIndex ID = 224 - enTTIndex ID = 225 - enTVIndex ID = 226 - enTZIndex ID = 227 - enUGIndex ID = 228 - enUMIndex ID = 229 - enUSIndex ID = 230 - enVCIndex ID = 231 - enVGIndex ID = 232 - enVIIndex ID = 233 - enVUIndex ID = 234 - enWSIndex ID = 235 - enZAIndex ID = 236 - enZMIndex ID = 237 - enZWIndex ID = 238 - eoIndex ID = 239 - eo001Index ID = 240 - esIndex ID = 241 - es419Index ID = 242 - esARIndex ID = 243 - esBOIndex ID = 244 - esBRIndex ID = 245 - esBZIndex ID = 246 - esCLIndex ID = 247 - esCOIndex ID = 248 - esCRIndex ID = 249 - esCUIndex ID = 250 - esDOIndex ID = 251 - esEAIndex ID = 252 - esECIndex ID = 253 - esESIndex ID = 254 - esGQIndex ID = 255 - esGTIndex ID = 256 - esHNIndex ID = 257 - esICIndex ID = 258 - esMXIndex ID = 259 - esNIIndex ID = 260 - esPAIndex ID = 261 - esPEIndex ID = 262 - esPHIndex ID = 263 - esPRIndex ID = 264 - esPYIndex ID = 265 - esSVIndex ID = 266 - esUSIndex ID = 267 - esUYIndex ID = 268 - esVEIndex ID = 269 - etIndex ID = 270 - etEEIndex ID = 271 - euIndex ID = 272 - euESIndex ID = 273 - ewoIndex ID = 274 - ewoCMIndex ID = 275 - faIndex ID = 276 - faAFIndex ID = 277 - faIRIndex ID = 278 - ffIndex ID = 279 - ffCMIndex ID = 280 - ffGNIndex ID = 281 - ffMRIndex ID = 282 - ffSNIndex ID = 283 - fiIndex ID = 284 - fiFIIndex ID = 285 - filIndex ID = 286 - filPHIndex ID = 287 - foIndex ID = 288 - foDKIndex ID = 289 - foFOIndex ID = 290 - frIndex ID = 291 - frBEIndex ID = 292 - frBFIndex ID = 293 - frBIIndex ID = 294 - frBJIndex ID = 295 - frBLIndex ID = 296 - frCAIndex ID = 297 - frCDIndex ID = 298 - frCFIndex ID = 299 - frCGIndex ID = 300 - frCHIndex ID = 301 - frCIIndex ID = 302 - frCMIndex ID = 303 - frDJIndex ID = 304 - frDZIndex ID = 305 - frFRIndex ID = 306 - frGAIndex ID = 307 - frGFIndex ID = 308 - frGNIndex ID = 309 - frGPIndex ID = 310 - frGQIndex ID = 311 - frHTIndex ID = 312 - frKMIndex ID = 313 - frLUIndex ID = 314 - frMAIndex ID = 315 - frMCIndex ID = 316 - frMFIndex ID = 317 - frMGIndex ID = 318 - frMLIndex ID = 319 - frMQIndex ID = 320 - frMRIndex ID = 321 - frMUIndex ID = 322 - frNCIndex ID = 323 - frNEIndex ID = 324 - frPFIndex ID = 325 - frPMIndex ID = 326 - frREIndex ID = 327 - frRWIndex ID = 328 - frSCIndex ID = 329 - frSNIndex ID = 330 - frSYIndex ID = 331 - frTDIndex ID = 332 - frTGIndex ID = 333 - frTNIndex ID = 334 - frVUIndex ID = 335 - frWFIndex ID = 336 - frYTIndex ID = 337 - furIndex ID = 338 - furITIndex ID = 339 - fyIndex ID = 340 - fyNLIndex ID = 341 - gaIndex ID = 342 - gaIEIndex ID = 343 - gdIndex ID = 344 - gdGBIndex ID = 345 - glIndex ID = 346 - glESIndex ID = 347 - gswIndex ID = 348 - gswCHIndex ID = 349 - gswFRIndex ID = 350 - gswLIIndex ID = 351 - guIndex ID = 352 - guINIndex ID = 353 - guwIndex ID = 354 - guzIndex ID = 355 - guzKEIndex ID = 356 - gvIndex ID = 357 - gvIMIndex ID = 358 - haIndex ID = 359 - haGHIndex ID = 360 - haNEIndex ID = 361 - haNGIndex ID = 362 - hawIndex ID = 363 - hawUSIndex ID = 364 - heIndex ID = 365 - heILIndex ID = 366 - hiIndex ID = 367 - hiINIndex ID = 368 - hrIndex ID = 369 - hrBAIndex ID = 370 - hrHRIndex ID = 371 - hsbIndex ID = 372 - hsbDEIndex ID = 373 - huIndex ID = 374 - huHUIndex ID = 375 - hyIndex ID = 376 - hyAMIndex ID = 377 - idIndex ID = 378 - idIDIndex ID = 379 - igIndex ID = 380 - igNGIndex ID = 381 - iiIndex ID = 382 - iiCNIndex ID = 383 - inIndex ID = 384 - ioIndex ID = 385 - isIndex ID = 386 - isISIndex ID = 387 - itIndex ID = 388 - itCHIndex ID = 389 - itITIndex ID = 390 - itSMIndex ID = 391 - itVAIndex ID = 392 - iuIndex ID = 393 - iwIndex ID = 394 - jaIndex ID = 395 - jaJPIndex ID = 396 - jboIndex ID = 397 - jgoIndex ID = 398 - jgoCMIndex ID = 399 - jiIndex ID = 400 - jmcIndex ID = 401 - jmcTZIndex ID = 402 - jvIndex ID = 403 - jwIndex ID = 404 - kaIndex ID = 405 - kaGEIndex ID = 406 - kabIndex ID = 407 - kabDZIndex ID = 408 - kajIndex ID = 409 - kamIndex ID = 410 - kamKEIndex ID = 411 - kcgIndex ID = 412 - kdeIndex ID = 413 - kdeTZIndex ID = 414 - keaIndex ID = 415 - keaCVIndex ID = 416 - khqIndex ID = 417 - khqMLIndex ID = 418 - kiIndex ID = 419 - kiKEIndex ID = 420 - kkIndex ID = 421 - kkKZIndex ID = 422 - kkjIndex ID = 423 - kkjCMIndex ID = 424 - klIndex ID = 425 - klGLIndex ID = 426 - klnIndex ID = 427 - klnKEIndex ID = 428 - kmIndex ID = 429 - kmKHIndex ID = 430 - knIndex ID = 431 - knINIndex ID = 432 - koIndex ID = 433 - koKPIndex ID = 434 - koKRIndex ID = 435 - kokIndex ID = 436 - kokINIndex ID = 437 - ksIndex ID = 438 - ksINIndex ID = 439 - ksbIndex ID = 440 - ksbTZIndex ID = 441 - ksfIndex ID = 442 - ksfCMIndex ID = 443 - kshIndex ID = 444 - kshDEIndex ID = 445 - kuIndex ID = 446 - kwIndex ID = 447 - kwGBIndex ID = 448 - kyIndex ID = 449 - kyKGIndex ID = 450 - lagIndex ID = 451 - lagTZIndex ID = 452 - lbIndex ID = 453 - lbLUIndex ID = 454 - lgIndex ID = 455 - lgUGIndex ID = 456 - lktIndex ID = 457 - lktUSIndex ID = 458 - lnIndex ID = 459 - lnAOIndex ID = 460 - lnCDIndex ID = 461 - lnCFIndex ID = 462 - lnCGIndex ID = 463 - loIndex ID = 464 - loLAIndex ID = 465 - lrcIndex ID = 466 - lrcIQIndex ID = 467 - lrcIRIndex ID = 468 - ltIndex ID = 469 - ltLTIndex ID = 470 - luIndex ID = 471 - luCDIndex ID = 472 - luoIndex ID = 473 - luoKEIndex ID = 474 - luyIndex ID = 475 - luyKEIndex ID = 476 - lvIndex ID = 477 - lvLVIndex ID = 478 - masIndex ID = 479 - masKEIndex ID = 480 - masTZIndex ID = 481 - merIndex ID = 482 - merKEIndex ID = 483 - mfeIndex ID = 484 - mfeMUIndex ID = 485 - mgIndex ID = 486 - mgMGIndex ID = 487 - mghIndex ID = 488 - mghMZIndex ID = 489 - mgoIndex ID = 490 - mgoCMIndex ID = 491 - mkIndex ID = 492 - mkMKIndex ID = 493 - mlIndex ID = 494 - mlINIndex ID = 495 - mnIndex ID = 496 - mnMNIndex ID = 497 - moIndex ID = 498 - mrIndex ID = 499 - mrINIndex ID = 500 - msIndex ID = 501 - msBNIndex ID = 502 - msMYIndex ID = 503 - msSGIndex ID = 504 - mtIndex ID = 505 - mtMTIndex ID = 506 - muaIndex ID = 507 - muaCMIndex ID = 508 - myIndex ID = 509 - myMMIndex ID = 510 - mznIndex ID = 511 - mznIRIndex ID = 512 - nahIndex ID = 513 - naqIndex ID = 514 - naqNAIndex ID = 515 - nbIndex ID = 516 - nbNOIndex ID = 517 - nbSJIndex ID = 518 - ndIndex ID = 519 - ndZWIndex ID = 520 - ndsIndex ID = 521 - ndsDEIndex ID = 522 - ndsNLIndex ID = 523 - neIndex ID = 524 - neINIndex ID = 525 - neNPIndex ID = 526 - nlIndex ID = 527 - nlAWIndex ID = 528 - nlBEIndex ID = 529 - nlBQIndex ID = 530 - nlCWIndex ID = 531 - nlNLIndex ID = 532 - nlSRIndex ID = 533 - nlSXIndex ID = 534 - nmgIndex ID = 535 - nmgCMIndex ID = 536 - nnIndex ID = 537 - nnNOIndex ID = 538 - nnhIndex ID = 539 - nnhCMIndex ID = 540 - noIndex ID = 541 - nqoIndex ID = 542 - nrIndex ID = 543 - nsoIndex ID = 544 - nusIndex ID = 545 - nusSSIndex ID = 546 - nyIndex ID = 547 - nynIndex ID = 548 - nynUGIndex ID = 549 - omIndex ID = 550 - omETIndex ID = 551 - omKEIndex ID = 552 - orIndex ID = 553 - orINIndex ID = 554 - osIndex ID = 555 - osGEIndex ID = 556 - osRUIndex ID = 557 - paIndex ID = 558 - paArabIndex ID = 559 - paArabPKIndex ID = 560 - paGuruIndex ID = 561 - paGuruINIndex ID = 562 - papIndex ID = 563 - plIndex ID = 564 - plPLIndex ID = 565 - prgIndex ID = 566 - prg001Index ID = 567 - psIndex ID = 568 - psAFIndex ID = 569 - ptIndex ID = 570 - ptAOIndex ID = 571 - ptBRIndex ID = 572 - ptCHIndex ID = 573 - ptCVIndex ID = 574 - ptGQIndex ID = 575 - ptGWIndex ID = 576 - ptLUIndex ID = 577 - ptMOIndex ID = 578 - ptMZIndex ID = 579 - ptPTIndex ID = 580 - ptSTIndex ID = 581 - ptTLIndex ID = 582 - quIndex ID = 583 - quBOIndex ID = 584 - quECIndex ID = 585 - quPEIndex ID = 586 - rmIndex ID = 587 - rmCHIndex ID = 588 - rnIndex ID = 589 - rnBIIndex ID = 590 - roIndex ID = 591 - roMDIndex ID = 592 - roROIndex ID = 593 - rofIndex ID = 594 - rofTZIndex ID = 595 - ruIndex ID = 596 - ruBYIndex ID = 597 - ruKGIndex ID = 598 - ruKZIndex ID = 599 - ruMDIndex ID = 600 - ruRUIndex ID = 601 - ruUAIndex ID = 602 - rwIndex ID = 603 - rwRWIndex ID = 604 - rwkIndex ID = 605 - rwkTZIndex ID = 606 - sahIndex ID = 607 - sahRUIndex ID = 608 - saqIndex ID = 609 - saqKEIndex ID = 610 - sbpIndex ID = 611 - sbpTZIndex ID = 612 - sdIndex ID = 613 - sdPKIndex ID = 614 - sdhIndex ID = 615 - seIndex ID = 616 - seFIIndex ID = 617 - seNOIndex ID = 618 - seSEIndex ID = 619 - sehIndex ID = 620 - sehMZIndex ID = 621 - sesIndex ID = 622 - sesMLIndex ID = 623 - sgIndex ID = 624 - sgCFIndex ID = 625 - shIndex ID = 626 - shiIndex ID = 627 - shiLatnIndex ID = 628 - shiLatnMAIndex ID = 629 - shiTfngIndex ID = 630 - shiTfngMAIndex ID = 631 - siIndex ID = 632 - siLKIndex ID = 633 - skIndex ID = 634 - skSKIndex ID = 635 - slIndex ID = 636 - slSIIndex ID = 637 - smaIndex ID = 638 - smiIndex ID = 639 - smjIndex ID = 640 - smnIndex ID = 641 - smnFIIndex ID = 642 - smsIndex ID = 643 - snIndex ID = 644 - snZWIndex ID = 645 - soIndex ID = 646 - soDJIndex ID = 647 - soETIndex ID = 648 - soKEIndex ID = 649 - soSOIndex ID = 650 - sqIndex ID = 651 - sqALIndex ID = 652 - sqMKIndex ID = 653 - sqXKIndex ID = 654 - srIndex ID = 655 - srCyrlIndex ID = 656 - srCyrlBAIndex ID = 657 - srCyrlMEIndex ID = 658 - srCyrlRSIndex ID = 659 - srCyrlXKIndex ID = 660 - srLatnIndex ID = 661 - srLatnBAIndex ID = 662 - srLatnMEIndex ID = 663 - srLatnRSIndex ID = 664 - srLatnXKIndex ID = 665 - ssIndex ID = 666 - ssyIndex ID = 667 - stIndex ID = 668 - svIndex ID = 669 - svAXIndex ID = 670 - svFIIndex ID = 671 - svSEIndex ID = 672 - swIndex ID = 673 - swCDIndex ID = 674 - swKEIndex ID = 675 - swTZIndex ID = 676 - swUGIndex ID = 677 - syrIndex ID = 678 - taIndex ID = 679 - taINIndex ID = 680 - taLKIndex ID = 681 - taMYIndex ID = 682 - taSGIndex ID = 683 - teIndex ID = 684 - teINIndex ID = 685 - teoIndex ID = 686 - teoKEIndex ID = 687 - teoUGIndex ID = 688 - tgIndex ID = 689 - tgTJIndex ID = 690 - thIndex ID = 691 - thTHIndex ID = 692 - tiIndex ID = 693 - tiERIndex ID = 694 - tiETIndex ID = 695 - tigIndex ID = 696 - tkIndex ID = 697 - tkTMIndex ID = 698 - tlIndex ID = 699 - tnIndex ID = 700 - toIndex ID = 701 - toTOIndex ID = 702 - trIndex ID = 703 - trCYIndex ID = 704 - trTRIndex ID = 705 - tsIndex ID = 706 - ttIndex ID = 707 - ttRUIndex ID = 708 - twqIndex ID = 709 - twqNEIndex ID = 710 - tzmIndex ID = 711 - tzmMAIndex ID = 712 - ugIndex ID = 713 - ugCNIndex ID = 714 - ukIndex ID = 715 - ukUAIndex ID = 716 - urIndex ID = 717 - urINIndex ID = 718 - urPKIndex ID = 719 - uzIndex ID = 720 - uzArabIndex ID = 721 - uzArabAFIndex ID = 722 - uzCyrlIndex ID = 723 - uzCyrlUZIndex ID = 724 - uzLatnIndex ID = 725 - uzLatnUZIndex ID = 726 - vaiIndex ID = 727 - vaiLatnIndex ID = 728 - vaiLatnLRIndex ID = 729 - vaiVaiiIndex ID = 730 - vaiVaiiLRIndex ID = 731 - veIndex ID = 732 - viIndex ID = 733 - viVNIndex ID = 734 - voIndex ID = 735 - vo001Index ID = 736 - vunIndex ID = 737 - vunTZIndex ID = 738 - waIndex ID = 739 - waeIndex ID = 740 - waeCHIndex ID = 741 - woIndex ID = 742 - woSNIndex ID = 743 - xhIndex ID = 744 - xogIndex ID = 745 - xogUGIndex ID = 746 - yavIndex ID = 747 - yavCMIndex ID = 748 - yiIndex ID = 749 - yi001Index ID = 750 - yoIndex ID = 751 - yoBJIndex ID = 752 - yoNGIndex ID = 753 - yueIndex ID = 754 - yueHansIndex ID = 755 - yueHansCNIndex ID = 756 - yueHantIndex ID = 757 - yueHantHKIndex ID = 758 - zghIndex ID = 759 - zghMAIndex ID = 760 - zhIndex ID = 761 - zhHansIndex ID = 762 - zhHansCNIndex ID = 763 - zhHansHKIndex ID = 764 - zhHansMOIndex ID = 765 - zhHansSGIndex ID = 766 - zhHantIndex ID = 767 - zhHantHKIndex ID = 768 - zhHantMOIndex ID = 769 - zhHantTWIndex ID = 770 - zuIndex ID = 771 - zuZAIndex ID = 772 - caESvalenciaIndex ID = 773 - enUSuvaposixIndex ID = 774 -) - -var coreTags = []language.CompactCoreInfo{ // 773 elements - // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, - // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, - 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, - // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, - // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, - // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, - 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, - 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, - 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, - 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, - // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, - // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, - // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, - 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, - 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, - // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, - // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, - 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, - 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, - 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, - // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, - // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, - // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, - // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, - // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, - 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, - // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, - // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, - 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, - // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, - 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, - // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, - 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, - // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, - 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, - // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, - // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, - // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, - 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, - // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, - 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, - // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, -} // Size: 3116 bytes - -const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" - -// Total table size 3147 bytes (3KiB); checksum: 6772C83C diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go deleted file mode 100644 index ca135d295a..0000000000 --- a/vendor/golang.org/x/text/internal/language/compact/tags.go +++ /dev/null @@ -1,91 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package compact - -var ( - und = Tag{} - - Und Tag = Tag{} - - Afrikaans Tag = Tag{language: afIndex, locale: afIndex} - Amharic Tag = Tag{language: amIndex, locale: amIndex} - Arabic Tag = Tag{language: arIndex, locale: arIndex} - ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} - Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} - Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} - Bengali Tag = Tag{language: bnIndex, locale: bnIndex} - Catalan Tag = Tag{language: caIndex, locale: caIndex} - Czech Tag = Tag{language: csIndex, locale: csIndex} - Danish Tag = Tag{language: daIndex, locale: daIndex} - German Tag = Tag{language: deIndex, locale: deIndex} - Greek Tag = Tag{language: elIndex, locale: elIndex} - English Tag = Tag{language: enIndex, locale: enIndex} - AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} - BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} - Spanish Tag = Tag{language: esIndex, locale: esIndex} - EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} - LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} - Estonian Tag = Tag{language: etIndex, locale: etIndex} - Persian Tag = Tag{language: faIndex, locale: faIndex} - Finnish Tag = Tag{language: fiIndex, locale: fiIndex} - Filipino Tag = Tag{language: filIndex, locale: filIndex} - French Tag = Tag{language: frIndex, locale: frIndex} - CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} - Gujarati Tag = Tag{language: guIndex, locale: guIndex} - Hebrew Tag = Tag{language: heIndex, locale: heIndex} - Hindi Tag = Tag{language: hiIndex, locale: hiIndex} - Croatian Tag = Tag{language: hrIndex, locale: hrIndex} - Hungarian Tag = Tag{language: huIndex, locale: huIndex} - Armenian Tag = Tag{language: hyIndex, locale: hyIndex} - Indonesian Tag = Tag{language: idIndex, locale: idIndex} - Icelandic Tag = Tag{language: isIndex, locale: isIndex} - Italian Tag = Tag{language: itIndex, locale: itIndex} - Japanese Tag = Tag{language: jaIndex, locale: jaIndex} - Georgian Tag = Tag{language: kaIndex, locale: kaIndex} - Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} - Khmer Tag = Tag{language: kmIndex, locale: kmIndex} - Kannada Tag = Tag{language: knIndex, locale: knIndex} - Korean Tag = Tag{language: koIndex, locale: koIndex} - Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} - Lao Tag = Tag{language: loIndex, locale: loIndex} - Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} - Latvian Tag = Tag{language: lvIndex, locale: lvIndex} - Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} - Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} - Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} - Marathi Tag = Tag{language: mrIndex, locale: mrIndex} - Malay Tag = Tag{language: msIndex, locale: msIndex} - Burmese Tag = Tag{language: myIndex, locale: myIndex} - Nepali Tag = Tag{language: neIndex, locale: neIndex} - Dutch Tag = Tag{language: nlIndex, locale: nlIndex} - Norwegian Tag = Tag{language: noIndex, locale: noIndex} - Punjabi Tag = Tag{language: paIndex, locale: paIndex} - Polish Tag = Tag{language: plIndex, locale: plIndex} - Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} - BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} - EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} - Romanian Tag = Tag{language: roIndex, locale: roIndex} - Russian Tag = Tag{language: ruIndex, locale: ruIndex} - Sinhala Tag = Tag{language: siIndex, locale: siIndex} - Slovak Tag = Tag{language: skIndex, locale: skIndex} - Slovenian Tag = Tag{language: slIndex, locale: slIndex} - Albanian Tag = Tag{language: sqIndex, locale: sqIndex} - Serbian Tag = Tag{language: srIndex, locale: srIndex} - SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} - Swedish Tag = Tag{language: svIndex, locale: svIndex} - Swahili Tag = Tag{language: swIndex, locale: swIndex} - Tamil Tag = Tag{language: taIndex, locale: taIndex} - Telugu Tag = Tag{language: teIndex, locale: teIndex} - Thai Tag = Tag{language: thIndex, locale: thIndex} - Turkish Tag = Tag{language: trIndex, locale: trIndex} - Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} - Urdu Tag = Tag{language: urIndex, locale: urIndex} - Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} - Vietnamese Tag = Tag{language: viIndex, locale: viIndex} - Chinese Tag = Tag{language: zhIndex, locale: zhIndex} - SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} - TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} - Zulu Tag = Tag{language: zuIndex, locale: zuIndex} -) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go deleted file mode 100644 index 4ae78e0fa5..0000000000 --- a/vendor/golang.org/x/text/internal/language/compose.go +++ /dev/null @@ -1,167 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "sort" - "strings" -) - -// A Builder allows constructing a Tag from individual components. -// Its main user is Compose in the top-level language package. -type Builder struct { - Tag Tag - - private string // the x extension - variants []string - extensions []string -} - -// Make returns a new Tag from the current settings. -func (b *Builder) Make() Tag { - t := b.Tag - - if len(b.extensions) > 0 || len(b.variants) > 0 { - sort.Sort(sortVariants(b.variants)) - sort.Strings(b.extensions) - - if b.private != "" { - b.extensions = append(b.extensions, b.private) - } - n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) - buf := make([]byte, n) - p := t.genCoreBytes(buf) - t.pVariant = byte(p) - p += appendTokens(buf[p:], b.variants...) - t.pExt = uint16(p) - p += appendTokens(buf[p:], b.extensions...) - t.str = string(buf[:p]) - // We may not always need to remake the string, but when or when not - // to do so is rather tricky. - scan := makeScanner(buf[:p]) - t, _ = parse(&scan, "") - return t - - } else if b.private != "" { - t.str = b.private - t.RemakeString() - } - return t -} - -// SetTag copies all the settings from a given Tag. Any previously set values -// are discarded. -func (b *Builder) SetTag(t Tag) { - b.Tag.LangID = t.LangID - b.Tag.RegionID = t.RegionID - b.Tag.ScriptID = t.ScriptID - // TODO: optimize - b.variants = b.variants[:0] - if variants := t.Variants(); variants != "" { - for _, vr := range strings.Split(variants[1:], "-") { - b.variants = append(b.variants, vr) - } - } - b.extensions, b.private = b.extensions[:0], "" - for _, e := range t.Extensions() { - b.AddExt(e) - } -} - -// AddExt adds extension e to the tag. e must be a valid extension as returned -// by Tag.Extension. If the extension already exists, it will be discarded, -// except for a -u extension, where non-existing key-type pairs will added. -func (b *Builder) AddExt(e string) { - if e[0] == 'x' { - if b.private == "" { - b.private = e - } - return - } - for i, s := range b.extensions { - if s[0] == e[0] { - if e[0] == 'u' { - b.extensions[i] += e[1:] - } - return - } - } - b.extensions = append(b.extensions, e) -} - -// SetExt sets the extension e to the tag. e must be a valid extension as -// returned by Tag.Extension. If the extension already exists, it will be -// overwritten, except for a -u extension, where the individual key-type pairs -// will be set. -func (b *Builder) SetExt(e string) { - if e[0] == 'x' { - b.private = e - return - } - for i, s := range b.extensions { - if s[0] == e[0] { - if e[0] == 'u' { - b.extensions[i] = e + s[1:] - } else { - b.extensions[i] = e - } - return - } - } - b.extensions = append(b.extensions, e) -} - -// AddVariant adds any number of variants. -func (b *Builder) AddVariant(v ...string) { - for _, v := range v { - if v != "" { - b.variants = append(b.variants, v) - } - } -} - -// ClearVariants removes any variants previously added, including those -// copied from a Tag in SetTag. -func (b *Builder) ClearVariants() { - b.variants = b.variants[:0] -} - -// ClearExtensions removes any extensions previously added, including those -// copied from a Tag in SetTag. -func (b *Builder) ClearExtensions() { - b.private = "" - b.extensions = b.extensions[:0] -} - -func tokenLen(token ...string) (n int) { - for _, t := range token { - n += len(t) + 1 - } - return -} - -func appendTokens(b []byte, token ...string) int { - p := 0 - for _, t := range token { - b[p] = '-' - copy(b[p+1:], t) - p += 1 + len(t) - } - return p -} - -type sortVariants []string - -func (s sortVariants) Len() int { - return len(s) -} - -func (s sortVariants) Swap(i, j int) { - s[j], s[i] = s[i], s[j] -} - -func (s sortVariants) Less(i, j int) bool { - return variantIndex[s[i]] < variantIndex[s[j]] -} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go deleted file mode 100644 index 9b20b88feb..0000000000 --- a/vendor/golang.org/x/text/internal/language/coverage.go +++ /dev/null @@ -1,28 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// BaseLanguages returns the list of all supported base languages. It generates -// the list by traversing the internal structures. -func BaseLanguages() []Language { - base := make([]Language, 0, NumLanguages) - for i := 0; i < langNoIndexOffset; i++ { - // We included "und" already for the value 0. - if i != nonCanonicalUnd { - base = append(base, Language(i)) - } - } - i := langNoIndexOffset - for _, v := range langNoIndex { - for k := 0; k < 8; k++ { - if v&1 == 1 { - base = append(base, Language(i)) - } - v >>= 1 - i++ - } - } - return base -} diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go deleted file mode 100644 index 09d41c7367..0000000000 --- a/vendor/golang.org/x/text/internal/language/language.go +++ /dev/null @@ -1,627 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_common.go -output tables.go - -package language // import "golang.org/x/text/internal/language" - -// TODO: Remove above NOTE after: -// - verifying that tables are dropped correctly (most notably matcher tables). - -import ( - "errors" - "fmt" - "strings" -) - -const ( - // maxCoreSize is the maximum size of a BCP 47 tag without variants and - // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. - maxCoreSize = 12 - - // max99thPercentileSize is a somewhat arbitrary buffer size that presumably - // is large enough to hold at least 99% of the BCP 47 tags. - max99thPercentileSize = 32 - - // maxSimpleUExtensionSize is the maximum size of a -u extension with one - // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). - maxSimpleUExtensionSize = 14 -) - -// Tag represents a BCP 47 language tag. It is used to specify an instance of a -// specific language or locale. All language tag values are guaranteed to be -// well-formed. The zero value of Tag is Und. -type Tag struct { - // TODO: the following fields have the form TagTypeID. This name is chosen - // to allow refactoring the public package without conflicting with its - // Base, Script, and Region methods. Once the transition is fully completed - // the ID can be stripped from the name. - - LangID Language - RegionID Region - // TODO: we will soon run out of positions for ScriptID. Idea: instead of - // storing lang, region, and ScriptID codes, store only the compact index and - // have a lookup table from this code to its expansion. This greatly speeds - // up table lookup, speed up common variant cases. - // This will also immediately free up 3 extra bytes. Also, the pVariant - // field can now be moved to the lookup table, as the compact index uniquely - // determines the offset of a possible variant. - ScriptID Script - pVariant byte // offset in str, includes preceding '-' - pExt uint16 // offset of first extension, includes preceding '-' - - // str is the string representation of the Tag. It will only be used if the - // tag has variants or extensions. - str string -} - -// Make is a convenience wrapper for Parse that omits the error. -// In case of an error, a sensible default is returned. -func Make(s string) Tag { - t, _ := Parse(s) - return t -} - -// Raw returns the raw base language, script and region, without making an -// attempt to infer their values. -// TODO: consider removing -func (t Tag) Raw() (b Language, s Script, r Region) { - return t.LangID, t.ScriptID, t.RegionID -} - -// equalTags compares language, script and region subtags only. -func (t Tag) equalTags(a Tag) bool { - return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID -} - -// IsRoot returns true if t is equal to language "und". -func (t Tag) IsRoot() bool { - if int(t.pVariant) < len(t.str) { - return false - } - return t.equalTags(Und) -} - -// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use -// tag. -func (t Tag) IsPrivateUse() bool { - return t.str != "" && t.pVariant == 0 -} - -// RemakeString is used to update t.str in case lang, script or region changed. -// It is assumed that pExt and pVariant still point to the start of the -// respective parts. -func (t *Tag) RemakeString() { - if t.str == "" { - return - } - extra := t.str[t.pVariant:] - if t.pVariant > 0 { - extra = extra[1:] - } - if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { - t.str = extra - t.pVariant = 0 - t.pExt = 0 - return - } - var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. - b := buf[:t.genCoreBytes(buf[:])] - if extra != "" { - diff := len(b) - int(t.pVariant) - b = append(b, '-') - b = append(b, extra...) - t.pVariant = uint8(int(t.pVariant) + diff) - t.pExt = uint16(int(t.pExt) + diff) - } else { - t.pVariant = uint8(len(b)) - t.pExt = uint16(len(b)) - } - t.str = string(b) -} - -// genCoreBytes writes a string for the base languages, script and region tags -// to the given buffer and returns the number of bytes written. It will never -// write more than maxCoreSize bytes. -func (t *Tag) genCoreBytes(buf []byte) int { - n := t.LangID.StringToBuf(buf[:]) - if t.ScriptID != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.ScriptID.String()) - } - if t.RegionID != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.RegionID.String()) - } - return n -} - -// String returns the canonical string representation of the language tag. -func (t Tag) String() string { - if t.str != "" { - return t.str - } - if t.ScriptID == 0 && t.RegionID == 0 { - return t.LangID.String() - } - buf := [maxCoreSize]byte{} - return string(buf[:t.genCoreBytes(buf[:])]) -} - -// MarshalText implements encoding.TextMarshaler. -func (t Tag) MarshalText() (text []byte, err error) { - if t.str != "" { - text = append(text, t.str...) - } else if t.ScriptID == 0 && t.RegionID == 0 { - text = append(text, t.LangID.String()...) - } else { - buf := [maxCoreSize]byte{} - text = buf[:t.genCoreBytes(buf[:])] - } - return text, nil -} - -// UnmarshalText implements encoding.TextUnmarshaler. -func (t *Tag) UnmarshalText(text []byte) error { - tag, err := Parse(string(text)) - *t = tag - return err -} - -// Variants returns the part of the tag holding all variants or the empty string -// if there are no variants defined. -func (t Tag) Variants() string { - if t.pVariant == 0 { - return "" - } - return t.str[t.pVariant:t.pExt] -} - -// VariantOrPrivateUseTags returns variants or private use tags. -func (t Tag) VariantOrPrivateUseTags() string { - if t.pExt > 0 { - return t.str[t.pVariant:t.pExt] - } - return t.str[t.pVariant:] -} - -// HasString reports whether this tag defines more than just the raw -// components. -func (t Tag) HasString() bool { - return t.str != "" -} - -// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a -// specific language are substituted with fields from the parent language. -// The parent for a language may change for newer versions of CLDR. -func (t Tag) Parent() Tag { - if t.str != "" { - // Strip the variants and extensions. - b, s, r := t.Raw() - t = Tag{LangID: b, ScriptID: s, RegionID: r} - if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { - base, _ := addTags(Tag{LangID: t.LangID}) - if base.ScriptID == t.ScriptID { - return Tag{LangID: t.LangID} - } - } - return t - } - if t.LangID != 0 { - if t.RegionID != 0 { - maxScript := t.ScriptID - if maxScript == 0 { - max, _ := addTags(t) - maxScript = max.ScriptID - } - - for i := range parents { - if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { - for _, r := range parents[i].fromRegion { - if Region(r) == t.RegionID { - return Tag{ - LangID: t.LangID, - ScriptID: Script(parents[i].script), - RegionID: Region(parents[i].toRegion), - } - } - } - } - } - - // Strip the script if it is the default one. - base, _ := addTags(Tag{LangID: t.LangID}) - if base.ScriptID != maxScript { - return Tag{LangID: t.LangID, ScriptID: maxScript} - } - return Tag{LangID: t.LangID} - } else if t.ScriptID != 0 { - // The parent for an base-script pair with a non-default script is - // "und" instead of the base language. - base, _ := addTags(Tag{LangID: t.LangID}) - if base.ScriptID != t.ScriptID { - return Und - } - return Tag{LangID: t.LangID} - } - } - return Und -} - -// ParseExtension parses s as an extension and returns it on success. -func ParseExtension(s string) (ext string, err error) { - defer func() { - if recover() != nil { - ext = "" - err = ErrSyntax - } - }() - - scan := makeScannerString(s) - var end int - if n := len(scan.token); n != 1 { - return "", ErrSyntax - } - scan.toLower(0, len(scan.b)) - end = parseExtension(&scan) - if end != len(s) { - return "", ErrSyntax - } - return string(scan.b), nil -} - -// HasVariants reports whether t has variants. -func (t Tag) HasVariants() bool { - return uint16(t.pVariant) < t.pExt -} - -// HasExtensions reports whether t has extensions. -func (t Tag) HasExtensions() bool { - return int(t.pExt) < len(t.str) -} - -// Extension returns the extension of type x for tag t. It will return -// false for ok if t does not have the requested extension. The returned -// extension will be invalid in this case. -func (t Tag) Extension(x byte) (ext string, ok bool) { - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - if ext[0] == x { - return ext, true - } - } - return "", false -} - -// Extensions returns all extensions of t. -func (t Tag) Extensions() []string { - e := []string{} - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - e = append(e, ext) - } - return e -} - -// TypeForKey returns the type associated with the given key, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// TypeForKey will traverse the inheritance chain to get the correct value. -// -// If there are multiple types associated with a key, only the first will be -// returned. If there is no type associated with a key, it returns the empty -// string. -func (t Tag) TypeForKey(key string) string { - if _, start, end, _ := t.findTypeForKey(key); end != start { - s := t.str[start:end] - if p := strings.IndexByte(s, '-'); p >= 0 { - s = s[:p] - } - return s - } - return "" -} - -var ( - errPrivateUse = errors.New("cannot set a key on a private use tag") - errInvalidArguments = errors.New("invalid key or type") -) - -// SetTypeForKey returns a new Tag with the key set to type, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// An empty value removes an existing pair with the same key. -func (t Tag) SetTypeForKey(key, value string) (Tag, error) { - if t.IsPrivateUse() { - return t, errPrivateUse - } - if len(key) != 2 { - return t, errInvalidArguments - } - - // Remove the setting if value is "". - if value == "" { - start, sep, end, _ := t.findTypeForKey(key) - if start != sep { - // Remove a possible empty extension. - switch { - case t.str[start-2] != '-': // has previous elements. - case end == len(t.str), // end of string - end+2 < len(t.str) && t.str[end+2] == '-': // end of extension - start -= 2 - } - if start == int(t.pVariant) && end == len(t.str) { - t.str = "" - t.pVariant, t.pExt = 0, 0 - } else { - t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) - } - } - return t, nil - } - - if len(value) < 3 || len(value) > 8 { - return t, errInvalidArguments - } - - var ( - buf [maxCoreSize + maxSimpleUExtensionSize]byte - uStart int // start of the -u extension. - ) - - // Generate the tag string if needed. - if t.str == "" { - uStart = t.genCoreBytes(buf[:]) - buf[uStart] = '-' - uStart++ - } - - // Create new key-type pair and parse it to verify. - b := buf[uStart:] - copy(b, "u-") - copy(b[2:], key) - b[4] = '-' - b = b[:5+copy(b[5:], value)] - scan := makeScanner(b) - if parseExtensions(&scan); scan.err != nil { - return t, scan.err - } - - // Assemble the replacement string. - if t.str == "" { - t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) - t.str = string(buf[:uStart+len(b)]) - } else { - s := t.str - start, sep, end, hasExt := t.findTypeForKey(key) - if start == sep { - if hasExt { - b = b[2:] - } - t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:]) - } else { - t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:]) - } - } - return t, nil -} - -// findTypeForKey returns the start and end position for the type corresponding -// to key or the point at which to insert the key-value pair if the type -// wasn't found. The hasExt return value reports whether an -u extension was present. -// Note: the extensions are typically very small and are likely to contain -// only one key-type pair. -func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) { - p := int(t.pExt) - if len(key) != 2 || p == len(t.str) || p == 0 { - return p, p, p, false - } - s := t.str - - // Find the correct extension. - for p++; s[p] != 'u'; p++ { - if s[p] > 'u' { - p-- - return p, p, p, false - } - if p = nextExtension(s, p); p == len(s) { - return len(s), len(s), len(s), false - } - } - // Proceed to the hyphen following the extension name. - p++ - - // curKey is the key currently being processed. - curKey := "" - - // Iterate over keys until we get the end of a section. - for { - end = p - for p++; p < len(s) && s[p] != '-'; p++ { - } - n := p - end - 1 - if n <= 2 && curKey == key { - if sep < end { - sep++ - } - return start, sep, end, true - } - switch n { - case 0, // invalid string - 1: // next extension - return end, end, end, true - case 2: - // next key - curKey = s[end+1 : p] - if curKey > key { - return end, end, end, true - } - start = end - sep = p - } - } -} - -// ParseBase parses a 2- or 3-letter ISO 639 code. -// It returns a ValueError if s is a well-formed but unknown language identifier -// or another error if another error occurred. -func ParseBase(s string) (l Language, err error) { - defer func() { - if recover() != nil { - l = 0 - err = ErrSyntax - } - }() - - if n := len(s); n < 2 || 3 < n { - return 0, ErrSyntax - } - var buf [3]byte - return getLangID(buf[:copy(buf[:], s)]) -} - -// ParseScript parses a 4-letter ISO 15924 code. -// It returns a ValueError if s is a well-formed but unknown script identifier -// or another error if another error occurred. -func ParseScript(s string) (scr Script, err error) { - defer func() { - if recover() != nil { - scr = 0 - err = ErrSyntax - } - }() - - if len(s) != 4 { - return 0, ErrSyntax - } - var buf [4]byte - return getScriptID(script, buf[:copy(buf[:], s)]) -} - -// EncodeM49 returns the Region for the given UN M.49 code. -// It returns an error if r is not a valid code. -func EncodeM49(r int) (Region, error) { - return getRegionM49(r) -} - -// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. -// It returns a ValueError if s is a well-formed but unknown region identifier -// or another error if another error occurred. -func ParseRegion(s string) (r Region, err error) { - defer func() { - if recover() != nil { - r = 0 - err = ErrSyntax - } - }() - - if n := len(s); n < 2 || 3 < n { - return 0, ErrSyntax - } - var buf [3]byte - return getRegionID(buf[:copy(buf[:], s)]) -} - -// IsCountry returns whether this region is a country or autonomous area. This -// includes non-standard definitions from CLDR. -func (r Region) IsCountry() bool { - if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { - return false - } - return true -} - -// IsGroup returns whether this region defines a collection of regions. This -// includes non-standard definitions from CLDR. -func (r Region) IsGroup() bool { - if r == 0 { - return false - } - return int(regionInclusion[r]) < len(regionContainment) -} - -// Contains returns whether Region c is contained by Region r. It returns true -// if c == r. -func (r Region) Contains(c Region) bool { - if r == c { - return true - } - g := regionInclusion[r] - if g >= nRegionGroups { - return false - } - m := regionContainment[g] - - d := regionInclusion[c] - b := regionInclusionBits[d] - - // A contained country may belong to multiple disjoint groups. Matching any - // of these indicates containment. If the contained region is a group, it - // must strictly be a subset. - if d >= nRegionGroups { - return b&m != 0 - } - return b&^m == 0 -} - -var errNoTLD = errors.New("language: region is not a valid ccTLD") - -// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. -// In all other cases it returns either the region itself or an error. -// -// This method may return an error for a region for which there exists a -// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The -// region will already be canonicalized it was obtained from a Tag that was -// obtained using any of the default methods. -func (r Region) TLD() (Region, error) { - // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the - // difference between ISO 3166-1 and IANA ccTLD. - if r == _GB { - r = _UK - } - if (r.typ() & ccTLD) == 0 { - return 0, errNoTLD - } - return r, nil -} - -// Canonicalize returns the region or a possible replacement if the region is -// deprecated. It will not return a replacement for deprecated regions that -// are split into multiple regions. -func (r Region) Canonicalize() Region { - if cr := normRegion(r); cr != 0 { - return cr - } - return r -} - -// Variant represents a registered variant of a language as defined by BCP 47. -type Variant struct { - ID uint8 - str string -} - -// ParseVariant parses and returns a Variant. An error is returned if s is not -// a valid variant. -func ParseVariant(s string) (v Variant, err error) { - defer func() { - if recover() != nil { - v = Variant{} - err = ErrSyntax - } - }() - - s = strings.ToLower(s) - if id, ok := variantIndex[s]; ok { - return Variant{id, s}, nil - } - return Variant{}, NewValueError([]byte(s)) -} - -// String returns the string representation of the variant. -func (v Variant) String() string { - return v.str -} diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go deleted file mode 100644 index 231b4fbdeb..0000000000 --- a/vendor/golang.org/x/text/internal/language/lookup.go +++ /dev/null @@ -1,412 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "bytes" - "fmt" - "sort" - "strconv" - - "golang.org/x/text/internal/tag" -) - -// findIndex tries to find the given tag in idx and returns a standardized error -// if it could not be found. -func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { - if !tag.FixCase(form, key) { - return 0, ErrSyntax - } - i := idx.Index(key) - if i == -1 { - return 0, NewValueError(key) - } - return i, nil -} - -func searchUint(imap []uint16, key uint16) int { - return sort.Search(len(imap), func(i int) bool { - return imap[i] >= key - }) -} - -type Language uint16 - -// getLangID returns the langID of s if s is a canonical subtag -// or langUnknown if s is not a canonical subtag. -func getLangID(s []byte) (Language, error) { - if len(s) == 2 { - return getLangISO2(s) - } - return getLangISO3(s) -} - -// TODO language normalization as well as the AliasMaps could be moved to the -// higher level package, but it is a bit tricky to separate the generation. - -func (id Language) Canonicalize() (Language, AliasType) { - return normLang(id) -} - -// normLang returns the mapped langID of id according to mapping m. -func normLang(id Language) (Language, AliasType) { - k := sort.Search(len(AliasMap), func(i int) bool { - return AliasMap[i].From >= uint16(id) - }) - if k < len(AliasMap) && AliasMap[k].From == uint16(id) { - return Language(AliasMap[k].To), AliasTypes[k] - } - return id, AliasTypeUnknown -} - -// getLangISO2 returns the langID for the given 2-letter ISO language code -// or unknownLang if this does not exist. -func getLangISO2(s []byte) (Language, error) { - if !tag.FixCase("zz", s) { - return 0, ErrSyntax - } - if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { - return Language(i), nil - } - return 0, NewValueError(s) -} - -const base = 'z' - 'a' + 1 - -func strToInt(s []byte) uint { - v := uint(0) - for i := 0; i < len(s); i++ { - v *= base - v += uint(s[i] - 'a') - } - return v -} - -// converts the given integer to the original ASCII string passed to strToInt. -// len(s) must match the number of characters obtained. -func intToStr(v uint, s []byte) { - for i := len(s) - 1; i >= 0; i-- { - s[i] = byte(v%base) + 'a' - v /= base - } -} - -// getLangISO3 returns the langID for the given 3-letter ISO language code -// or unknownLang if this does not exist. -func getLangISO3(s []byte) (Language, error) { - if tag.FixCase("und", s) { - // first try to match canonical 3-letter entries - for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { - if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { - // We treat "und" as special and always translate it to "unspecified". - // Note that ZZ and Zzzz are private use and are not treated as - // unspecified by default. - id := Language(i) - if id == nonCanonicalUnd { - return 0, nil - } - return id, nil - } - } - if i := altLangISO3.Index(s); i != -1 { - return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil - } - n := strToInt(s) - if langNoIndex[n/8]&(1<<(n%8)) != 0 { - return Language(n) + langNoIndexOffset, nil - } - // Check for non-canonical uses of ISO3. - for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { - if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { - return Language(i), nil - } - } - return 0, NewValueError(s) - } - return 0, ErrSyntax -} - -// StringToBuf writes the string to b and returns the number of bytes -// written. cap(b) must be >= 3. -func (id Language) StringToBuf(b []byte) int { - if id >= langNoIndexOffset { - intToStr(uint(id)-langNoIndexOffset, b[:3]) - return 3 - } else if id == 0 { - return copy(b, "und") - } - l := lang[id<<2:] - if l[3] == 0 { - return copy(b, l[:3]) - } - return copy(b, l[:2]) -} - -// String returns the BCP 47 representation of the langID. -// Use b as variable name, instead of id, to ensure the variable -// used is consistent with that of Base in which this type is embedded. -func (b Language) String() string { - if b == 0 { - return "und" - } else if b >= langNoIndexOffset { - b -= langNoIndexOffset - buf := [3]byte{} - intToStr(uint(b), buf[:]) - return string(buf[:]) - } - l := lang.Elem(int(b)) - if l[3] == 0 { - return l[:3] - } - return l[:2] -} - -// ISO3 returns the ISO 639-3 language code. -func (b Language) ISO3() string { - if b == 0 || b >= langNoIndexOffset { - return b.String() - } - l := lang.Elem(int(b)) - if l[3] == 0 { - return l[:3] - } else if l[2] == 0 { - return altLangISO3.Elem(int(l[3]))[:3] - } - // This allocation will only happen for 3-letter ISO codes - // that are non-canonical BCP 47 language identifiers. - return l[0:1] + l[2:4] -} - -// IsPrivateUse reports whether this language code is reserved for private use. -func (b Language) IsPrivateUse() bool { - return langPrivateStart <= b && b <= langPrivateEnd -} - -// SuppressScript returns the script marked as SuppressScript in the IANA -// language tag repository, or 0 if there is no such script. -func (b Language) SuppressScript() Script { - if b < langNoIndexOffset { - return Script(suppressScript[b]) - } - return 0 -} - -type Region uint16 - -// getRegionID returns the region id for s if s is a valid 2-letter region code -// or unknownRegion. -func getRegionID(s []byte) (Region, error) { - if len(s) == 3 { - if isAlpha(s[0]) { - return getRegionISO3(s) - } - if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { - return getRegionM49(int(i)) - } - } - return getRegionISO2(s) -} - -// getRegionISO2 returns the regionID for the given 2-letter ISO country code -// or unknownRegion if this does not exist. -func getRegionISO2(s []byte) (Region, error) { - i, err := findIndex(regionISO, s, "ZZ") - if err != nil { - return 0, err - } - return Region(i) + isoRegionOffset, nil -} - -// getRegionISO3 returns the regionID for the given 3-letter ISO country code -// or unknownRegion if this does not exist. -func getRegionISO3(s []byte) (Region, error) { - if tag.FixCase("ZZZ", s) { - for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { - if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { - return Region(i) + isoRegionOffset, nil - } - } - for i := 0; i < len(altRegionISO3); i += 3 { - if tag.Compare(altRegionISO3[i:i+3], s) == 0 { - return Region(altRegionIDs[i/3]), nil - } - } - return 0, NewValueError(s) - } - return 0, ErrSyntax -} - -func getRegionM49(n int) (Region, error) { - if 0 < n && n <= 999 { - const ( - searchBits = 7 - regionBits = 9 - regionMask = 1<> searchBits - buf := fromM49[m49Index[idx]:m49Index[idx+1]] - val := uint16(n) << regionBits // we rely on bits shifting out - i := sort.Search(len(buf), func(i int) bool { - return buf[i] >= val - }) - if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { - return Region(r & regionMask), nil - } - } - var e ValueError - fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) - return 0, e -} - -// normRegion returns a region if r is deprecated or 0 otherwise. -// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). -// TODO: consider mapping split up regions to new most populous one (like CLDR). -func normRegion(r Region) Region { - m := regionOldMap - k := sort.Search(len(m), func(i int) bool { - return m[i].From >= uint16(r) - }) - if k < len(m) && m[k].From == uint16(r) { - return Region(m[k].To) - } - return 0 -} - -const ( - iso3166UserAssigned = 1 << iota - ccTLD - bcp47Region -) - -func (r Region) typ() byte { - return regionTypes[r] -} - -// String returns the BCP 47 representation for the region. -// It returns "ZZ" for an unspecified region. -func (r Region) String() string { - if r < isoRegionOffset { - if r == 0 { - return "ZZ" - } - return fmt.Sprintf("%03d", r.M49()) - } - r -= isoRegionOffset - return regionISO.Elem(int(r))[:2] -} - -// ISO3 returns the 3-letter ISO code of r. -// Note that not all regions have a 3-letter ISO code. -// In such cases this method returns "ZZZ". -func (r Region) ISO3() string { - if r < isoRegionOffset { - return "ZZZ" - } - r -= isoRegionOffset - reg := regionISO.Elem(int(r)) - switch reg[2] { - case 0: - return altRegionISO3[reg[3]:][:3] - case ' ': - return "ZZZ" - } - return reg[0:1] + reg[2:4] -} - -// M49 returns the UN M.49 encoding of r, or 0 if this encoding -// is not defined for r. -func (r Region) M49() int { - return int(m49[r]) -} - -// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This -// may include private-use tags that are assigned by CLDR and used in this -// implementation. So IsPrivateUse and IsCountry can be simultaneously true. -func (r Region) IsPrivateUse() bool { - return r.typ()&iso3166UserAssigned != 0 -} - -type Script uint16 - -// getScriptID returns the script id for string s. It assumes that s -// is of the format [A-Z][a-z]{3}. -func getScriptID(idx tag.Index, s []byte) (Script, error) { - i, err := findIndex(idx, s, "Zzzz") - return Script(i), err -} - -// String returns the script code in title case. -// It returns "Zzzz" for an unspecified script. -func (s Script) String() string { - if s == 0 { - return "Zzzz" - } - return script.Elem(int(s)) -} - -// IsPrivateUse reports whether this script code is reserved for private use. -func (s Script) IsPrivateUse() bool { - return _Qaaa <= s && s <= _Qabx -} - -const ( - maxAltTaglen = len("en-US-POSIX") - maxLen = maxAltTaglen -) - -var ( - // grandfatheredMap holds a mapping from legacy and grandfathered tags to - // their base language or index to more elaborate tag. - grandfatheredMap = map[[maxLen]byte]int16{ - [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban - [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami - [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn - [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak - [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon - [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux - [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo - [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn - [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao - [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay - [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu - [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok - [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn - [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR - [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL - [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE - [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu - [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka - [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan - [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang - - // Grandfathered tags with no modern replacement will be converted as - // follows: - [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish - [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed - [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default - [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian - [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo - [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min - - // CLDR-specific tag. - [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root - [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" - } - - altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} - - altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" -) - -func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { - if v, ok := grandfatheredMap[s]; ok { - if v < 0 { - return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true - } - t.LangID = Language(v) - return t, true - } - return t, false -} diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go deleted file mode 100644 index 75a2dbca76..0000000000 --- a/vendor/golang.org/x/text/internal/language/match.go +++ /dev/null @@ -1,226 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import "errors" - -type scriptRegionFlags uint8 - -const ( - isList = 1 << iota - scriptInFrom - regionInFrom -) - -func (t *Tag) setUndefinedLang(id Language) { - if t.LangID == 0 { - t.LangID = id - } -} - -func (t *Tag) setUndefinedScript(id Script) { - if t.ScriptID == 0 { - t.ScriptID = id - } -} - -func (t *Tag) setUndefinedRegion(id Region) { - if t.RegionID == 0 || t.RegionID.Contains(id) { - t.RegionID = id - } -} - -// ErrMissingLikelyTagsData indicates no information was available -// to compute likely values of missing tags. -var ErrMissingLikelyTagsData = errors.New("missing likely tags data") - -// addLikelySubtags sets subtags to their most likely value, given the locale. -// In most cases this means setting fields for unknown values, but in some -// cases it may alter a value. It returns an ErrMissingLikelyTagsData error -// if the given locale cannot be expanded. -func (t Tag) addLikelySubtags() (Tag, error) { - id, err := addTags(t) - if err != nil { - return t, err - } else if id.equalTags(t) { - return t, nil - } - id.RemakeString() - return id, nil -} - -// specializeRegion attempts to specialize a group region. -func specializeRegion(t *Tag) bool { - if i := regionInclusion[t.RegionID]; i < nRegionGroups { - x := likelyRegionGroup[i] - if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { - t.RegionID = Region(x.region) - } - return true - } - return false -} - -// Maximize returns a new tag with missing tags filled in. -func (t Tag) Maximize() (Tag, error) { - return addTags(t) -} - -func addTags(t Tag) (Tag, error) { - // We leave private use identifiers alone. - if t.IsPrivateUse() { - return t, nil - } - if t.ScriptID != 0 && t.RegionID != 0 { - if t.LangID != 0 { - // already fully specified - specializeRegion(&t) - return t, nil - } - // Search matches for und-script-region. Note that for these cases - // region will never be a group so there is no need to check for this. - list := likelyRegion[t.RegionID : t.RegionID+1] - if x := list[0]; x.flags&isList != 0 { - list = likelyRegionList[x.lang : x.lang+uint16(x.script)] - } - for _, x := range list { - // Deviating from the spec. See match_test.go for details. - if Script(x.script) == t.ScriptID { - t.setUndefinedLang(Language(x.lang)) - return t, nil - } - } - } - if t.LangID != 0 { - // Search matches for lang-script and lang-region, where lang != und. - if t.LangID < langNoIndexOffset { - x := likelyLang[t.LangID] - if x.flags&isList != 0 { - list := likelyLangList[x.region : x.region+uint16(x.script)] - if t.ScriptID != 0 { - for _, x := range list { - if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { - t.setUndefinedRegion(Region(x.region)) - return t, nil - } - } - } else if t.RegionID != 0 { - count := 0 - goodScript := true - tt := t - for _, x := range list { - // We visit all entries for which the script was not - // defined, including the ones where the region was not - // defined. This allows for proper disambiguation within - // regions. - if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { - tt.RegionID = Region(x.region) - tt.setUndefinedScript(Script(x.script)) - goodScript = goodScript && tt.ScriptID == Script(x.script) - count++ - } - } - if count == 1 { - return tt, nil - } - // Even if we fail to find a unique Region, we might have - // an unambiguous script. - if goodScript { - t.ScriptID = tt.ScriptID - } - } - } - } - } else { - // Search matches for und-script. - if t.ScriptID != 0 { - x := likelyScript[t.ScriptID] - if x.region != 0 { - t.setUndefinedRegion(Region(x.region)) - t.setUndefinedLang(Language(x.lang)) - return t, nil - } - } - // Search matches for und-region. If und-script-region exists, it would - // have been found earlier. - if t.RegionID != 0 { - if i := regionInclusion[t.RegionID]; i < nRegionGroups { - x := likelyRegionGroup[i] - if x.region != 0 { - t.setUndefinedLang(Language(x.lang)) - t.setUndefinedScript(Script(x.script)) - t.RegionID = Region(x.region) - } - } else { - x := likelyRegion[t.RegionID] - if x.flags&isList != 0 { - x = likelyRegionList[x.lang] - } - if x.script != 0 && x.flags != scriptInFrom { - t.setUndefinedLang(Language(x.lang)) - t.setUndefinedScript(Script(x.script)) - return t, nil - } - } - } - } - - // Search matches for lang. - if t.LangID < langNoIndexOffset { - x := likelyLang[t.LangID] - if x.flags&isList != 0 { - x = likelyLangList[x.region] - } - if x.region != 0 { - t.setUndefinedScript(Script(x.script)) - t.setUndefinedRegion(Region(x.region)) - } - specializeRegion(&t) - if t.LangID == 0 { - t.LangID = _en // default language - } - return t, nil - } - return t, ErrMissingLikelyTagsData -} - -func (t *Tag) setTagsFrom(id Tag) { - t.LangID = id.LangID - t.ScriptID = id.ScriptID - t.RegionID = id.RegionID -} - -// minimize removes the region or script subtags from t such that -// t.addLikelySubtags() == t.minimize().addLikelySubtags(). -func (t Tag) minimize() (Tag, error) { - t, err := minimizeTags(t) - if err != nil { - return t, err - } - t.RemakeString() - return t, nil -} - -// minimizeTags mimics the behavior of the ICU 51 C implementation. -func minimizeTags(t Tag) (Tag, error) { - if t.equalTags(Und) { - return t, nil - } - max, err := addTags(t) - if err != nil { - return t, err - } - for _, id := range [...]Tag{ - {LangID: t.LangID}, - {LangID: t.LangID, RegionID: t.RegionID}, - {LangID: t.LangID, ScriptID: t.ScriptID}, - } { - if x, err := addTags(id); err == nil && max.equalTags(x) { - t.setTagsFrom(id) - break - } - } - return t, nil -} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go deleted file mode 100644 index aad1e0acf7..0000000000 --- a/vendor/golang.org/x/text/internal/language/parse.go +++ /dev/null @@ -1,608 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "bytes" - "errors" - "fmt" - "sort" - - "golang.org/x/text/internal/tag" -) - -// isAlpha returns true if the byte is not a digit. -// b must be an ASCII letter or digit. -func isAlpha(b byte) bool { - return b > '9' -} - -// isAlphaNum returns true if the string contains only ASCII letters or digits. -func isAlphaNum(s []byte) bool { - for _, c := range s { - if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { - return false - } - } - return true -} - -// ErrSyntax is returned by any of the parsing functions when the -// input is not well-formed, according to BCP 47. -// TODO: return the position at which the syntax error occurred? -var ErrSyntax = errors.New("language: tag is not well-formed") - -// ErrDuplicateKey is returned when a tag contains the same key twice with -// different values in the -u section. -var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") - -// ValueError is returned by any of the parsing functions when the -// input is well-formed but the respective subtag is not recognized -// as a valid value. -type ValueError struct { - v [8]byte -} - -// NewValueError creates a new ValueError. -func NewValueError(tag []byte) ValueError { - var e ValueError - copy(e.v[:], tag) - return e -} - -func (e ValueError) tag() []byte { - n := bytes.IndexByte(e.v[:], 0) - if n == -1 { - n = 8 - } - return e.v[:n] -} - -// Error implements the error interface. -func (e ValueError) Error() string { - return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) -} - -// Subtag returns the subtag for which the error occurred. -func (e ValueError) Subtag() string { - return string(e.tag()) -} - -// scanner is used to scan BCP 47 tokens, which are separated by _ or -. -type scanner struct { - b []byte - bytes [max99thPercentileSize]byte - token []byte - start int // start position of the current token - end int // end position of the current token - next int // next point for scan - err error - done bool -} - -func makeScannerString(s string) scanner { - scan := scanner{} - if len(s) <= len(scan.bytes) { - scan.b = scan.bytes[:copy(scan.bytes[:], s)] - } else { - scan.b = []byte(s) - } - scan.init() - return scan -} - -// makeScanner returns a scanner using b as the input buffer. -// b is not copied and may be modified by the scanner routines. -func makeScanner(b []byte) scanner { - scan := scanner{b: b} - scan.init() - return scan -} - -func (s *scanner) init() { - for i, c := range s.b { - if c == '_' { - s.b[i] = '-' - } - } - s.scan() -} - -// restToLower converts the string between start and end to lower case. -func (s *scanner) toLower(start, end int) { - for i := start; i < end; i++ { - c := s.b[i] - if 'A' <= c && c <= 'Z' { - s.b[i] += 'a' - 'A' - } - } -} - -func (s *scanner) setError(e error) { - if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { - s.err = e - } -} - -// resizeRange shrinks or grows the array at position oldStart such that -// a new string of size newSize can fit between oldStart and oldEnd. -// Sets the scan point to after the resized range. -func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { - s.start = oldStart - if end := oldStart + newSize; end != oldEnd { - diff := end - oldEnd - var b []byte - if n := len(s.b) + diff; n > cap(s.b) { - b = make([]byte, n) - copy(b, s.b[:oldStart]) - } else { - b = s.b[:n] - } - copy(b[end:], s.b[oldEnd:]) - s.b = b - s.next = end + (s.next - s.end) - s.end = end - } -} - -// replace replaces the current token with repl. -func (s *scanner) replace(repl string) { - s.resizeRange(s.start, s.end, len(repl)) - copy(s.b[s.start:], repl) -} - -// gobble removes the current token from the input. -// Caller must call scan after calling gobble. -func (s *scanner) gobble(e error) { - s.setError(e) - if s.start == 0 { - s.b = s.b[:+copy(s.b, s.b[s.next:])] - s.end = 0 - } else { - s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] - s.end = s.start - 1 - } - s.next = s.start -} - -// deleteRange removes the given range from s.b before the current token. -func (s *scanner) deleteRange(start, end int) { - s.b = s.b[:start+copy(s.b[start:], s.b[end:])] - diff := end - start - s.next -= diff - s.start -= diff - s.end -= diff -} - -// scan parses the next token of a BCP 47 string. Tokens that are larger -// than 8 characters or include non-alphanumeric characters result in an error -// and are gobbled and removed from the output. -// It returns the end position of the last token consumed. -func (s *scanner) scan() (end int) { - end = s.end - s.token = nil - for s.start = s.next; s.next < len(s.b); { - i := bytes.IndexByte(s.b[s.next:], '-') - if i == -1 { - s.end = len(s.b) - s.next = len(s.b) - i = s.end - s.start - } else { - s.end = s.next + i - s.next = s.end + 1 - } - token := s.b[s.start:s.end] - if i < 1 || i > 8 || !isAlphaNum(token) { - s.gobble(ErrSyntax) - continue - } - s.token = token - return end - } - if n := len(s.b); n > 0 && s.b[n-1] == '-' { - s.setError(ErrSyntax) - s.b = s.b[:len(s.b)-1] - } - s.done = true - return end -} - -// acceptMinSize parses multiple tokens of the given size or greater. -// It returns the end position of the last token consumed. -func (s *scanner) acceptMinSize(min int) (end int) { - end = s.end - s.scan() - for ; len(s.token) >= min; s.scan() { - end = s.end - } - return end -} - -// Parse parses the given BCP 47 string and returns a valid Tag. If parsing -// failed it returns an error and any part of the tag that could be parsed. -// If parsing succeeded but an unknown value was found, it returns -// ValueError. The Tag returned in this case is just stripped of the unknown -// value. All other values are preserved. It accepts tags in the BCP 47 format -// and extensions to this standard defined in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -func Parse(s string) (t Tag, err error) { - // TODO: consider supporting old-style locale key-value pairs. - if s == "" { - return Und, ErrSyntax - } - defer func() { - if recover() != nil { - t = Und - err = ErrSyntax - return - } - }() - if len(s) <= maxAltTaglen { - b := [maxAltTaglen]byte{} - for i, c := range s { - // Generating invalid UTF-8 is okay as it won't match. - if 'A' <= c && c <= 'Z' { - c += 'a' - 'A' - } else if c == '_' { - c = '-' - } - b[i] = byte(c) - } - if t, ok := grandfathered(b); ok { - return t, nil - } - } - scan := makeScannerString(s) - return parse(&scan, s) -} - -func parse(scan *scanner, s string) (t Tag, err error) { - t = Und - var end int - if n := len(scan.token); n <= 1 { - scan.toLower(0, len(scan.b)) - if n == 0 || scan.token[0] != 'x' { - return t, ErrSyntax - } - end = parseExtensions(scan) - } else if n >= 4 { - return Und, ErrSyntax - } else { // the usual case - t, end = parseTag(scan, true) - if n := len(scan.token); n == 1 { - t.pExt = uint16(end) - end = parseExtensions(scan) - } else if end < len(scan.b) { - scan.setError(ErrSyntax) - scan.b = scan.b[:end] - } - } - if int(t.pVariant) < len(scan.b) { - if end < len(s) { - s = s[:end] - } - if len(s) > 0 && tag.Compare(s, scan.b) == 0 { - t.str = s - } else { - t.str = string(scan.b) - } - } else { - t.pVariant, t.pExt = 0, 0 - } - return t, scan.err -} - -// parseTag parses language, script, region and variants. -// It returns a Tag and the end position in the input that was parsed. -// If doNorm is true, then - will be normalized to . -func parseTag(scan *scanner, doNorm bool) (t Tag, end int) { - var e error - // TODO: set an error if an unknown lang, script or region is encountered. - t.LangID, e = getLangID(scan.token) - scan.setError(e) - scan.replace(t.LangID.String()) - langStart := scan.start - end = scan.scan() - for len(scan.token) == 3 && isAlpha(scan.token[0]) { - // From http://tools.ietf.org/html/bcp47, - tags are equivalent - // to a tag of the form . - if doNorm { - lang, e := getLangID(scan.token) - if lang != 0 { - t.LangID = lang - langStr := lang.String() - copy(scan.b[langStart:], langStr) - scan.b[langStart+len(langStr)] = '-' - scan.start = langStart + len(langStr) + 1 - } - scan.gobble(e) - } - end = scan.scan() - } - if len(scan.token) == 4 && isAlpha(scan.token[0]) { - t.ScriptID, e = getScriptID(script, scan.token) - if t.ScriptID == 0 { - scan.gobble(e) - } - end = scan.scan() - } - if n := len(scan.token); n >= 2 && n <= 3 { - t.RegionID, e = getRegionID(scan.token) - if t.RegionID == 0 { - scan.gobble(e) - } else { - scan.replace(t.RegionID.String()) - } - end = scan.scan() - } - scan.toLower(scan.start, len(scan.b)) - t.pVariant = byte(end) - end = parseVariants(scan, end, t) - t.pExt = uint16(end) - return t, end -} - -var separator = []byte{'-'} - -// parseVariants scans tokens as long as each token is a valid variant string. -// Duplicate variants are removed. -func parseVariants(scan *scanner, end int, t Tag) int { - start := scan.start - varIDBuf := [4]uint8{} - variantBuf := [4][]byte{} - varID := varIDBuf[:0] - variant := variantBuf[:0] - last := -1 - needSort := false - for ; len(scan.token) >= 4; scan.scan() { - // TODO: measure the impact of needing this conversion and redesign - // the data structure if there is an issue. - v, ok := variantIndex[string(scan.token)] - if !ok { - // unknown variant - // TODO: allow user-defined variants? - scan.gobble(NewValueError(scan.token)) - continue - } - varID = append(varID, v) - variant = append(variant, scan.token) - if !needSort { - if last < int(v) { - last = int(v) - } else { - needSort = true - // There is no legal combinations of more than 7 variants - // (and this is by no means a useful sequence). - const maxVariants = 8 - if len(varID) > maxVariants { - break - } - } - } - end = scan.end - } - if needSort { - sort.Sort(variantsSort{varID, variant}) - k, l := 0, -1 - for i, v := range varID { - w := int(v) - if l == w { - // Remove duplicates. - continue - } - varID[k] = varID[i] - variant[k] = variant[i] - k++ - l = w - } - if str := bytes.Join(variant[:k], separator); len(str) == 0 { - end = start - 1 - } else { - scan.resizeRange(start, end, len(str)) - copy(scan.b[scan.start:], str) - end = scan.end - } - } - return end -} - -type variantsSort struct { - i []uint8 - v [][]byte -} - -func (s variantsSort) Len() int { - return len(s.i) -} - -func (s variantsSort) Swap(i, j int) { - s.i[i], s.i[j] = s.i[j], s.i[i] - s.v[i], s.v[j] = s.v[j], s.v[i] -} - -func (s variantsSort) Less(i, j int) bool { - return s.i[i] < s.i[j] -} - -type bytesSort struct { - b [][]byte - n int // first n bytes to compare -} - -func (b bytesSort) Len() int { - return len(b.b) -} - -func (b bytesSort) Swap(i, j int) { - b.b[i], b.b[j] = b.b[j], b.b[i] -} - -func (b bytesSort) Less(i, j int) bool { - for k := 0; k < b.n; k++ { - if b.b[i][k] == b.b[j][k] { - continue - } - return b.b[i][k] < b.b[j][k] - } - return false -} - -// parseExtensions parses and normalizes the extensions in the buffer. -// It returns the last position of scan.b that is part of any extension. -// It also trims scan.b to remove excess parts accordingly. -func parseExtensions(scan *scanner) int { - start := scan.start - exts := [][]byte{} - private := []byte{} - end := scan.end - for len(scan.token) == 1 { - extStart := scan.start - ext := scan.token[0] - end = parseExtension(scan) - extension := scan.b[extStart:end] - if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { - scan.setError(ErrSyntax) - end = extStart - continue - } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { - scan.b = scan.b[:end] - return end - } else if ext == 'x' { - private = extension - break - } - exts = append(exts, extension) - } - sort.Sort(bytesSort{exts, 1}) - if len(private) > 0 { - exts = append(exts, private) - } - scan.b = scan.b[:start] - if len(exts) > 0 { - scan.b = append(scan.b, bytes.Join(exts, separator)...) - } else if start > 0 { - // Strip trailing '-'. - scan.b = scan.b[:start-1] - } - return end -} - -// parseExtension parses a single extension and returns the position of -// the extension end. -func parseExtension(scan *scanner) int { - start, end := scan.start, scan.end - switch scan.token[0] { - case 'u': // https://www.ietf.org/rfc/rfc6067.txt - attrStart := end - scan.scan() - for last := []byte{}; len(scan.token) > 2; scan.scan() { - if bytes.Compare(scan.token, last) != -1 { - // Attributes are unsorted. Start over from scratch. - p := attrStart + 1 - scan.next = p - attrs := [][]byte{} - for scan.scan(); len(scan.token) > 2; scan.scan() { - attrs = append(attrs, scan.token) - end = scan.end - } - sort.Sort(bytesSort{attrs, 3}) - copy(scan.b[p:], bytes.Join(attrs, separator)) - break - } - last = scan.token - end = scan.end - } - // Scan key-type sequences. A key is of length 2 and may be followed - // by 0 or more "type" subtags from 3 to the maximum of 8 letters. - var last, key []byte - for attrEnd := end; len(scan.token) == 2; last = key { - key = scan.token - end = scan.end - for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { - end = scan.end - } - // TODO: check key value validity - if bytes.Compare(key, last) != 1 || scan.err != nil { - // We have an invalid key or the keys are not sorted. - // Start scanning keys from scratch and reorder. - p := attrEnd + 1 - scan.next = p - keys := [][]byte{} - for scan.scan(); len(scan.token) == 2; { - keyStart := scan.start - end = scan.end - for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { - end = scan.end - } - keys = append(keys, scan.b[keyStart:end]) - } - sort.Stable(bytesSort{keys, 2}) - if n := len(keys); n > 0 { - k := 0 - for i := 1; i < n; i++ { - if !bytes.Equal(keys[k][:2], keys[i][:2]) { - k++ - keys[k] = keys[i] - } else if !bytes.Equal(keys[k], keys[i]) { - scan.setError(ErrDuplicateKey) - } - } - keys = keys[:k+1] - } - reordered := bytes.Join(keys, separator) - if e := p + len(reordered); e < end { - scan.deleteRange(e, end) - end = e - } - copy(scan.b[p:], reordered) - break - } - } - case 't': // https://www.ietf.org/rfc/rfc6497.txt - scan.scan() - if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { - _, end = parseTag(scan, false) - scan.toLower(start, end) - } - for len(scan.token) == 2 && !isAlpha(scan.token[1]) { - end = scan.acceptMinSize(3) - } - case 'x': - end = scan.acceptMinSize(1) - default: - end = scan.acceptMinSize(2) - } - return end -} - -// getExtension returns the name, body and end position of the extension. -func getExtension(s string, p int) (end int, ext string) { - if s[p] == '-' { - p++ - } - if s[p] == 'x' { - return len(s), s[p:] - } - end = nextExtension(s, p) - return end, s[p:end] -} - -// nextExtension finds the next extension within the string, searching -// for the -- pattern from position p. -// In the fast majority of cases, language tags will have at most -// one extension and extensions tend to be small. -func nextExtension(s string, p int) int { - for n := len(s) - 3; p < n; { - if s[p] == '-' { - if s[p+2] == '-' { - return p - } - p += 3 - } else { - p++ - } - } - return len(s) -} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go deleted file mode 100644 index fb6b58378b..0000000000 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ /dev/null @@ -1,3472 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -import "golang.org/x/text/internal/tag" - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "32" - -const NumLanguages = 8752 - -const NumScripts = 258 - -const NumRegions = 357 - -type FromTo struct { - From uint16 - To uint16 -} - -const nonCanonicalUnd = 1201 -const ( - _af = 22 - _am = 39 - _ar = 58 - _az = 88 - _bg = 126 - _bn = 165 - _ca = 215 - _cs = 250 - _da = 257 - _de = 269 - _el = 310 - _en = 313 - _es = 318 - _et = 320 - _fa = 328 - _fi = 337 - _fil = 339 - _fr = 350 - _gu = 420 - _he = 444 - _hi = 446 - _hr = 465 - _hu = 469 - _hy = 471 - _id = 481 - _is = 504 - _it = 505 - _ja = 512 - _ka = 528 - _kk = 578 - _km = 586 - _kn = 593 - _ko = 596 - _ky = 650 - _lo = 696 - _lt = 704 - _lv = 711 - _mk = 767 - _ml = 772 - _mn = 779 - _mo = 784 - _mr = 795 - _ms = 799 - _mul = 806 - _my = 817 - _nb = 839 - _ne = 849 - _nl = 871 - _no = 879 - _pa = 925 - _pl = 947 - _pt = 960 - _ro = 988 - _ru = 994 - _sh = 1031 - _si = 1036 - _sk = 1042 - _sl = 1046 - _sq = 1073 - _sr = 1074 - _sv = 1092 - _sw = 1093 - _ta = 1104 - _te = 1121 - _th = 1131 - _tl = 1146 - _tn = 1152 - _tr = 1162 - _uk = 1198 - _ur = 1204 - _uz = 1212 - _vi = 1219 - _zh = 1321 - _zu = 1327 - _jbo = 515 - _ami = 1650 - _bnn = 2357 - _hak = 438 - _tlh = 14467 - _lb = 661 - _nv = 899 - _pwn = 12055 - _tao = 14188 - _tay = 14198 - _tsu = 14662 - _nn = 874 - _sfb = 13629 - _vgt = 15701 - _sgg = 13660 - _cmn = 3007 - _nan = 835 - _hsn = 467 -) - -const langPrivateStart = 0x2f72 - -const langPrivateEnd = 0x3179 - -// lang holds an alphabetically sorted list of ISO-639 language identifiers. -// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -// For 2-byte language identifiers, the two successive bytes have the following meaning: -// - if the first letter of the 2- and 3-letter ISO codes are the same: -// the second and third letter of the 3-letter ISO code. -// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -// -// For 3-byte language identifiers the 4th byte is 0. -const lang tag.Index = "" + // Size: 5324 bytes - "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + - "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + - "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + - "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + - "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + - "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + - "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + - "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + - "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + - "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + - "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + - "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + - "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + - "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + - "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + - "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + - "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + - "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + - "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + - "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + - "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + - "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + - "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + - "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + - "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + - "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + - "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + - "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + - "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + - "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + - "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + - "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + - "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + - "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + - "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + - "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + - "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + - "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + - "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + - "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + - "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + - "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + - "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + - "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + - "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + - "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + - "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + - "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + - "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + - "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + - "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + - "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + - "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + - "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + - "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + - "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + - "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + - "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + - "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + - "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + - "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + - "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + - "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + - "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + - "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + - "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + - "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + - "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + - "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + - "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + - "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + - "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + - "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + - "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + - "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + - "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + - "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + - "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + - "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + - "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + - "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + - "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + - "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + - "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + - "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + - "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + - "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + - "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + - "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + - "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + - "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + - "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + - "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + - "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + - "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + - "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + - "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + - "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + - "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + - "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + - "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + - "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + - "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + - "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + - "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + - "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + - "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + - "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + - "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + - "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + - "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + - "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + - "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + - "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + - "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + - "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + - "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + - "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + - "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + - "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + - "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + - "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + - "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + - "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" - -const langNoIndexOffset = 1330 - -// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -// in lookup tables. The language ids for these language codes are derived directly -// from the letters and are not consecutive. -// Size: 2197 bytes, 2197 elements -var langNoIndex = [2197]uint8{ - // Entry 0 - 3F - 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, - 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, - 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, - 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, - 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, - 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, - 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, - // Entry 40 - 7F - 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, - 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, - 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, - 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, - 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, - 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, - 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, - 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, - // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, - 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, - 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, - 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, - 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, - 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, - 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, - 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, - // Entry C0 - FF - 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, - 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, - 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, - 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, - // Entry 100 - 13F - 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, - 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, - 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, - 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c, - 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, - 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, - 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, - // Entry 140 - 17F - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, - 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, - 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, - 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, - 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, - // Entry 180 - 1BF - 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, - 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, - 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, - 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, - 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, - // Entry 200 - 23F - 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, - 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, - 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, - 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, - 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, - 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, - // Entry 240 - 27F - 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0, - 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, - 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, - 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, - 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, - // Entry 280 - 2BF - 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, - 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, - 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, - 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, - 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, - 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, - 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, - // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, - 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, - 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, - 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, - 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, - 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, - // Entry 300 - 33F - 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, - 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, - 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, - 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0, - 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, - 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, - 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, - // Entry 340 - 37F - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, - 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, - 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, - 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, - 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, - 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, - 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, - 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, - // Entry 380 - 3BF - 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, - 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, - 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, - 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, - 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, - 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, - 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, - // Entry 3C0 - 3FF - 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, - 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, - 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, - 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, - 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, - // Entry 400 - 43F - 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, - 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, - 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, - 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, - 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, - 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, - 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, - 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, - // Entry 440 - 47F - 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, - 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, - 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, - 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, - 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, - 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd, - 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, - 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, - // Entry 480 - 4BF - 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, - 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, - 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, - 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, - // Entry 4C0 - 4FF - 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, - 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7, - 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, - 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, - 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, - // Entry 500 - 53F - 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, - 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, - 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, - 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, - 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, - 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, - 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, - // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - // Entry 580 - 5BF - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, - 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, - 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, - 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, - 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, - 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, - // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, - 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, - 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, - 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, - 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, - // Entry 600 - 63F - 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, - 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, - 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, - 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, - 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f, - 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, - 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18, - 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, - // Entry 640 - 67F - 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, - 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, - 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98, - 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, - 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, - 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, - 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, - // Entry 680 - 6BF - 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, - 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, - 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, - 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, - 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, - // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, - 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, - 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, - 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, - 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, - // Entry 700 - 73F - 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, - 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, - 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, - 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 740 - 77F - 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, - 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, - 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, - 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, - 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03, - 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, - // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, - 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, - 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, - 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, - 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, - // Entry 7C0 - 7FF - 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42, - 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, - 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, - 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, - 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, - 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, - 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, - // Entry 800 - 83F - 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, - 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, - 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, - 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, - 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, - 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, - 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, - // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, - 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, - 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, - 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, - 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, - 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, - // Entry 880 - 8BF - 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, - 0x0a, 0x00, 0x80, 0x00, 0x00, -} - -// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -// to 2-letter language codes that cannot be derived using the method described above. -// Each 3-letter code is followed by its 1-byte langID. -const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" - -// altLangIndex is used to convert indexes in altLangISO3 to langIDs. -// Size: 12 bytes, 6 elements -var altLangIndex = [6]uint16{ - 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, -} - -// AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ - 0: {From: 0x82, To: 0x88}, - 1: {From: 0x187, To: 0x1ae}, - 2: {From: 0x1f3, To: 0x1e1}, - 3: {From: 0x1fb, To: 0x1bc}, - 4: {From: 0x208, To: 0x512}, - 5: {From: 0x20f, To: 0x20e}, - 6: {From: 0x310, To: 0x3dc}, - 7: {From: 0x347, To: 0x36f}, - 8: {From: 0x407, To: 0x432}, - 9: {From: 0x47a, To: 0x153}, - 10: {From: 0x490, To: 0x451}, - 11: {From: 0x4a2, To: 0x21}, - 12: {From: 0x53e, To: 0x544}, - 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, -} - -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ - // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, - // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, - // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, -} - -const ( - _Latn = 90 - _Hani = 57 - _Hans = 59 - _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 -) - -// script is an alphabetically sorted list of ISO 15924 codes. The index -// of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes - "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + - "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + - "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + - "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" - -// suppressScript is an index from langID to the dominant script for that language, -// if it exists. If a script is given, it should be suppressed from the language tag. -// Size: 1330 bytes, 1330 elements -var suppressScript = [1330]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 40 - 7F - 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, - // Entry 80 - BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry C0 - FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, - // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 180 - 1BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, - // Entry 200 - 23F - 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 280 - 2BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, - // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, - // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 500 - 53F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, -} - -const ( - _001 = 1 - _419 = 31 - _BR = 65 - _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 -) - -// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -// the UN.M49 codes used for groups.) -const isoRegionOffset = 32 - -// regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 40 - 7F - 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 80 - BF - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, -} - -// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -// Each 2-letter codes is followed by two bytes with the following meaning: -// - [A-Z}{2}: the first letter of the 2-letter code plus these two -// letters form the 3-letter ISO code. -// - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes - "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + - "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + - "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" - -// altRegionISO3 holds a list of 3-letter region codes that cannot be -// mapped to 2-letter codes using the default algorithm. This is a short list. -const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" - -// altRegionIDs holds a list of regionIDs the positions of which match those -// of the 3-letter ISO codes in altRegionISO3. -// Size: 22 bytes, 11 elements -var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, -} - -// Size: 80 bytes, 20 elements -var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, -} - -// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -// codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ - // Entry 0 - 3F - 0, 1, 2, 3, 5, 9, 11, 13, - 14, 15, 17, 18, 19, 21, 29, 30, - 34, 35, 39, 53, 54, 57, 61, 142, - 143, 145, 150, 151, 154, 155, 202, 419, - 958, 0, 20, 784, 4, 28, 660, 8, - 51, 530, 24, 10, 32, 16, 40, 36, - 533, 248, 31, 70, 52, 50, 56, 854, - 100, 48, 108, 204, 652, 60, 96, 68, - // Entry 40 - 7F - 535, 76, 44, 64, 104, 74, 72, 112, - 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, - // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, - // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, - // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, - // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, -} - -// m49Index gives indexes into fromM49 based on the three most significant bits -// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in -// -// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -// -// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -// The region code is stored in the 9 lsb of the indexed value. -// Size: 18 bytes, 9 elements -var m49Index = [9]int16{ - 0, 59, 108, 143, 181, 220, 259, 291, - 333, -} - -// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. -// Size: 666 bytes, 333 elements -var fromM49 = [333]uint16{ - // Entry 0 - 3F - 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, - 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, - 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, - 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, - 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, - // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, - // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, - // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, - // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, - // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, -} - -// Size: 2014 bytes -var variantIndex = map[string]uint8{ - "1606nict": 0x0, - "1694acad": 0x1, - "1901": 0x2, - "1959acad": 0x3, - "1994": 0x61, - "1996": 0x4, - "abl1943": 0x5, - "akuapem": 0x6, - "alalc97": 0x63, - "aluku": 0x7, - "ao1990": 0x8, - "aranes": 0x9, - "arevela": 0xa, - "arevmda": 0xb, - "arkaika": 0xc, - "asante": 0xd, - "auvern": 0xe, - "baku1926": 0xf, - "balanka": 0x10, - "barla": 0x11, - "basiceng": 0x12, - "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, -} - -// variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 - -// nRegionGroups is the number of region groups. -const nRegionGroups = 33 - -type likelyLangRegion struct { - lang uint16 - region uint16 -} - -// likelyScript is a lookup table, indexed by scriptID, for the most likely -// languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, - 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, - 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, - 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, - 22: {lang: 0xdb, region: 0x35}, - 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, - 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, - 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, - 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, - 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, -} - -type likelyScriptRegion struct { - region uint16 - script uint16 - flags uint8 -} - -// likelyLang is a lookup table, indexed by langID, for the most likely -// scripts and regions given incomplete information. If more entries exist for a -// given language, region and script are the index and size respectively -// of the list in likelyLangList. -// Size: 7980 bytes, 1330 elements -var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, - 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, - 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, - 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, - 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, - 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, - 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, - 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, - 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, - 245: {region: 0x49, script: 0x17, flags: 0x0}, - 246: {region: 0x49, script: 0x17, flags: 0x0}, - 247: {region: 0x49, script: 0x17, flags: 0x0}, - 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, - 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, - 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, - 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, - 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, - 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, - 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, - 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, - 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, - 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, - 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, - 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, - 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, - 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, - 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, - 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, - 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, - 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, - 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, - 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, - 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, - 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, - 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, - 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, - 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, - 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, - 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, - 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, - 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, - 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, - 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, - 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, - 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, - 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, - 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, - 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, - 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, - 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, - 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, -} - -// likelyLangList holds lists info associated with likelyLang. -// Size: 582 bytes, 97 elements -var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, - 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, - 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, - 20: {region: 0x24, script: 0x5, flags: 0x4}, - 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, - 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, - 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, - 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, - 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, - 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, - 71: {region: 0x24, script: 0x5, flags: 0x4}, - 72: {region: 0x53, script: 0x20, flags: 0x4}, - 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, - 75: {region: 0x53, script: 0x3b, flags: 0x4}, - 76: {region: 0x53, script: 0x3b, flags: 0x2}, - 77: {region: 0x53, script: 0x3b, flags: 0x0}, - 78: {region: 0x2f, script: 0x3c, flags: 0x4}, - 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, -} - -type likelyLangScript struct { - lang uint16 - script uint16 - flags uint8 -} - -// likelyRegion is a lookup table, indexed by regionID, for the most likely -// languages and scripts given incomplete information. If more entries exist -// for a given regionID, lang and script are the index and size respectively -// of the list in likelyRegionList. -// TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, - 35: {lang: 0x3a, script: 0x5, flags: 0x0}, - 36: {lang: 0x0, script: 0x2, flags: 0x1}, - 39: {lang: 0x2, script: 0x2, flags: 0x1}, - 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, - 51: {lang: 0x6, script: 0x2, flags: 0x1}, - 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 56: {lang: 0x7e, script: 0x20, flags: 0x0}, - 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, - 71: {lang: 0x71, script: 0x20, flags: 0x0}, - 73: {lang: 0x512, script: 0x3e, flags: 0x2}, - 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, - 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, -} - -// likelyRegionList holds lists info associated with likelyRegion. -// Size: 558 bytes, 93 elements -var likelyRegionList = [93]likelyLangScript{ - 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, - 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, - 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, - 9: {lang: 0x351, script: 0x22, flags: 0x0}, - 10: {lang: 0x529, script: 0x3b, flags: 0x0}, - 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, - 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, - 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, - 20: {lang: 0x26a, script: 0x5, flags: 0x2}, - 21: {lang: 0x512, script: 0x3e, flags: 0x2}, - 22: {lang: 0x210, script: 0x2e, flags: 0x0}, - 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, - 25: {lang: 0x136, script: 0x34, flags: 0x0}, - 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, - 28: {lang: 0x31f, script: 0x5, flags: 0x0}, - 29: {lang: 0x1be, script: 0x22, flags: 0x0}, - 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, - 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, - 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, - 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, - 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, - 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, - 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, - 49: {lang: 0x30b, script: 0x20, flags: 0x0}, - 50: {lang: 0x242, script: 0x5, flags: 0x0}, - 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, - 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 57: {lang: 0x88, script: 0x22, flags: 0x0}, - 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, - 62: {lang: 0x7e, script: 0x20, flags: 0x0}, - 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, - 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, - 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, - 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, - 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, - 76: {lang: 0x467, script: 0x20, flags: 0x0}, - 77: {lang: 0x148, script: 0x5, flags: 0x0}, - 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, - 81: {lang: 0x58, script: 0x5, flags: 0x0}, - 82: {lang: 0x219, script: 0x20, flags: 0x0}, - 83: {lang: 0x81, script: 0x34, flags: 0x0}, - 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, - 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, - 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, - 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 92: {lang: 0x446, script: 0x5, flags: 0x0}, -} - -type likelyTag struct { - lang uint16 - region uint16 - script uint16 -} - -// Size: 198 bytes, 33 elements -var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, - 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, - 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, -} - -// Size: 264 bytes, 33 elements -var regionContainment = [33]uint64{ - // Entry 0 - 1F - 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, - 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, - 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, - 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, - 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, - 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, - 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, - // Entry 20 - 3F - 0x0000000100000000, -} - -// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -// where each set holds all groupings that are directly connected in a region -// containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, - 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, - 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, - 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, - 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, - 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, - 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, - 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, - // Entry 40 - 7F - 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, - 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, - // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, - // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, - // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, -} - -// regionInclusionBits is an array of bit vectors where every vector represents -// a set of region groupings. These sets are used to compute the distance -// between two regions for the purpose of language matching. -// Size: 584 bytes, 73 elements -var regionInclusionBits = [73]uint64{ - // Entry 0 - 1F - 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, - 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, - 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, - 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, - 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, - 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, - 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, - 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, - // Entry 20 - 3F - 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, - 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, - 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, - 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, - 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, - 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, - 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, - // Entry 40 - 5F - 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, - 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, - 0x0000000102020001, -} - -// regionInclusionNext marks, for each entry in regionInclusionBits, the set of -// all groups that are reachable from the groups set in the respective entry. -// Size: 73 bytes, 73 elements -var regionInclusionNext = [73]uint8{ - // Entry 0 - 3F - 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, - 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, - 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, - 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, - 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, - 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, - 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, - 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, - // Entry 40 - 7F - 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, - 0x43, -} - -type parentRel struct { - lang uint16 - script uint16 - maxScript uint16 - toRegion uint16 - fromRegion []uint16 -} - -// Size: 414 bytes, 5 elements -var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, -} - -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go deleted file mode 100644 index e7afd3188e..0000000000 --- a/vendor/golang.org/x/text/internal/language/tags.go +++ /dev/null @@ -1,48 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. -// It simplifies safe initialization of Tag values. -func MustParse(s string) Tag { - t, err := Parse(s) - if err != nil { - panic(err) - } - return t -} - -// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. -// It simplifies safe initialization of Base values. -func MustParseBase(s string) Language { - b, err := ParseBase(s) - if err != nil { - panic(err) - } - return b -} - -// MustParseScript is like ParseScript, but panics if the given script cannot be -// parsed. It simplifies safe initialization of Script values. -func MustParseScript(s string) Script { - scr, err := ParseScript(s) - if err != nil { - panic(err) - } - return scr -} - -// MustParseRegion is like ParseRegion, but panics if the given region cannot be -// parsed. It simplifies safe initialization of Region values. -func MustParseRegion(s string) Region { - r, err := ParseRegion(s) - if err != nil { - panic(err) - } - return r -} - -// Und is the root language. -var Und Tag diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go deleted file mode 100644 index 1cc004a6d5..0000000000 --- a/vendor/golang.org/x/text/internal/match.go +++ /dev/null @@ -1,67 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package internal - -// This file contains matchers that implement CLDR inheritance. -// -// See https://unicode.org/reports/tr35/#Locale_Inheritance. -// -// Some of the inheritance described in this document is already handled by -// the cldr package. - -import ( - "golang.org/x/text/language" -) - -// TODO: consider if (some of the) matching algorithm needs to be public after -// getting some feel about what is generic and what is specific. - -// NewInheritanceMatcher returns a matcher that matches based on the inheritance -// chain. -// -// The matcher uses canonicalization and the parent relationship to find a -// match. The resulting match will always be either Und or a language with the -// same language and script as the requested language. It will not match -// languages for which there is understood to be mutual or one-directional -// intelligibility. -// -// A Match will indicate an Exact match if the language matches after -// canonicalization and High if the matched tag is a parent. -func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { - tags := &InheritanceMatcher{make(map[language.Tag]int)} - for i, tag := range t { - ct, err := language.All.Canonicalize(tag) - if err != nil { - ct = tag - } - tags.index[ct] = i - } - return tags -} - -type InheritanceMatcher struct { - index map[language.Tag]int -} - -func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { - for _, t := range want { - ct, err := language.All.Canonicalize(t) - if err != nil { - ct = t - } - conf := language.Exact - for { - if index, ok := m.index[ct]; ok { - return ct, index, conf - } - if ct == language.Und { - break - } - ct = ct.Parent() - conf = language.High - } - } - return language.Und, 0, language.No -} diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go deleted file mode 100644 index b5d348891d..0000000000 --- a/vendor/golang.org/x/text/internal/tag/tag.go +++ /dev/null @@ -1,100 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package tag contains functionality handling tags and related data. -package tag // import "golang.org/x/text/internal/tag" - -import "sort" - -// An Index converts tags to a compact numeric value. -// -// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can -// be used to store additional information about the tag. -type Index string - -// Elem returns the element data at the given index. -func (s Index) Elem(x int) string { - return string(s[x*4 : x*4+4]) -} - -// Index reports the index of the given key or -1 if it could not be found. -// Only the first len(key) bytes from the start of the 4-byte entries will be -// considered for the search and the first match in Index will be returned. -func (s Index) Index(key []byte) int { - n := len(key) - // search the index of the first entry with an equal or higher value than - // key in s. - index := sort.Search(len(s)/4, func(i int) bool { - return cmp(s[i*4:i*4+n], key) != -1 - }) - i := index * 4 - if cmp(s[i:i+len(key)], key) != 0 { - return -1 - } - return index -} - -// Next finds the next occurrence of key after index x, which must have been -// obtained from a call to Index using the same key. It returns x+1 or -1. -func (s Index) Next(key []byte, x int) int { - if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { - return x - } - return -1 -} - -// cmp returns an integer comparing a and b lexicographically. -func cmp(a Index, b []byte) int { - n := len(a) - if len(b) < n { - n = len(b) - } - for i, c := range b[:n] { - switch { - case a[i] > c: - return 1 - case a[i] < c: - return -1 - } - } - switch { - case len(a) < len(b): - return -1 - case len(a) > len(b): - return 1 - } - return 0 -} - -// Compare returns an integer comparing a and b lexicographically. -func Compare(a string, b []byte) int { - return cmp(Index(a), b) -} - -// FixCase reformats b to the same pattern of cases as form. -// If returns false if string b is malformed. -func FixCase(form string, b []byte) bool { - if len(form) != len(b) { - return false - } - for i, c := range b { - if form[i] <= 'Z' { - if c >= 'a' { - c -= 'z' - 'Z' - } - if c < 'A' || 'Z' < c { - return false - } - } else { - if c <= 'Z' { - c += 'z' - 'Z' - } - if c < 'a' || 'z' < c { - return false - } - } - b[i] = c - } - return true -} diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go deleted file mode 100644 index a24fd1a4d6..0000000000 --- a/vendor/golang.org/x/text/language/coverage.go +++ /dev/null @@ -1,187 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "fmt" - "sort" - - "golang.org/x/text/internal/language" -) - -// The Coverage interface is used to define the level of coverage of an -// internationalization service. Note that not all types are supported by all -// services. As lists may be generated on the fly, it is recommended that users -// of a Coverage cache the results. -type Coverage interface { - // Tags returns the list of supported tags. - Tags() []Tag - - // BaseLanguages returns the list of supported base languages. - BaseLanguages() []Base - - // Scripts returns the list of supported scripts. - Scripts() []Script - - // Regions returns the list of supported regions. - Regions() []Region -} - -var ( - // Supported defines a Coverage that lists all supported subtags. Tags - // always returns nil. - Supported Coverage = allSubtags{} -) - -// TODO: -// - Support Variants, numbering systems. -// - CLDR coverage levels. -// - Set of common tags defined in this package. - -type allSubtags struct{} - -// Regions returns the list of supported regions. As all regions are in a -// consecutive range, it simply returns a slice of numbers in increasing order. -// The "undefined" region is not returned. -func (s allSubtags) Regions() []Region { - reg := make([]Region, language.NumRegions) - for i := range reg { - reg[i] = Region{language.Region(i + 1)} - } - return reg -} - -// Scripts returns the list of supported scripts. As all scripts are in a -// consecutive range, it simply returns a slice of numbers in increasing order. -// The "undefined" script is not returned. -func (s allSubtags) Scripts() []Script { - scr := make([]Script, language.NumScripts) - for i := range scr { - scr[i] = Script{language.Script(i + 1)} - } - return scr -} - -// BaseLanguages returns the list of all supported base languages. It generates -// the list by traversing the internal structures. -func (s allSubtags) BaseLanguages() []Base { - bs := language.BaseLanguages() - base := make([]Base, len(bs)) - for i, b := range bs { - base[i] = Base{b} - } - return base -} - -// Tags always returns nil. -func (s allSubtags) Tags() []Tag { - return nil -} - -// coverage is used by NewCoverage which is used as a convenient way for -// creating Coverage implementations for partially defined data. Very often a -// package will only need to define a subset of slices. coverage provides a -// convenient way to do this. Moreover, packages using NewCoverage, instead of -// their own implementation, will not break if later new slice types are added. -type coverage struct { - tags func() []Tag - bases func() []Base - scripts func() []Script - regions func() []Region -} - -func (s *coverage) Tags() []Tag { - if s.tags == nil { - return nil - } - return s.tags() -} - -// bases implements sort.Interface and is used to sort base languages. -type bases []Base - -func (b bases) Len() int { - return len(b) -} - -func (b bases) Swap(i, j int) { - b[i], b[j] = b[j], b[i] -} - -func (b bases) Less(i, j int) bool { - return b[i].langID < b[j].langID -} - -// BaseLanguages returns the result from calling s.bases if it is specified or -// otherwise derives the set of supported base languages from tags. -func (s *coverage) BaseLanguages() []Base { - if s.bases == nil { - tags := s.Tags() - if len(tags) == 0 { - return nil - } - a := make([]Base, len(tags)) - for i, t := range tags { - a[i] = Base{language.Language(t.lang())} - } - sort.Sort(bases(a)) - k := 0 - for i := 1; i < len(a); i++ { - if a[k] != a[i] { - k++ - a[k] = a[i] - } - } - return a[:k+1] - } - return s.bases() -} - -func (s *coverage) Scripts() []Script { - if s.scripts == nil { - return nil - } - return s.scripts() -} - -func (s *coverage) Regions() []Region { - if s.regions == nil { - return nil - } - return s.regions() -} - -// NewCoverage returns a Coverage for the given lists. It is typically used by -// packages providing internationalization services to define their level of -// coverage. A list may be of type []T or func() []T, where T is either Tag, -// Base, Script or Region. The returned Coverage derives the value for Bases -// from Tags if no func or slice for []Base is specified. For other unspecified -// types the returned Coverage will return nil for the respective methods. -func NewCoverage(list ...interface{}) Coverage { - s := &coverage{} - for _, x := range list { - switch v := x.(type) { - case func() []Base: - s.bases = v - case func() []Script: - s.scripts = v - case func() []Region: - s.regions = v - case func() []Tag: - s.tags = v - case []Base: - s.bases = func() []Base { return v } - case []Script: - s.scripts = func() []Script { return v } - case []Region: - s.regions = func() []Region { return v } - case []Tag: - s.tags = func() []Tag { return v } - default: - panic(fmt.Sprintf("language: unsupported set type %T", v)) - } - } - return s -} diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go deleted file mode 100644 index 212b77c906..0000000000 --- a/vendor/golang.org/x/text/language/doc.go +++ /dev/null @@ -1,98 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package language implements BCP 47 language tags and related functionality. -// -// The most important function of package language is to match a list of -// user-preferred languages to a list of supported languages. -// It alleviates the developer of dealing with the complexity of this process -// and provides the user with the best experience -// (see https://blog.golang.org/matchlang). -// -// # Matching preferred against supported languages -// -// A Matcher for an application that supports English, Australian English, -// Danish, and standard Mandarin can be created as follows: -// -// var matcher = language.NewMatcher([]language.Tag{ -// language.English, // The first language is used as fallback. -// language.MustParse("en-AU"), -// language.Danish, -// language.Chinese, -// }) -// -// This list of supported languages is typically implied by the languages for -// which there exists translations of the user interface. -// -// User-preferred languages usually come as a comma-separated list of BCP 47 -// language tags. -// The MatchString finds best matches for such strings: -// -// handler(w http.ResponseWriter, r *http.Request) { -// lang, _ := r.Cookie("lang") -// accept := r.Header.Get("Accept-Language") -// tag, _ := language.MatchStrings(matcher, lang.String(), accept) -// -// // tag should now be used for the initialization of any -// // locale-specific service. -// } -// -// The Matcher's Match method can be used to match Tags directly. -// -// Matchers are aware of the intricacies of equivalence between languages, such -// as deprecated subtags, legacy tags, macro languages, mutual -// intelligibility between scripts and languages, and transparently passing -// BCP 47 user configuration. -// For instance, it will know that a reader of Bokmål Danish can read Norwegian -// and will know that Cantonese ("yue") is a good match for "zh-HK". -// -// # Using match results -// -// To guarantee a consistent user experience to the user it is important to -// use the same language tag for the selection of any locale-specific services. -// For example, it is utterly confusing to substitute spelled-out numbers -// or dates in one language in text of another language. -// More subtly confusing is using the wrong sorting order or casing -// algorithm for a certain language. -// -// All the packages in x/text that provide locale-specific services -// (e.g. collate, cases) should be initialized with the tag that was -// obtained at the start of an interaction with the user. -// -// Note that Tag that is returned by Match and MatchString may differ from any -// of the supported languages, as it may contain carried over settings from -// the user tags. -// This may be inconvenient when your application has some additional -// locale-specific data for your supported languages. -// Match and MatchString both return the index of the matched supported tag -// to simplify associating such data with the matched tag. -// -// # Canonicalization -// -// If one uses the Matcher to compare languages one does not need to -// worry about canonicalization. -// -// The meaning of a Tag varies per application. The language package -// therefore delays canonicalization and preserves information as much -// as possible. The Matcher, however, will always take into account that -// two different tags may represent the same language. -// -// By default, only legacy and deprecated tags are converted into their -// canonical equivalent. All other information is preserved. This approach makes -// the confidence scores more accurate and allows matchers to distinguish -// between variants that are otherwise lost. -// -// As a consequence, two tags that should be treated as identical according to -// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The -// Matcher handles such distinctions, though, and is aware of the -// equivalence relations. The CanonType type can be used to alter the -// canonicalization form. -// -// # References -// -// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 -package language // import "golang.org/x/text/language" - -// TODO: explanation on how to match languages for your own locale-specific -// service. diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go deleted file mode 100644 index 4d9c661212..0000000000 --- a/vendor/golang.org/x/text/language/language.go +++ /dev/null @@ -1,605 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go -output tables.go - -package language - -// TODO: Remove above NOTE after: -// - verifying that tables are dropped correctly (most notably matcher tables). - -import ( - "strings" - - "golang.org/x/text/internal/language" - "golang.org/x/text/internal/language/compact" -) - -// Tag represents a BCP 47 language tag. It is used to specify an instance of a -// specific language or locale. All language tag values are guaranteed to be -// well-formed. -type Tag compact.Tag - -func makeTag(t language.Tag) (tag Tag) { - return Tag(compact.Make(t)) -} - -func (t *Tag) tag() language.Tag { - return (*compact.Tag)(t).Tag() -} - -func (t *Tag) isCompact() bool { - return (*compact.Tag)(t).IsCompact() -} - -// TODO: improve performance. -func (t *Tag) lang() language.Language { return t.tag().LangID } -func (t *Tag) region() language.Region { return t.tag().RegionID } -func (t *Tag) script() language.Script { return t.tag().ScriptID } - -// Make is a convenience wrapper for Parse that omits the error. -// In case of an error, a sensible default is returned. -func Make(s string) Tag { - return Default.Make(s) -} - -// Make is a convenience wrapper for c.Parse that omits the error. -// In case of an error, a sensible default is returned. -func (c CanonType) Make(s string) Tag { - t, _ := c.Parse(s) - return t -} - -// Raw returns the raw base language, script and region, without making an -// attempt to infer their values. -func (t Tag) Raw() (b Base, s Script, r Region) { - tt := t.tag() - return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} -} - -// IsRoot returns true if t is equal to language "und". -func (t Tag) IsRoot() bool { - return compact.Tag(t).IsRoot() -} - -// CanonType can be used to enable or disable various types of canonicalization. -type CanonType int - -const ( - // Replace deprecated base languages with their preferred replacements. - DeprecatedBase CanonType = 1 << iota - // Replace deprecated scripts with their preferred replacements. - DeprecatedScript - // Replace deprecated regions with their preferred replacements. - DeprecatedRegion - // Remove redundant scripts. - SuppressScript - // Normalize legacy encodings. This includes legacy languages defined in - // CLDR as well as bibliographic codes defined in ISO-639. - Legacy - // Map the dominant language of a macro language group to the macro language - // subtag. For example cmn -> zh. - Macro - // The CLDR flag should be used if full compatibility with CLDR is required. - // There are a few cases where language.Tag may differ from CLDR. To follow all - // of CLDR's suggestions, use All|CLDR. - CLDR - - // Raw can be used to Compose or Parse without Canonicalization. - Raw CanonType = 0 - - // Replace all deprecated tags with their preferred replacements. - Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion - - // All canonicalizations recommended by BCP 47. - BCP47 = Deprecated | SuppressScript - - // All canonicalizations. - All = BCP47 | Legacy | Macro - - // Default is the canonicalization used by Parse, Make and Compose. To - // preserve as much information as possible, canonicalizations that remove - // potentially valuable information are not included. The Matcher is - // designed to recognize similar tags that would be the same if - // they were canonicalized using All. - Default = Deprecated | Legacy - - canonLang = DeprecatedBase | Legacy | Macro - - // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. -) - -// canonicalize returns the canonicalized equivalent of the tag and -// whether there was any change. -func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { - if c == Raw { - return t, false - } - changed := false - if c&SuppressScript != 0 { - if t.LangID.SuppressScript() == t.ScriptID { - t.ScriptID = 0 - changed = true - } - } - if c&canonLang != 0 { - for { - if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { - switch aliasType { - case language.Legacy: - if c&Legacy != 0 { - if t.LangID == _sh && t.ScriptID == 0 { - t.ScriptID = _Latn - } - t.LangID = l - changed = true - } - case language.Macro: - if c&Macro != 0 { - // We deviate here from CLDR. The mapping "nb" -> "no" - // qualifies as a typical Macro language mapping. However, - // for legacy reasons, CLDR maps "no", the macro language - // code for Norwegian, to the dominant variant "nb". This - // change is currently under consideration for CLDR as well. - // See https://unicode.org/cldr/trac/ticket/2698 and also - // https://unicode.org/cldr/trac/ticket/1790 for some of the - // practical implications. TODO: this check could be removed - // if CLDR adopts this change. - if c&CLDR == 0 || t.LangID != _nb { - changed = true - t.LangID = l - } - } - case language.Deprecated: - if c&DeprecatedBase != 0 { - if t.LangID == _mo && t.RegionID == 0 { - t.RegionID = _MD - } - t.LangID = l - changed = true - // Other canonicalization types may still apply. - continue - } - } - } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { - t.LangID = _nb - changed = true - } - break - } - } - if c&DeprecatedScript != 0 { - if t.ScriptID == _Qaai { - changed = true - t.ScriptID = _Zinh - } - } - if c&DeprecatedRegion != 0 { - if r := t.RegionID.Canonicalize(); r != t.RegionID { - changed = true - t.RegionID = r - } - } - return t, changed -} - -// Canonicalize returns the canonicalized equivalent of the tag. -func (c CanonType) Canonicalize(t Tag) (Tag, error) { - // First try fast path. - if t.isCompact() { - if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { - return t, nil - } - } - // It is unlikely that one will canonicalize a tag after matching. So do - // a slow but simple approach here. - if tag, changed := canonicalize(c, t.tag()); changed { - tag.RemakeString() - return makeTag(tag), nil - } - return t, nil - -} - -// Confidence indicates the level of certainty for a given return value. -// For example, Serbian may be written in Cyrillic or Latin script. -// The confidence level indicates whether a value was explicitly specified, -// whether it is typically the only possible value, or whether there is -// an ambiguity. -type Confidence int - -const ( - No Confidence = iota // full confidence that there was no match - Low // most likely value picked out of a set of alternatives - High // value is generally assumed to be the correct match - Exact // exact match or explicitly specified value -) - -var confName = []string{"No", "Low", "High", "Exact"} - -func (c Confidence) String() string { - return confName[c] -} - -// String returns the canonical string representation of the language tag. -func (t Tag) String() string { - return t.tag().String() -} - -// MarshalText implements encoding.TextMarshaler. -func (t Tag) MarshalText() (text []byte, err error) { - return t.tag().MarshalText() -} - -// UnmarshalText implements encoding.TextUnmarshaler. -func (t *Tag) UnmarshalText(text []byte) error { - var tag language.Tag - err := tag.UnmarshalText(text) - *t = makeTag(tag) - return err -} - -// Base returns the base language of the language tag. If the base language is -// unspecified, an attempt will be made to infer it from the context. -// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. -func (t Tag) Base() (Base, Confidence) { - if b := t.lang(); b != 0 { - return Base{b}, Exact - } - tt := t.tag() - c := High - if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { - c = Low - } - if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { - return Base{tag.LangID}, c - } - return Base{0}, No -} - -// Script infers the script for the language tag. If it was not explicitly given, it will infer -// a most likely candidate. -// If more than one script is commonly used for a language, the most likely one -// is returned with a low confidence indication. For example, it returns (Cyrl, Low) -// for Serbian. -// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) -// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks -// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. -// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for -// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. -// Note that an inferred script is never guaranteed to be the correct one. Latin is -// almost exclusively used for Afrikaans, but Arabic has been used for some texts -// in the past. Also, the script that is commonly used may change over time. -// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. -func (t Tag) Script() (Script, Confidence) { - if scr := t.script(); scr != 0 { - return Script{scr}, Exact - } - tt := t.tag() - sc, c := language.Script(_Zzzz), No - if scr := tt.LangID.SuppressScript(); scr != 0 { - // Note: it is not always the case that a language with a suppress - // script value is only written in one script (e.g. kk, ms, pa). - if tt.RegionID == 0 { - return Script{scr}, High - } - sc, c = scr, High - } - if tag, err := tt.Maximize(); err == nil { - if tag.ScriptID != sc { - sc, c = tag.ScriptID, Low - } - } else { - tt, _ = canonicalize(Deprecated|Macro, tt) - if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { - sc, c = tag.ScriptID, Low - } - } - return Script{sc}, c -} - -// Region returns the region for the language tag. If it was not explicitly given, it will -// infer a most likely candidate from the context. -// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. -func (t Tag) Region() (Region, Confidence) { - if r := t.region(); r != 0 { - return Region{r}, Exact - } - tt := t.tag() - if tt, err := tt.Maximize(); err == nil { - return Region{tt.RegionID}, Low // TODO: differentiate between high and low. - } - tt, _ = canonicalize(Deprecated|Macro, tt) - if tag, err := tt.Maximize(); err == nil { - return Region{tag.RegionID}, Low - } - return Region{_ZZ}, No // TODO: return world instead of undetermined? -} - -// Variants returns the variants specified explicitly for this language tag. -// or nil if no variant was specified. -func (t Tag) Variants() []Variant { - if !compact.Tag(t).MayHaveVariants() { - return nil - } - v := []Variant{} - x, str := "", t.tag().Variants() - for str != "" { - x, str = nextToken(str) - v = append(v, Variant{x}) - } - return v -} - -// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a -// specific language are substituted with fields from the parent language. -// The parent for a language may change for newer versions of CLDR. -// -// Parent returns a tag for a less specific language that is mutually -// intelligible or Und if there is no such language. This may not be the same as -// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" -// is "zh-Hant", and the parent of "zh-Hant" is "und". -func (t Tag) Parent() Tag { - return Tag(compact.Tag(t).Parent()) -} - -// nextToken returns token t and the rest of the string. -func nextToken(s string) (t, tail string) { - p := strings.Index(s[1:], "-") - if p == -1 { - return s[1:], "" - } - p++ - return s[1:p], s[p:] -} - -// Extension is a single BCP 47 extension. -type Extension struct { - s string -} - -// String returns the string representation of the extension, including the -// type tag. -func (e Extension) String() string { - return e.s -} - -// ParseExtension parses s as an extension and returns it on success. -func ParseExtension(s string) (e Extension, err error) { - ext, err := language.ParseExtension(s) - return Extension{ext}, err -} - -// Type returns the one-byte extension type of e. It returns 0 for the zero -// exception. -func (e Extension) Type() byte { - if e.s == "" { - return 0 - } - return e.s[0] -} - -// Tokens returns the list of tokens of e. -func (e Extension) Tokens() []string { - return strings.Split(e.s, "-") -} - -// Extension returns the extension of type x for tag t. It will return -// false for ok if t does not have the requested extension. The returned -// extension will be invalid in this case. -func (t Tag) Extension(x byte) (ext Extension, ok bool) { - if !compact.Tag(t).MayHaveExtensions() { - return Extension{}, false - } - e, ok := t.tag().Extension(x) - return Extension{e}, ok -} - -// Extensions returns all extensions of t. -func (t Tag) Extensions() []Extension { - if !compact.Tag(t).MayHaveExtensions() { - return nil - } - e := []Extension{} - for _, ext := range t.tag().Extensions() { - e = append(e, Extension{ext}) - } - return e -} - -// TypeForKey returns the type associated with the given key, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// TypeForKey will traverse the inheritance chain to get the correct value. -// -// If there are multiple types associated with a key, only the first will be -// returned. If there is no type associated with a key, it returns the empty -// string. -func (t Tag) TypeForKey(key string) string { - if !compact.Tag(t).MayHaveExtensions() { - if key != "rg" && key != "va" { - return "" - } - } - return t.tag().TypeForKey(key) -} - -// SetTypeForKey returns a new Tag with the key set to type, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// An empty value removes an existing pair with the same key. -func (t Tag) SetTypeForKey(key, value string) (Tag, error) { - tt, err := t.tag().SetTypeForKey(key, value) - return makeTag(tt), err -} - -// NumCompactTags is the number of compact tags. The maximum tag is -// NumCompactTags-1. -const NumCompactTags = compact.NumCompactTags - -// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags -// for which data exists in the text repository.The index will change over time -// and should not be stored in persistent storage. If t does not match a compact -// index, exact will be false and the compact index will be returned for the -// first match after repeatedly taking the Parent of t. -func CompactIndex(t Tag) (index int, exact bool) { - id, exact := compact.LanguageID(compact.Tag(t)) - return int(id), exact -} - -var root = language.Tag{} - -// Base is an ISO 639 language code, used for encoding the base language -// of a language tag. -type Base struct { - langID language.Language -} - -// ParseBase parses a 2- or 3-letter ISO 639 code. -// It returns a ValueError if s is a well-formed but unknown language identifier -// or another error if another error occurred. -func ParseBase(s string) (Base, error) { - l, err := language.ParseBase(s) - return Base{l}, err -} - -// String returns the BCP 47 representation of the base language. -func (b Base) String() string { - return b.langID.String() -} - -// ISO3 returns the ISO 639-3 language code. -func (b Base) ISO3() string { - return b.langID.ISO3() -} - -// IsPrivateUse reports whether this language code is reserved for private use. -func (b Base) IsPrivateUse() bool { - return b.langID.IsPrivateUse() -} - -// Script is a 4-letter ISO 15924 code for representing scripts. -// It is idiomatically represented in title case. -type Script struct { - scriptID language.Script -} - -// ParseScript parses a 4-letter ISO 15924 code. -// It returns a ValueError if s is a well-formed but unknown script identifier -// or another error if another error occurred. -func ParseScript(s string) (Script, error) { - sc, err := language.ParseScript(s) - return Script{sc}, err -} - -// String returns the script code in title case. -// It returns "Zzzz" for an unspecified script. -func (s Script) String() string { - return s.scriptID.String() -} - -// IsPrivateUse reports whether this script code is reserved for private use. -func (s Script) IsPrivateUse() bool { - return s.scriptID.IsPrivateUse() -} - -// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. -type Region struct { - regionID language.Region -} - -// EncodeM49 returns the Region for the given UN M.49 code. -// It returns an error if r is not a valid code. -func EncodeM49(r int) (Region, error) { - rid, err := language.EncodeM49(r) - return Region{rid}, err -} - -// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. -// It returns a ValueError if s is a well-formed but unknown region identifier -// or another error if another error occurred. -func ParseRegion(s string) (Region, error) { - r, err := language.ParseRegion(s) - return Region{r}, err -} - -// String returns the BCP 47 representation for the region. -// It returns "ZZ" for an unspecified region. -func (r Region) String() string { - return r.regionID.String() -} - -// ISO3 returns the 3-letter ISO code of r. -// Note that not all regions have a 3-letter ISO code. -// In such cases this method returns "ZZZ". -func (r Region) ISO3() string { - return r.regionID.ISO3() -} - -// M49 returns the UN M.49 encoding of r, or 0 if this encoding -// is not defined for r. -func (r Region) M49() int { - return r.regionID.M49() -} - -// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This -// may include private-use tags that are assigned by CLDR and used in this -// implementation. So IsPrivateUse and IsCountry can be simultaneously true. -func (r Region) IsPrivateUse() bool { - return r.regionID.IsPrivateUse() -} - -// IsCountry returns whether this region is a country or autonomous area. This -// includes non-standard definitions from CLDR. -func (r Region) IsCountry() bool { - return r.regionID.IsCountry() -} - -// IsGroup returns whether this region defines a collection of regions. This -// includes non-standard definitions from CLDR. -func (r Region) IsGroup() bool { - return r.regionID.IsGroup() -} - -// Contains returns whether Region c is contained by Region r. It returns true -// if c == r. -func (r Region) Contains(c Region) bool { - return r.regionID.Contains(c.regionID) -} - -// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. -// In all other cases it returns either the region itself or an error. -// -// This method may return an error for a region for which there exists a -// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The -// region will already be canonicalized it was obtained from a Tag that was -// obtained using any of the default methods. -func (r Region) TLD() (Region, error) { - tld, err := r.regionID.TLD() - return Region{tld}, err -} - -// Canonicalize returns the region or a possible replacement if the region is -// deprecated. It will not return a replacement for deprecated regions that -// are split into multiple regions. -func (r Region) Canonicalize() Region { - return Region{r.regionID.Canonicalize()} -} - -// Variant represents a registered variant of a language as defined by BCP 47. -type Variant struct { - variant string -} - -// ParseVariant parses and returns a Variant. An error is returned if s is not -// a valid variant. -func ParseVariant(s string) (Variant, error) { - v, err := language.ParseVariant(s) - return Variant{v.String()}, err -} - -// String returns the string representation of the variant. -func (v Variant) String() string { - return v.variant -} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go deleted file mode 100644 index ee45f49474..0000000000 --- a/vendor/golang.org/x/text/language/match.go +++ /dev/null @@ -1,735 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "errors" - "strings" - - "golang.org/x/text/internal/language" -) - -// A MatchOption configures a Matcher. -type MatchOption func(*matcher) - -// PreferSameScript will, in the absence of a match, result in the first -// preferred tag with the same script as a supported tag to match this supported -// tag. The default is currently true, but this may change in the future. -func PreferSameScript(preferSame bool) MatchOption { - return func(m *matcher) { m.preferSameScript = preferSame } -} - -// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. -// There doesn't seem to be too much need for multiple types. -// Making it a concrete type allows MatchStrings to be a method, which will -// improve its discoverability. - -// MatchStrings parses and matches the given strings until one of them matches -// the language in the Matcher. A string may be an Accept-Language header as -// handled by ParseAcceptLanguage. The default language is returned if no -// other language matched. -func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { - for _, accept := range lang { - desired, _, err := ParseAcceptLanguage(accept) - if err != nil { - continue - } - if tag, index, conf := m.Match(desired...); conf != No { - return tag, index - } - } - tag, index, _ = m.Match() - return -} - -// Matcher is the interface that wraps the Match method. -// -// Match returns the best match for any of the given tags, along with -// a unique index associated with the returned tag and a confidence -// score. -type Matcher interface { - Match(t ...Tag) (tag Tag, index int, c Confidence) -} - -// Comprehends reports the confidence score for a speaker of a given language -// to being able to comprehend the written form of an alternative language. -func Comprehends(speaker, alternative Tag) Confidence { - _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) - return c -} - -// NewMatcher returns a Matcher that matches an ordered list of preferred tags -// against a list of supported tags based on written intelligibility, closeness -// of dialect, equivalence of subtags and various other rules. It is initialized -// with the list of supported tags. The first element is used as the default -// value in case no match is found. -// -// Its Match method matches the first of the given Tags to reach a certain -// confidence threshold. The tags passed to Match should therefore be specified -// in order of preference. Extensions are ignored for matching. -// -// The index returned by the Match method corresponds to the index of the -// matched tag in t, but is augmented with the Unicode extension ('u')of the -// corresponding preferred tag. This allows user locale options to be passed -// transparently. -func NewMatcher(t []Tag, options ...MatchOption) Matcher { - return newMatcher(t, options) -} - -func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { - var tt language.Tag - match, w, c := m.getBest(want...) - if match != nil { - tt, index = match.tag, match.index - } else { - // TODO: this should be an option - tt = m.default_.tag - if m.preferSameScript { - outer: - for _, w := range want { - script, _ := w.Script() - if script.scriptID == 0 { - // Don't do anything if there is no script, such as with - // private subtags. - continue - } - for i, h := range m.supported { - if script.scriptID == h.maxScript { - tt, index = h.tag, i - break outer - } - } - } - } - // TODO: select first language tag based on script. - } - if w.RegionID != tt.RegionID && w.RegionID != 0 { - if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { - tt.RegionID = w.RegionID - tt.RemakeString() - } else if r := w.RegionID.String(); len(r) == 2 { - // TODO: also filter macro and deprecated. - tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") - } - } - // Copy options from the user-provided tag into the result tag. This is hard - // to do after the fact, so we do it here. - // TODO: add in alternative variants to -u-va-. - // TODO: add preferred region to -u-rg-. - if e := w.Extensions(); len(e) > 0 { - b := language.Builder{} - b.SetTag(tt) - for _, e := range e { - b.AddExt(e) - } - tt = b.Make() - } - return makeTag(tt), index, c -} - -// ErrMissingLikelyTagsData indicates no information was available -// to compute likely values of missing tags. -var ErrMissingLikelyTagsData = errors.New("missing likely tags data") - -// func (t *Tag) setTagsFrom(id Tag) { -// t.LangID = id.LangID -// t.ScriptID = id.ScriptID -// t.RegionID = id.RegionID -// } - -// Tag Matching -// CLDR defines an algorithm for finding the best match between two sets of language -// tags. The basic algorithm defines how to score a possible match and then find -// the match with the best score -// (see https://www.unicode.org/reports/tr35/#LanguageMatching). -// Using scoring has several disadvantages. The scoring obfuscates the importance of -// the various factors considered, making the algorithm harder to understand. Using -// scoring also requires the full score to be computed for each pair of tags. -// -// We will use a different algorithm which aims to have the following properties: -// - clarity on the precedence of the various selection factors, and -// - improved performance by allowing early termination of a comparison. -// -// Matching algorithm (overview) -// Input: -// - supported: a set of supported tags -// - default: the default tag to return in case there is no match -// - desired: list of desired tags, ordered by preference, starting with -// the most-preferred. -// -// Algorithm: -// 1) Set the best match to the lowest confidence level -// 2) For each tag in "desired": -// a) For each tag in "supported": -// 1) compute the match between the two tags. -// 2) if the match is better than the previous best match, replace it -// with the new match. (see next section) -// b) if the current best match is Exact and pin is true the result will be -// frozen to the language found thusfar, although better matches may -// still be found for the same language. -// 3) If the best match so far is below a certain threshold, return "default". -// -// Ranking: -// We use two phases to determine whether one pair of tags are a better match -// than another pair of tags. First, we determine a rough confidence level. If the -// levels are different, the one with the highest confidence wins. -// Second, if the rough confidence levels are identical, we use a set of tie-breaker -// rules. -// -// The confidence level of matching a pair of tags is determined by finding the -// lowest confidence level of any matches of the corresponding subtags (the -// result is deemed as good as its weakest link). -// We define the following levels: -// Exact - An exact match of a subtag, before adding likely subtags. -// MaxExact - An exact match of a subtag, after adding likely subtags. -// [See Note 2]. -// High - High level of mutual intelligibility between different subtag -// variants. -// Low - Low level of mutual intelligibility between different subtag -// variants. -// No - No mutual intelligibility. -// -// The following levels can occur for each type of subtag: -// Base: Exact, MaxExact, High, Low, No -// Script: Exact, MaxExact [see Note 3], Low, No -// Region: Exact, MaxExact, High -// Variant: Exact, High -// Private: Exact, No -// -// Any result with a confidence level of Low or higher is deemed a possible match. -// Once a desired tag matches any of the supported tags with a level of MaxExact -// or higher, the next desired tag is not considered (see Step 2.b). -// Note that CLDR provides languageMatching data that defines close equivalence -// classes for base languages, scripts and regions. -// -// Tie-breaking -// If we get the same confidence level for two matches, we apply a sequence of -// tie-breaking rules. The first that succeeds defines the result. The rules are -// applied in the following order. -// 1) Original language was defined and was identical. -// 2) Original region was defined and was identical. -// 3) Distance between two maximized regions was the smallest. -// 4) Original script was defined and was identical. -// 5) Distance from want tag to have tag using the parent relation [see Note 5.] -// If there is still no winner after these rules are applied, the first match -// found wins. -// -// Notes: -// [2] In practice, as matching of Exact is done in a separate phase from -// matching the other levels, we reuse the Exact level to mean MaxExact in -// the second phase. As a consequence, we only need the levels defined by -// the Confidence type. The MaxExact confidence level is mapped to High in -// the public API. -// [3] We do not differentiate between maximized script values that were derived -// from suppressScript versus most likely tag data. We determined that in -// ranking the two, one ranks just after the other. Moreover, the two cannot -// occur concurrently. As a consequence, they are identical for practical -// purposes. -// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign -// the MaxExact level to allow iw vs he to still be a closer match than -// en-AU vs en-US, for example. -// [5] In CLDR a locale inherits fields that are unspecified for this locale -// from its parent. Therefore, if a locale is a parent of another locale, -// it is a strong measure for closeness, especially when no other tie -// breaker rule applies. One could also argue it is inconsistent, for -// example, when pt-AO matches pt (which CLDR equates with pt-BR), even -// though its parent is pt-PT according to the inheritance rules. -// -// Implementation Details: -// There are several performance considerations worth pointing out. Most notably, -// we preprocess as much as possible (within reason) at the time of creation of a -// matcher. This includes: -// - creating a per-language map, which includes data for the raw base language -// and its canonicalized variant (if applicable), -// - expanding entries for the equivalence classes defined in CLDR's -// languageMatch data. -// The per-language map ensures that typically only a very small number of tags -// need to be considered. The pre-expansion of canonicalized subtags and -// equivalence classes reduces the amount of map lookups that need to be done at -// runtime. - -// matcher keeps a set of supported language tags, indexed by language. -type matcher struct { - default_ *haveTag - supported []*haveTag - index map[language.Language]*matchHeader - passSettings bool - preferSameScript bool -} - -// matchHeader has the lists of tags for exact matches and matches based on -// maximized and canonicalized tags for a given language. -type matchHeader struct { - haveTags []*haveTag - original bool -} - -// haveTag holds a supported Tag and its maximized script and region. The maximized -// or canonicalized language is not stored as it is not needed during matching. -type haveTag struct { - tag language.Tag - - // index of this tag in the original list of supported tags. - index int - - // conf is the maximum confidence that can result from matching this haveTag. - // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. - conf Confidence - - // Maximized region and script. - maxRegion language.Region - maxScript language.Script - - // altScript may be checked as an alternative match to maxScript. If altScript - // matches, the confidence level for this match is Low. Theoretically there - // could be multiple alternative scripts. This does not occur in practice. - altScript language.Script - - // nextMax is the index of the next haveTag with the same maximized tags. - nextMax uint16 -} - -func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { - max := tag - if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { - max, _ = canonicalize(All, max) - max, _ = max.Maximize() - max.RemakeString() - } - return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID -} - -// altScript returns an alternative script that may match the given script with -// a low confidence. At the moment, the langMatch data allows for at most one -// script to map to another and we rely on this to keep the code simple. -func altScript(l language.Language, s language.Script) language.Script { - for _, alt := range matchScript { - // TODO: also match cases where language is not the same. - if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && - language.Script(alt.haveScript) == s { - return language.Script(alt.wantScript) - } - } - return 0 -} - -// addIfNew adds a haveTag to the list of tags only if it is a unique tag. -// Tags that have the same maximized values are linked by index. -func (h *matchHeader) addIfNew(n haveTag, exact bool) { - h.original = h.original || exact - // Don't add new exact matches. - for _, v := range h.haveTags { - if equalsRest(v.tag, n.tag) { - return - } - } - // Allow duplicate maximized tags, but create a linked list to allow quickly - // comparing the equivalents and bail out. - for i, v := range h.haveTags { - if v.maxScript == n.maxScript && - v.maxRegion == n.maxRegion && - v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { - for h.haveTags[i].nextMax != 0 { - i = int(h.haveTags[i].nextMax) - } - h.haveTags[i].nextMax = uint16(len(h.haveTags)) - break - } - } - h.haveTags = append(h.haveTags, &n) -} - -// header returns the matchHeader for the given language. It creates one if -// it doesn't already exist. -func (m *matcher) header(l language.Language) *matchHeader { - if h := m.index[l]; h != nil { - return h - } - h := &matchHeader{} - m.index[l] = h - return h -} - -func toConf(d uint8) Confidence { - if d <= 10 { - return High - } - if d < 30 { - return Low - } - return No -} - -// newMatcher builds an index for the given supported tags and returns it as -// a matcher. It also expands the index by considering various equivalence classes -// for a given tag. -func newMatcher(supported []Tag, options []MatchOption) *matcher { - m := &matcher{ - index: make(map[language.Language]*matchHeader), - preferSameScript: true, - } - for _, o := range options { - o(m) - } - if len(supported) == 0 { - m.default_ = &haveTag{} - return m - } - // Add supported languages to the index. Add exact matches first to give - // them precedence. - for i, tag := range supported { - tt := tag.tag() - pair, _ := makeHaveTag(tt, i) - m.header(tt.LangID).addIfNew(pair, true) - m.supported = append(m.supported, &pair) - } - m.default_ = m.header(supported[0].lang()).haveTags[0] - // Keep these in two different loops to support the case that two equivalent - // languages are distinguished, such as iw and he. - for i, tag := range supported { - tt := tag.tag() - pair, max := makeHaveTag(tt, i) - if max != tt.LangID { - m.header(max).addIfNew(pair, true) - } - } - - // update is used to add indexes in the map for equivalent languages. - // update will only add entries to original indexes, thus not computing any - // transitive relations. - update := func(want, have uint16, conf Confidence) { - if hh := m.index[language.Language(have)]; hh != nil { - if !hh.original { - return - } - hw := m.header(language.Language(want)) - for _, ht := range hh.haveTags { - v := *ht - if conf < v.conf { - v.conf = conf - } - v.nextMax = 0 // this value needs to be recomputed - if v.altScript != 0 { - v.altScript = altScript(language.Language(want), v.maxScript) - } - hw.addIfNew(v, conf == Exact && hh.original) - } - } - } - - // Add entries for languages with mutual intelligibility as defined by CLDR's - // languageMatch data. - for _, ml := range matchLang { - update(ml.want, ml.have, toConf(ml.distance)) - if !ml.oneway { - update(ml.have, ml.want, toConf(ml.distance)) - } - } - - // Add entries for possible canonicalizations. This is an optimization to - // ensure that only one map lookup needs to be done at runtime per desired tag. - // First we match deprecated equivalents. If they are perfect equivalents - // (their canonicalization simply substitutes a different language code, but - // nothing else), the match confidence is Exact, otherwise it is High. - for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or - // or region, we consider it an exact match. - conf := Exact - if language.AliasTypes[i] != language.Macro { - if !isExactEquivalent(language.Language(lm.From)) { - conf = High - } - update(lm.To, lm.From, conf) - } - update(lm.From, lm.To, conf) - } - return m -} - -// getBest gets the best matching tag in m for any of the given tags, taking into -// account the order of preference of the given tags. -func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { - best := bestMatch{} - for i, ww := range want { - w := ww.tag() - var max language.Tag - // Check for exact match first. - h := m.index[w.LangID] - if w.LangID != 0 { - if h == nil { - continue - } - // Base language is defined. - max, _ = canonicalize(Legacy|Deprecated|Macro, w) - // A region that is added through canonicalization is stronger than - // a maximized region: set it in the original (e.g. mo -> ro-MD). - if w.RegionID != max.RegionID { - w.RegionID = max.RegionID - } - // TODO: should we do the same for scripts? - // See test case: en, sr, nl ; sh ; sr - max, _ = max.Maximize() - } else { - // Base language is not defined. - if h != nil { - for i := range h.haveTags { - have := h.haveTags[i] - if equalsRest(have.tag, w) { - return have, w, Exact - } - } - } - if w.ScriptID == 0 && w.RegionID == 0 { - // We skip all tags matching und for approximate matching, including - // private tags. - continue - } - max, _ = w.Maximize() - if h = m.index[max.LangID]; h == nil { - continue - } - } - pin := true - for _, t := range want[i+1:] { - if w.LangID == t.lang() { - pin = false - break - } - } - // Check for match based on maximized tag. - for i := range h.haveTags { - have := h.haveTags[i] - best.update(have, w, max.ScriptID, max.RegionID, pin) - if best.conf == Exact { - for have.nextMax != 0 { - have = h.haveTags[have.nextMax] - best.update(have, w, max.ScriptID, max.RegionID, pin) - } - return best.have, best.want, best.conf - } - } - } - if best.conf <= No { - if len(want) != 0 { - return nil, want[0].tag(), No - } - return nil, language.Tag{}, No - } - return best.have, best.want, best.conf -} - -// bestMatch accumulates the best match so far. -type bestMatch struct { - have *haveTag - want language.Tag - conf Confidence - pinnedRegion language.Region - pinLanguage bool - sameRegionGroup bool - // Cached results from applying tie-breaking rules. - origLang bool - origReg bool - paradigmReg bool - regGroupDist uint8 - origScript bool -} - -// update updates the existing best match if the new pair is considered to be a -// better match. To determine if the given pair is a better match, it first -// computes the rough confidence level. If this surpasses the current match, it -// will replace it and update the tie-breaker rule cache. If there is a tie, it -// proceeds with applying a series of tie-breaker rules. If there is no -// conclusive winner after applying the tie-breaker rules, it leaves the current -// match as the preferred match. -// -// If pin is true and have and tag are a strong match, it will henceforth only -// consider matches for this language. This corresponds to the idea that most -// users have a strong preference for the first defined language. A user can -// still prefer a second language over a dialect of the preferred language by -// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should -// be false. -func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { - // Bail if the maximum attainable confidence is below that of the current best match. - c := have.conf - if c < m.conf { - return - } - // Don't change the language once we already have found an exact match. - if m.pinLanguage && tag.LangID != m.want.LangID { - return - } - // Pin the region group if we are comparing tags for the same language. - if tag.LangID == m.want.LangID && m.sameRegionGroup { - _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) - if !sameGroup { - return - } - } - if c == Exact && have.maxScript == maxScript { - // If there is another language and then another entry of this language, - // don't pin anything, otherwise pin the language. - m.pinLanguage = pin - } - if equalsRest(have.tag, tag) { - } else if have.maxScript != maxScript { - // There is usually very little comprehension between different scripts. - // In a few cases there may still be Low comprehension. This possibility - // is pre-computed and stored in have.altScript. - if Low < m.conf || have.altScript != maxScript { - return - } - c = Low - } else if have.maxRegion != maxRegion { - if High < c { - // There is usually a small difference between languages across regions. - c = High - } - } - - // We store the results of the computations of the tie-breaker rules along - // with the best match. There is no need to do the checks once we determine - // we have a winner, but we do still need to do the tie-breaker computations. - // We use "beaten" to keep track if we still need to do the checks. - beaten := false // true if the new pair defeats the current one. - if c != m.conf { - if c < m.conf { - return - } - beaten = true - } - - // Tie-breaker rules: - // We prefer if the pre-maximized language was specified and identical. - origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 - if !beaten && m.origLang != origLang { - if m.origLang { - return - } - beaten = true - } - - // We prefer if the pre-maximized region was specified and identical. - origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 - if !beaten && m.origReg != origReg { - if m.origReg { - return - } - beaten = true - } - - regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) - if !beaten && m.regGroupDist != regGroupDist { - if regGroupDist > m.regGroupDist { - return - } - beaten = true - } - - paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) - if !beaten && m.paradigmReg != paradigmReg { - if !paradigmReg { - return - } - beaten = true - } - - // Next we prefer if the pre-maximized script was specified and identical. - origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 - if !beaten && m.origScript != origScript { - if m.origScript { - return - } - beaten = true - } - - // Update m to the newly found best match. - if beaten { - m.have = have - m.want = tag - m.conf = c - m.pinnedRegion = maxRegion - m.sameRegionGroup = sameGroup - m.origLang = origLang - m.origReg = origReg - m.paradigmReg = paradigmReg - m.origScript = origScript - m.regGroupDist = regGroupDist - } -} - -func isParadigmLocale(lang language.Language, r language.Region) bool { - for _, e := range paradigmLocales { - if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { - return true - } - } - return false -} - -// regionGroupDist computes the distance between two regions based on their -// CLDR grouping. -func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { - const defaultDistance = 4 - - aGroup := uint(regionToGroups[a]) << 1 - bGroup := uint(regionToGroups[b]) << 1 - for _, ri := range matchRegion { - if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { - group := uint(1 << (ri.group &^ 0x80)) - if 0x80&ri.group == 0 { - if aGroup&bGroup&group != 0 { // Both regions are in the group. - return ri.distance, ri.distance == defaultDistance - } - } else { - if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. - return ri.distance, ri.distance == defaultDistance - } - } - } - } - return defaultDistance, true -} - -// equalsRest compares everything except the language. -func equalsRest(a, b language.Tag) bool { - // TODO: don't include extensions in this comparison. To do this efficiently, - // though, we should handle private tags separately. - return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() -} - -// isExactEquivalent returns true if canonicalizing the language will not alter -// the script or region of a tag. -func isExactEquivalent(l language.Language) bool { - for _, o := range notEquivalent { - if o == l { - return false - } - } - return true -} - -var notEquivalent []language.Language - -func init() { - // Create a list of all languages for which canonicalization may alter the - // script or region. - for _, lm := range language.AliasMap { - tag := language.Tag{LangID: language.Language(lm.From)} - if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { - notEquivalent = append(notEquivalent, language.Language(lm.From)) - } - } - // Maximize undefined regions of paradigm locales. - for i, v := range paradigmLocales { - t := language.Tag{LangID: language.Language(v[0])} - max, _ := t.Maximize() - if v[1] == 0 { - paradigmLocales[i][1] = uint16(max.RegionID) - } - if v[2] == 0 { - paradigmLocales[i][2] = uint16(max.RegionID) - } - } -} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go deleted file mode 100644 index 4d57222e77..0000000000 --- a/vendor/golang.org/x/text/language/parse.go +++ /dev/null @@ -1,256 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "errors" - "sort" - "strconv" - "strings" - - "golang.org/x/text/internal/language" -) - -// ValueError is returned by any of the parsing functions when the -// input is well-formed but the respective subtag is not recognized -// as a valid value. -type ValueError interface { - error - - // Subtag returns the subtag for which the error occurred. - Subtag() string -} - -// Parse parses the given BCP 47 string and returns a valid Tag. If parsing -// failed it returns an error and any part of the tag that could be parsed. -// If parsing succeeded but an unknown value was found, it returns -// ValueError. The Tag returned in this case is just stripped of the unknown -// value. All other values are preserved. It accepts tags in the BCP 47 format -// and extensions to this standard defined in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// The resulting tag is canonicalized using the default canonicalization type. -func Parse(s string) (t Tag, err error) { - return Default.Parse(s) -} - -// Parse parses the given BCP 47 string and returns a valid Tag. If parsing -// failed it returns an error and any part of the tag that could be parsed. -// If parsing succeeded but an unknown value was found, it returns -// ValueError. The Tag returned in this case is just stripped of the unknown -// value. All other values are preserved. It accepts tags in the BCP 47 format -// and extensions to this standard defined in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// The resulting tag is canonicalized using the canonicalization type c. -func (c CanonType) Parse(s string) (t Tag, err error) { - defer func() { - if recover() != nil { - t = Tag{} - err = language.ErrSyntax - } - }() - - tt, err := language.Parse(s) - if err != nil { - return makeTag(tt), err - } - tt, changed := canonicalize(c, tt) - if changed { - tt.RemakeString() - } - return makeTag(tt), err -} - -// Compose creates a Tag from individual parts, which may be of type Tag, Base, -// Script, Region, Variant, []Variant, Extension, []Extension or error. If a -// Base, Script or Region or slice of type Variant or Extension is passed more -// than once, the latter will overwrite the former. Variants and Extensions are -// accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. For -u extensions, though, the key-type pairs are -// added, where later values overwrite older ones. A Tag overwrites all former -// values and typically only makes sense as the first argument. The resulting -// tag is returned after canonicalizing using the Default CanonType. If one or -// more errors are encountered, one of the errors is returned. -func Compose(part ...interface{}) (t Tag, err error) { - return Default.Compose(part...) -} - -// Compose creates a Tag from individual parts, which may be of type Tag, Base, -// Script, Region, Variant, []Variant, Extension, []Extension or error. If a -// Base, Script or Region or slice of type Variant or Extension is passed more -// than once, the latter will overwrite the former. Variants and Extensions are -// accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. For -u extensions, though, the key-type pairs are -// added, where later values overwrite older ones. A Tag overwrites all former -// values and typically only makes sense as the first argument. The resulting -// tag is returned after canonicalizing using CanonType c. If one or more errors -// are encountered, one of the errors is returned. -func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { - defer func() { - if recover() != nil { - t = Tag{} - err = language.ErrSyntax - } - }() - - var b language.Builder - if err = update(&b, part...); err != nil { - return und, err - } - b.Tag, _ = canonicalize(c, b.Tag) - return makeTag(b.Make()), err -} - -var errInvalidArgument = errors.New("invalid Extension or Variant") - -func update(b *language.Builder, part ...interface{}) (err error) { - for _, x := range part { - switch v := x.(type) { - case Tag: - b.SetTag(v.tag()) - case Base: - b.Tag.LangID = v.langID - case Script: - b.Tag.ScriptID = v.scriptID - case Region: - b.Tag.RegionID = v.regionID - case Variant: - if v.variant == "" { - err = errInvalidArgument - break - } - b.AddVariant(v.variant) - case Extension: - if v.s == "" { - err = errInvalidArgument - break - } - b.SetExt(v.s) - case []Variant: - b.ClearVariants() - for _, v := range v { - b.AddVariant(v.variant) - } - case []Extension: - b.ClearExtensions() - for _, e := range v { - b.SetExt(e.s) - } - // TODO: support parsing of raw strings based on morphology or just extensions? - case error: - if v != nil { - err = v - } - } - } - return -} - -var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") -var errTagListTooLarge = errors.New("tag list exceeds max length") - -// ParseAcceptLanguage parses the contents of an Accept-Language header as -// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and -// a list of corresponding quality weights. It is more permissive than RFC 2616 -// and may return non-nil slices even if the input is not valid. -// The Tags will be sorted by highest weight first and then by first occurrence. -// Tags with a weight of zero will be dropped. An error will be returned if the -// input could not be parsed. -func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { - defer func() { - if recover() != nil { - tag = nil - q = nil - err = language.ErrSyntax - } - }() - - if strings.Count(s, "-") > 1000 { - return nil, nil, errTagListTooLarge - } - - var entry string - for s != "" { - if entry, s = split(s, ','); entry == "" { - continue - } - - entry, weight := split(entry, ';') - - // Scan the language. - t, err := Parse(entry) - if err != nil { - id, ok := acceptFallback[entry] - if !ok { - return nil, nil, err - } - t = makeTag(language.Tag{LangID: id}) - } - - // Scan the optional weight. - w := 1.0 - if weight != "" { - weight = consume(weight, 'q') - weight = consume(weight, '=') - // consume returns the empty string when a token could not be - // consumed, resulting in an error for ParseFloat. - if w, err = strconv.ParseFloat(weight, 32); err != nil { - return nil, nil, errInvalidWeight - } - // Drop tags with a quality weight of 0. - if w <= 0 { - continue - } - } - - tag = append(tag, t) - q = append(q, float32(w)) - } - sort.Stable(&tagSort{tag, q}) - return tag, q, nil -} - -// consume removes a leading token c from s and returns the result or the empty -// string if there is no such token. -func consume(s string, c byte) string { - if s == "" || s[0] != c { - return "" - } - return strings.TrimSpace(s[1:]) -} - -func split(s string, c byte) (head, tail string) { - if i := strings.IndexByte(s, c); i >= 0 { - return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) - } - return strings.TrimSpace(s), "" -} - -// Add hack mapping to deal with a small number of cases that occur -// in Accept-Language (with reasonable frequency). -var acceptFallback = map[string]language.Language{ - "english": _en, - "deutsch": _de, - "italian": _it, - "french": _fr, - "*": _mul, // defined in the spec to match all languages. -} - -type tagSort struct { - tag []Tag - q []float32 -} - -func (s *tagSort) Len() int { - return len(s.q) -} - -func (s *tagSort) Less(i, j int) bool { - return s.q[i] > s.q[j] -} - -func (s *tagSort) Swap(i, j int) { - s.tag[i], s.tag[j] = s.tag[j], s.tag[i] - s.q[i], s.q[j] = s.q[j], s.q[i] -} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go deleted file mode 100644 index 34a732b699..0000000000 --- a/vendor/golang.org/x/text/language/tables.go +++ /dev/null @@ -1,298 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "32" - -const ( - _de = 269 - _en = 313 - _fr = 350 - _it = 505 - _mo = 784 - _no = 879 - _nb = 839 - _pt = 960 - _sh = 1031 - _mul = 806 - _und = 0 -) -const ( - _001 = 1 - _419 = 31 - _BR = 65 - _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 -) -const ( - _Latn = 90 - _Hani = 57 - _Hans = 59 - _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 -) - -var regionToGroups = []uint8{ // 358 elements - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, - // Entry 40 - 7F - 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, - // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 100 - 13F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, - // Entry 140 - 17F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes - -var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, - 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, -} // Size: 42 bytes - -type mutualIntelligibility struct { - want uint16 - have uint16 - distance uint8 - oneway bool -} -type scriptIntelligibility struct { - wantLang uint16 - haveLang uint16 - wantScript uint8 - haveScript uint8 - distance uint8 -} -type regionIntelligibility struct { - lang uint16 - script uint8 - group uint8 - distance uint8 -} - -// matchLang holds pairs of langIDs of base languages that are typically -// mutually intelligible. Each pair is associated with a confidence and -// whether the intelligibility goes one or both ways. -var matchLang = []mutualIntelligibility{ // 113 elements - 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, - 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, - 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, - 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false}, - 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false}, - 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true}, - 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true}, - 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false}, - 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false}, - 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true}, - 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true}, - 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true}, - 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true}, - 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true}, - 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true}, - 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true}, - 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true}, - 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true}, - 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true}, - 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true}, - 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true}, - 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true}, - 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, - 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true}, - 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true}, - 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true}, - 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true}, - 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true}, - 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true}, - 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true}, - 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true}, - 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true}, - 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true}, - 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true}, - 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true}, - 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true}, - 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true}, - 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true}, - 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true}, - 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true}, - 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true}, - 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true}, - 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true}, - 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true}, - 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true}, - 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true}, - 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true}, - 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true}, - 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true}, - 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true}, - 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true}, - 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true}, - 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true}, - 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true}, - 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true}, - 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true}, - 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true}, - 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true}, - 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true}, - 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true}, - 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true}, - 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true}, - 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true}, - 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true}, - 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true}, - 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true}, - 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true}, - 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true}, - 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true}, - 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true}, - 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true}, - 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false}, - 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true}, - 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true}, - 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true}, - 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true}, - 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true}, - 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true}, - 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true}, - 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true}, - 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true}, - 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true}, - 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true}, - 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true}, - 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true}, - 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true}, - 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true}, - 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true}, - 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true}, - 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true}, - 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true}, - 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true}, - 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true}, - 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true}, - 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true}, - 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true}, - 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true}, - 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true}, - 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true}, - 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true}, - 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true}, - 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true}, - 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true}, - 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true}, - 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true}, - 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true}, - 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true}, - 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true}, - 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true}, - 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true}, - 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, - 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, - 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, -} // Size: 702 bytes - -// matchScript holds pairs of scriptIDs where readers of one script -// can typically also read the other. Each is associated with a confidence. -var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, - 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, - 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, - 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, -} // Size: 232 bytes - -var matchRegion = []regionIntelligibility{ // 15 elements - 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, - 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, - 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, - 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4}, - 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4}, - 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4}, - 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4}, - 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4}, - 8: {lang: 0x529, script: 0x3c, group: 0x2, distance: 0x4}, - 9: {lang: 0x529, script: 0x3c, group: 0x82, distance: 0x4}, - 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, - 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5}, - 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, - 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, - 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, -} // Size: 114 bytes - -// Total table size 1472 bytes (1KiB); checksum: F86C669 diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go deleted file mode 100644 index 42ea792666..0000000000 --- a/vendor/golang.org/x/text/language/tags.go +++ /dev/null @@ -1,145 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import "golang.org/x/text/internal/language/compact" - -// TODO: Various sets of commonly use tags and regions. - -// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. -// It simplifies safe initialization of Tag values. -func MustParse(s string) Tag { - t, err := Parse(s) - if err != nil { - panic(err) - } - return t -} - -// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. -// It simplifies safe initialization of Tag values. -func (c CanonType) MustParse(s string) Tag { - t, err := c.Parse(s) - if err != nil { - panic(err) - } - return t -} - -// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. -// It simplifies safe initialization of Base values. -func MustParseBase(s string) Base { - b, err := ParseBase(s) - if err != nil { - panic(err) - } - return b -} - -// MustParseScript is like ParseScript, but panics if the given script cannot be -// parsed. It simplifies safe initialization of Script values. -func MustParseScript(s string) Script { - scr, err := ParseScript(s) - if err != nil { - panic(err) - } - return scr -} - -// MustParseRegion is like ParseRegion, but panics if the given region cannot be -// parsed. It simplifies safe initialization of Region values. -func MustParseRegion(s string) Region { - r, err := ParseRegion(s) - if err != nil { - panic(err) - } - return r -} - -var ( - und = Tag{} - - Und Tag = Tag{} - - Afrikaans Tag = Tag(compact.Afrikaans) - Amharic Tag = Tag(compact.Amharic) - Arabic Tag = Tag(compact.Arabic) - ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) - Azerbaijani Tag = Tag(compact.Azerbaijani) - Bulgarian Tag = Tag(compact.Bulgarian) - Bengali Tag = Tag(compact.Bengali) - Catalan Tag = Tag(compact.Catalan) - Czech Tag = Tag(compact.Czech) - Danish Tag = Tag(compact.Danish) - German Tag = Tag(compact.German) - Greek Tag = Tag(compact.Greek) - English Tag = Tag(compact.English) - AmericanEnglish Tag = Tag(compact.AmericanEnglish) - BritishEnglish Tag = Tag(compact.BritishEnglish) - Spanish Tag = Tag(compact.Spanish) - EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) - LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) - Estonian Tag = Tag(compact.Estonian) - Persian Tag = Tag(compact.Persian) - Finnish Tag = Tag(compact.Finnish) - Filipino Tag = Tag(compact.Filipino) - French Tag = Tag(compact.French) - CanadianFrench Tag = Tag(compact.CanadianFrench) - Gujarati Tag = Tag(compact.Gujarati) - Hebrew Tag = Tag(compact.Hebrew) - Hindi Tag = Tag(compact.Hindi) - Croatian Tag = Tag(compact.Croatian) - Hungarian Tag = Tag(compact.Hungarian) - Armenian Tag = Tag(compact.Armenian) - Indonesian Tag = Tag(compact.Indonesian) - Icelandic Tag = Tag(compact.Icelandic) - Italian Tag = Tag(compact.Italian) - Japanese Tag = Tag(compact.Japanese) - Georgian Tag = Tag(compact.Georgian) - Kazakh Tag = Tag(compact.Kazakh) - Khmer Tag = Tag(compact.Khmer) - Kannada Tag = Tag(compact.Kannada) - Korean Tag = Tag(compact.Korean) - Kirghiz Tag = Tag(compact.Kirghiz) - Lao Tag = Tag(compact.Lao) - Lithuanian Tag = Tag(compact.Lithuanian) - Latvian Tag = Tag(compact.Latvian) - Macedonian Tag = Tag(compact.Macedonian) - Malayalam Tag = Tag(compact.Malayalam) - Mongolian Tag = Tag(compact.Mongolian) - Marathi Tag = Tag(compact.Marathi) - Malay Tag = Tag(compact.Malay) - Burmese Tag = Tag(compact.Burmese) - Nepali Tag = Tag(compact.Nepali) - Dutch Tag = Tag(compact.Dutch) - Norwegian Tag = Tag(compact.Norwegian) - Punjabi Tag = Tag(compact.Punjabi) - Polish Tag = Tag(compact.Polish) - Portuguese Tag = Tag(compact.Portuguese) - BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) - EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) - Romanian Tag = Tag(compact.Romanian) - Russian Tag = Tag(compact.Russian) - Sinhala Tag = Tag(compact.Sinhala) - Slovak Tag = Tag(compact.Slovak) - Slovenian Tag = Tag(compact.Slovenian) - Albanian Tag = Tag(compact.Albanian) - Serbian Tag = Tag(compact.Serbian) - SerbianLatin Tag = Tag(compact.SerbianLatin) - Swedish Tag = Tag(compact.Swedish) - Swahili Tag = Tag(compact.Swahili) - Tamil Tag = Tag(compact.Tamil) - Telugu Tag = Tag(compact.Telugu) - Thai Tag = Tag(compact.Thai) - Turkish Tag = Tag(compact.Turkish) - Ukrainian Tag = Tag(compact.Ukrainian) - Urdu Tag = Tag(compact.Urdu) - Uzbek Tag = Tag(compact.Uzbek) - Vietnamese Tag = Tag(compact.Vietnamese) - Chinese Tag = Tag(compact.Chinese) - SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) - TraditionalChinese Tag = Tag(compact.TraditionalChinese) - Zulu Tag = Tag(compact.Zulu) -) diff --git a/vendor/knative.dev/networking/pkg/client/injection/client/client.go b/vendor/knative.dev/networking/pkg/client/injection/client/client.go index 03d392120a..16ef2d17cd 100644 --- a/vendor/knative.dev/networking/pkg/client/injection/client/client.go +++ b/vendor/knative.dev/networking/pkg/client/injection/client/client.go @@ -20,24 +20,10 @@ package client import ( context "context" - json "encoding/json" - errors "errors" - fmt "fmt" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - unstructured "k8s.io/apimachinery/pkg/apis/meta/v1/unstructured" - runtime "k8s.io/apimachinery/pkg/runtime" - schema "k8s.io/apimachinery/pkg/runtime/schema" - types "k8s.io/apimachinery/pkg/types" - watch "k8s.io/apimachinery/pkg/watch" - discovery "k8s.io/client-go/discovery" - dynamic "k8s.io/client-go/dynamic" rest "k8s.io/client-go/rest" - v1alpha1 "knative.dev/networking/pkg/apis/networking/v1alpha1" versioned "knative.dev/networking/pkg/client/clientset/versioned" - typednetworkingv1alpha1 "knative.dev/networking/pkg/client/clientset/versioned/typed/networking/v1alpha1" injection "knative.dev/pkg/injection" - dynamicclient "knative.dev/pkg/injection/clients/dynamicclient" logging "knative.dev/pkg/logging" ) @@ -46,7 +32,6 @@ func init() { injection.Default.RegisterClientFetcher(func(ctx context.Context) interface{} { return Get(ctx) }) - injection.Dynamic.RegisterDynamicClient(withClientFromDynamic) } // Key is used as the key for associating information with a context.Context. @@ -56,10 +41,6 @@ func withClientFromConfig(ctx context.Context, cfg *rest.Config) context.Context return context.WithValue(ctx, Key{}, versioned.NewForConfigOrDie(cfg)) } -func withClientFromDynamic(ctx context.Context) context.Context { - return context.WithValue(ctx, Key{}, &wrapClient{dyn: dynamicclient.Get(ctx)}) -} - // Get extracts the versioned.Interface client from the context. func Get(ctx context.Context) versioned.Interface { untyped := ctx.Value(Key{}) @@ -74,813 +55,3 @@ func Get(ctx context.Context) versioned.Interface { } return untyped.(versioned.Interface) } - -type wrapClient struct { - dyn dynamic.Interface -} - -var _ versioned.Interface = (*wrapClient)(nil) - -func (w *wrapClient) Discovery() discovery.DiscoveryInterface { - panic("Discovery called on dynamic client!") -} - -func convert(from interface{}, to runtime.Object) error { - bs, err := json.Marshal(from) - if err != nil { - return fmt.Errorf("Marshal() = %w", err) - } - if err := json.Unmarshal(bs, to); err != nil { - return fmt.Errorf("Unmarshal() = %w", err) - } - return nil -} - -// NetworkingV1alpha1 retrieves the NetworkingV1alpha1Client -func (w *wrapClient) NetworkingV1alpha1() typednetworkingv1alpha1.NetworkingV1alpha1Interface { - return &wrapNetworkingV1alpha1{ - dyn: w.dyn, - } -} - -type wrapNetworkingV1alpha1 struct { - dyn dynamic.Interface -} - -func (w *wrapNetworkingV1alpha1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapNetworkingV1alpha1) Certificates(namespace string) typednetworkingv1alpha1.CertificateInterface { - return &wrapNetworkingV1alpha1CertificateImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Resource: "certificates", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1alpha1CertificateImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1alpha1.CertificateInterface = (*wrapNetworkingV1alpha1CertificateImpl)(nil) - -func (w *wrapNetworkingV1alpha1CertificateImpl) Create(ctx context.Context, in *v1alpha1.Certificate, opts v1.CreateOptions) (*v1alpha1.Certificate, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "Certificate", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Certificate{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1CertificateImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1alpha1CertificateImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1alpha1CertificateImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1alpha1.Certificate, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Certificate{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1CertificateImpl) List(ctx context.Context, opts v1.ListOptions) (*v1alpha1.CertificateList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.CertificateList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1CertificateImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1alpha1.Certificate, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Certificate{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1CertificateImpl) Update(ctx context.Context, in *v1alpha1.Certificate, opts v1.UpdateOptions) (*v1alpha1.Certificate, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "Certificate", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Certificate{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1CertificateImpl) UpdateStatus(ctx context.Context, in *v1alpha1.Certificate, opts v1.UpdateOptions) (*v1alpha1.Certificate, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "Certificate", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Certificate{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1CertificateImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1alpha1) ClusterDomainClaims() typednetworkingv1alpha1.ClusterDomainClaimInterface { - return &wrapNetworkingV1alpha1ClusterDomainClaimImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Resource: "clusterdomainclaims", - }), - } -} - -type wrapNetworkingV1alpha1ClusterDomainClaimImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typednetworkingv1alpha1.ClusterDomainClaimInterface = (*wrapNetworkingV1alpha1ClusterDomainClaimImpl)(nil) - -func (w *wrapNetworkingV1alpha1ClusterDomainClaimImpl) Create(ctx context.Context, in *v1alpha1.ClusterDomainClaim, opts v1.CreateOptions) (*v1alpha1.ClusterDomainClaim, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "ClusterDomainClaim", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.ClusterDomainClaim{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterDomainClaimImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1alpha1ClusterDomainClaimImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1alpha1ClusterDomainClaimImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1alpha1.ClusterDomainClaim, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.ClusterDomainClaim{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterDomainClaimImpl) List(ctx context.Context, opts v1.ListOptions) (*v1alpha1.ClusterDomainClaimList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.ClusterDomainClaimList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterDomainClaimImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1alpha1.ClusterDomainClaim, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.ClusterDomainClaim{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterDomainClaimImpl) Update(ctx context.Context, in *v1alpha1.ClusterDomainClaim, opts v1.UpdateOptions) (*v1alpha1.ClusterDomainClaim, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "ClusterDomainClaim", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.ClusterDomainClaim{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterDomainClaimImpl) UpdateStatus(ctx context.Context, in *v1alpha1.ClusterDomainClaim, opts v1.UpdateOptions) (*v1alpha1.ClusterDomainClaim, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "ClusterDomainClaim", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.ClusterDomainClaim{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterDomainClaimImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1alpha1) Domains() typednetworkingv1alpha1.DomainInterface { - return &wrapNetworkingV1alpha1DomainImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Resource: "domains", - }), - } -} - -type wrapNetworkingV1alpha1DomainImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typednetworkingv1alpha1.DomainInterface = (*wrapNetworkingV1alpha1DomainImpl)(nil) - -func (w *wrapNetworkingV1alpha1DomainImpl) Create(ctx context.Context, in *v1alpha1.Domain, opts v1.CreateOptions) (*v1alpha1.Domain, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "Domain", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Domain{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1DomainImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1alpha1DomainImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1alpha1DomainImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1alpha1.Domain, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Domain{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1DomainImpl) List(ctx context.Context, opts v1.ListOptions) (*v1alpha1.DomainList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.DomainList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1DomainImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1alpha1.Domain, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Domain{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1DomainImpl) Update(ctx context.Context, in *v1alpha1.Domain, opts v1.UpdateOptions) (*v1alpha1.Domain, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "Domain", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Domain{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1DomainImpl) UpdateStatus(ctx context.Context, in *v1alpha1.Domain, opts v1.UpdateOptions) (*v1alpha1.Domain, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "Domain", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Domain{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1DomainImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1alpha1) Ingresses(namespace string) typednetworkingv1alpha1.IngressInterface { - return &wrapNetworkingV1alpha1IngressImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Resource: "ingresses", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1alpha1IngressImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1alpha1.IngressInterface = (*wrapNetworkingV1alpha1IngressImpl)(nil) - -func (w *wrapNetworkingV1alpha1IngressImpl) Create(ctx context.Context, in *v1alpha1.Ingress, opts v1.CreateOptions) (*v1alpha1.Ingress, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "Ingress", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1IngressImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1alpha1IngressImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1alpha1IngressImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1alpha1.Ingress, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1IngressImpl) List(ctx context.Context, opts v1.ListOptions) (*v1alpha1.IngressList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.IngressList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1IngressImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1alpha1.Ingress, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1IngressImpl) Update(ctx context.Context, in *v1alpha1.Ingress, opts v1.UpdateOptions) (*v1alpha1.Ingress, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "Ingress", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1IngressImpl) UpdateStatus(ctx context.Context, in *v1alpha1.Ingress, opts v1.UpdateOptions) (*v1alpha1.Ingress, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "Ingress", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1IngressImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1alpha1) Realms() typednetworkingv1alpha1.RealmInterface { - return &wrapNetworkingV1alpha1RealmImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Resource: "realms", - }), - } -} - -type wrapNetworkingV1alpha1RealmImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typednetworkingv1alpha1.RealmInterface = (*wrapNetworkingV1alpha1RealmImpl)(nil) - -func (w *wrapNetworkingV1alpha1RealmImpl) Create(ctx context.Context, in *v1alpha1.Realm, opts v1.CreateOptions) (*v1alpha1.Realm, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "Realm", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Realm{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1RealmImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1alpha1RealmImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1alpha1RealmImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1alpha1.Realm, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Realm{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1RealmImpl) List(ctx context.Context, opts v1.ListOptions) (*v1alpha1.RealmList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.RealmList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1RealmImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1alpha1.Realm, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Realm{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1RealmImpl) Update(ctx context.Context, in *v1alpha1.Realm, opts v1.UpdateOptions) (*v1alpha1.Realm, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "Realm", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Realm{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1RealmImpl) UpdateStatus(ctx context.Context, in *v1alpha1.Realm, opts v1.UpdateOptions) (*v1alpha1.Realm, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "Realm", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.Realm{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1RealmImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1alpha1) ServerlessServices(namespace string) typednetworkingv1alpha1.ServerlessServiceInterface { - return &wrapNetworkingV1alpha1ServerlessServiceImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Resource: "serverlessservices", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1alpha1ServerlessServiceImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1alpha1.ServerlessServiceInterface = (*wrapNetworkingV1alpha1ServerlessServiceImpl)(nil) - -func (w *wrapNetworkingV1alpha1ServerlessServiceImpl) Create(ctx context.Context, in *v1alpha1.ServerlessService, opts v1.CreateOptions) (*v1alpha1.ServerlessService, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "ServerlessService", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.ServerlessService{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ServerlessServiceImpl) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1alpha1ServerlessServiceImpl) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1alpha1ServerlessServiceImpl) Get(ctx context.Context, name string, opts v1.GetOptions) (*v1alpha1.ServerlessService, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.ServerlessService{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ServerlessServiceImpl) List(ctx context.Context, opts v1.ListOptions) (*v1alpha1.ServerlessServiceList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.ServerlessServiceList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ServerlessServiceImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1alpha1.ServerlessService, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.ServerlessService{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ServerlessServiceImpl) Update(ctx context.Context, in *v1alpha1.ServerlessService, opts v1.UpdateOptions) (*v1alpha1.ServerlessService, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "ServerlessService", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.ServerlessService{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ServerlessServiceImpl) UpdateStatus(ctx context.Context, in *v1alpha1.ServerlessService, opts v1.UpdateOptions) (*v1alpha1.ServerlessService, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.internal.knative.dev", - Version: "v1alpha1", - Kind: "ServerlessService", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &v1alpha1.ServerlessService{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ServerlessServiceImpl) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} diff --git a/vendor/knative.dev/networking/pkg/client/injection/informers/networking/v1alpha1/certificate/certificate.go b/vendor/knative.dev/networking/pkg/client/injection/informers/networking/v1alpha1/certificate/certificate.go index 844c25b6d3..b88624278c 100644 --- a/vendor/knative.dev/networking/pkg/client/injection/informers/networking/v1alpha1/certificate/certificate.go +++ b/vendor/knative.dev/networking/pkg/client/injection/informers/networking/v1alpha1/certificate/certificate.go @@ -21,15 +21,8 @@ package certificate import ( context "context" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - apisnetworkingv1alpha1 "knative.dev/networking/pkg/apis/networking/v1alpha1" - versioned "knative.dev/networking/pkg/client/clientset/versioned" v1alpha1 "knative.dev/networking/pkg/client/informers/externalversions/networking/v1alpha1" - client "knative.dev/networking/pkg/client/injection/client" factory "knative.dev/networking/pkg/client/injection/informers/factory" - networkingv1alpha1 "knative.dev/networking/pkg/client/listers/networking/v1alpha1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1alpha1.CertificateInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1alpha1.CertificateInformer { } return untyped.(v1alpha1.CertificateInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - resourceVersion string -} - -var _ v1alpha1.CertificateInformer = (*wrapper)(nil) -var _ networkingv1alpha1.CertificateLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1alpha1.Certificate{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1alpha1.CertificateLister { - return w -} - -func (w *wrapper) Certificates(namespace string) networkingv1alpha1.CertificateNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1alpha1.Certificate, err error) { - lo, err := w.client.NetworkingV1alpha1().Certificates(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, &lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1alpha1.Certificate, error) { - return w.client.NetworkingV1alpha1().Certificates(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/vendor/knative.dev/networking/pkg/client/injection/informers/networking/v1alpha1/ingress/ingress.go b/vendor/knative.dev/networking/pkg/client/injection/informers/networking/v1alpha1/ingress/ingress.go index e86f9ff2ea..81ef41871e 100644 --- a/vendor/knative.dev/networking/pkg/client/injection/informers/networking/v1alpha1/ingress/ingress.go +++ b/vendor/knative.dev/networking/pkg/client/injection/informers/networking/v1alpha1/ingress/ingress.go @@ -21,15 +21,8 @@ package ingress import ( context "context" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - apisnetworkingv1alpha1 "knative.dev/networking/pkg/apis/networking/v1alpha1" - versioned "knative.dev/networking/pkg/client/clientset/versioned" v1alpha1 "knative.dev/networking/pkg/client/informers/externalversions/networking/v1alpha1" - client "knative.dev/networking/pkg/client/injection/client" factory "knative.dev/networking/pkg/client/injection/informers/factory" - networkingv1alpha1 "knative.dev/networking/pkg/client/listers/networking/v1alpha1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1alpha1.IngressInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1alpha1.IngressInformer { } return untyped.(v1alpha1.IngressInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - resourceVersion string -} - -var _ v1alpha1.IngressInformer = (*wrapper)(nil) -var _ networkingv1alpha1.IngressLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1alpha1.Ingress{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1alpha1.IngressLister { - return w -} - -func (w *wrapper) Ingresses(namespace string) networkingv1alpha1.IngressNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1alpha1.Ingress, err error) { - lo, err := w.client.NetworkingV1alpha1().Ingresses(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, &lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1alpha1.Ingress, error) { - return w.client.NetworkingV1alpha1().Ingresses(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/vendor/knative.dev/networking/pkg/client/injection/informers/networking/v1alpha1/serverlessservice/serverlessservice.go b/vendor/knative.dev/networking/pkg/client/injection/informers/networking/v1alpha1/serverlessservice/serverlessservice.go index af988b44f7..c3dc668d10 100644 --- a/vendor/knative.dev/networking/pkg/client/injection/informers/networking/v1alpha1/serverlessservice/serverlessservice.go +++ b/vendor/knative.dev/networking/pkg/client/injection/informers/networking/v1alpha1/serverlessservice/serverlessservice.go @@ -21,15 +21,8 @@ package serverlessservice import ( context "context" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" - cache "k8s.io/client-go/tools/cache" - apisnetworkingv1alpha1 "knative.dev/networking/pkg/apis/networking/v1alpha1" - versioned "knative.dev/networking/pkg/client/clientset/versioned" v1alpha1 "knative.dev/networking/pkg/client/informers/externalversions/networking/v1alpha1" - client "knative.dev/networking/pkg/client/injection/client" factory "knative.dev/networking/pkg/client/injection/informers/factory" - networkingv1alpha1 "knative.dev/networking/pkg/client/listers/networking/v1alpha1" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" logging "knative.dev/pkg/logging" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1alpha1.ServerlessServiceInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1alpha1.ServerlessServiceInformer { } return untyped.(v1alpha1.ServerlessServiceInformer) } - -type wrapper struct { - client versioned.Interface - - namespace string - - resourceVersion string -} - -var _ v1alpha1.ServerlessServiceInformer = (*wrapper)(nil) -var _ networkingv1alpha1.ServerlessServiceLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apisnetworkingv1alpha1.ServerlessService{}, 0, nil) -} - -func (w *wrapper) Lister() networkingv1alpha1.ServerlessServiceLister { - return w -} - -func (w *wrapper) ServerlessServices(namespace string) networkingv1alpha1.ServerlessServiceNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apisnetworkingv1alpha1.ServerlessService, err error) { - lo, err := w.client.NetworkingV1alpha1().ServerlessServices(w.namespace).List(context.TODO(), v1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, &lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apisnetworkingv1alpha1.ServerlessService, error) { - return w.client.NetworkingV1alpha1().ServerlessServices(w.namespace).Get(context.TODO(), name, v1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/vendor/knative.dev/networking/pkg/config/config.go b/vendor/knative.dev/networking/pkg/config/config.go index 8483707d1a..47cf440cde 100644 --- a/vendor/knative.dev/networking/pkg/config/config.go +++ b/vendor/knative.dev/networking/pkg/config/config.go @@ -405,6 +405,10 @@ func NewConfigFromMap(data map[string]string) (*Config, error) { case "", string(TrustDisabled): // If DataplaneTrus is not set in the config-network, default is already // set to TrustDisabled. + if nc.InternalEncryption { + // Backward compatibility + nc.DataplaneTrust = TrustMinimal + } case string(TrustMinimal): nc.DataplaneTrust = TrustMinimal case string(TrustEnabled): diff --git a/vendor/knative.dev/pkg/apis/duck/v1/destination.go b/vendor/knative.dev/pkg/apis/duck/v1/destination.go index 15638f4018..8e067a99b5 100644 --- a/vendor/knative.dev/pkg/apis/duck/v1/destination.go +++ b/vendor/knative.dev/pkg/apis/duck/v1/destination.go @@ -18,6 +18,8 @@ package v1 import ( "context" + "crypto/x509" + "encoding/pem" "knative.dev/pkg/apis" ) @@ -53,6 +55,7 @@ func (d *Destination) Validate(ctx context.Context) *apis.FieldError { func ValidateDestination(ctx context.Context, dest Destination) *apis.FieldError { ref := dest.Ref uri := dest.URI + caCerts := dest.CACerts if ref == nil && uri == nil { return apis.ErrGeneric("expected at least one, got none", "ref", "uri") } @@ -67,6 +70,9 @@ func ValidateDestination(ctx context.Context, dest Destination) *apis.FieldError if ref != nil && uri == nil { return ref.Validate(ctx).ViaField("ref") } + if caCerts != nil { + return validateCACerts(caCerts) + } return nil } @@ -88,3 +94,20 @@ func (d *Destination) SetDefaults(ctx context.Context) { d.Ref.Namespace = apis.ParentMeta(ctx).Namespace } } + +func validateCACerts(CACert *string) *apis.FieldError { + // Check the object. + var errs *apis.FieldError + + block, err := pem.Decode([]byte(*CACert)) + if err != nil && block == nil { + errs = errs.Also(apis.ErrInvalidValue("CA Cert provided is invalid", "caCert")) + return errs + } + if block.Type != "CERTIFICATE" { + errs = errs.Also(apis.ErrInvalidValue("CA Cert provided is not a certificate", "caCert")) + } else if _, err := x509.ParseCertificate(block.Bytes); err != nil { + errs = errs.Also(apis.ErrInvalidValue("CA Cert provided is invalid", "caCert")) + } + return errs +} diff --git a/vendor/knative.dev/pkg/client/injection/kube/client/client.go b/vendor/knative.dev/pkg/client/injection/kube/client/client.go index f490241e1d..b5735bbb06 100644 --- a/vendor/knative.dev/pkg/client/injection/kube/client/client.go +++ b/vendor/knative.dev/pkg/client/injection/kube/client/client.go @@ -20,158 +20,11 @@ package client import ( context "context" - json "encoding/json" - errors "errors" - fmt "fmt" - admissionregistrationv1 "k8s.io/api/admissionregistration/v1" - admissionregistrationv1beta1 "k8s.io/api/admissionregistration/v1beta1" - apiserverinternalv1alpha1 "k8s.io/api/apiserverinternal/v1alpha1" - apiappsv1 "k8s.io/api/apps/v1" - apiappsv1beta1 "k8s.io/api/apps/v1beta1" - appsv1beta2 "k8s.io/api/apps/v1beta2" - authenticationv1 "k8s.io/api/authentication/v1" - authenticationv1beta1 "k8s.io/api/authentication/v1beta1" - authorizationv1 "k8s.io/api/authorization/v1" - authorizationv1beta1 "k8s.io/api/authorization/v1beta1" - autoscalingv1 "k8s.io/api/autoscaling/v1" - autoscalingv2 "k8s.io/api/autoscaling/v2" - autoscalingv2beta1 "k8s.io/api/autoscaling/v2beta1" - autoscalingv2beta2 "k8s.io/api/autoscaling/v2beta2" - apibatchv1 "k8s.io/api/batch/v1" - apibatchv1beta1 "k8s.io/api/batch/v1beta1" - apicertificatesv1 "k8s.io/api/certificates/v1" - apicertificatesv1beta1 "k8s.io/api/certificates/v1beta1" - apicoordinationv1 "k8s.io/api/coordination/v1" - apicoordinationv1beta1 "k8s.io/api/coordination/v1beta1" - apicorev1 "k8s.io/api/core/v1" - apidiscoveryv1 "k8s.io/api/discovery/v1" - apidiscoveryv1beta1 "k8s.io/api/discovery/v1beta1" - apieventsv1 "k8s.io/api/events/v1" - apieventsv1beta1 "k8s.io/api/events/v1beta1" - apiextensionsv1beta1 "k8s.io/api/extensions/v1beta1" - apiflowcontrolv1alpha1 "k8s.io/api/flowcontrol/v1alpha1" - apiflowcontrolv1beta1 "k8s.io/api/flowcontrol/v1beta1" - apiflowcontrolv1beta2 "k8s.io/api/flowcontrol/v1beta2" - apinetworkingv1 "k8s.io/api/networking/v1" - apinetworkingv1alpha1 "k8s.io/api/networking/v1alpha1" - apinetworkingv1beta1 "k8s.io/api/networking/v1beta1" - apinodev1 "k8s.io/api/node/v1" - apinodev1alpha1 "k8s.io/api/node/v1alpha1" - apinodev1beta1 "k8s.io/api/node/v1beta1" - apipolicyv1 "k8s.io/api/policy/v1" - apipolicyv1beta1 "k8s.io/api/policy/v1beta1" - apirbacv1 "k8s.io/api/rbac/v1" - apirbacv1alpha1 "k8s.io/api/rbac/v1alpha1" - apirbacv1beta1 "k8s.io/api/rbac/v1beta1" - apischedulingv1 "k8s.io/api/scheduling/v1" - apischedulingv1alpha1 "k8s.io/api/scheduling/v1alpha1" - apischedulingv1beta1 "k8s.io/api/scheduling/v1beta1" - apistoragev1 "k8s.io/api/storage/v1" - apistoragev1alpha1 "k8s.io/api/storage/v1alpha1" - apistoragev1beta1 "k8s.io/api/storage/v1beta1" - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - unstructured "k8s.io/apimachinery/pkg/apis/meta/v1/unstructured" - runtime "k8s.io/apimachinery/pkg/runtime" - schema "k8s.io/apimachinery/pkg/runtime/schema" - types "k8s.io/apimachinery/pkg/types" - watch "k8s.io/apimachinery/pkg/watch" - v1 "k8s.io/client-go/applyconfigurations/admissionregistration/v1" - v1beta1 "k8s.io/client-go/applyconfigurations/admissionregistration/v1beta1" - v1alpha1 "k8s.io/client-go/applyconfigurations/apiserverinternal/v1alpha1" - appsv1 "k8s.io/client-go/applyconfigurations/apps/v1" - appsv1beta1 "k8s.io/client-go/applyconfigurations/apps/v1beta1" - v1beta2 "k8s.io/client-go/applyconfigurations/apps/v1beta2" - applyconfigurationsautoscalingv1 "k8s.io/client-go/applyconfigurations/autoscaling/v1" - v2 "k8s.io/client-go/applyconfigurations/autoscaling/v2" - v2beta1 "k8s.io/client-go/applyconfigurations/autoscaling/v2beta1" - v2beta2 "k8s.io/client-go/applyconfigurations/autoscaling/v2beta2" - batchv1 "k8s.io/client-go/applyconfigurations/batch/v1" - batchv1beta1 "k8s.io/client-go/applyconfigurations/batch/v1beta1" - certificatesv1 "k8s.io/client-go/applyconfigurations/certificates/v1" - certificatesv1beta1 "k8s.io/client-go/applyconfigurations/certificates/v1beta1" - coordinationv1 "k8s.io/client-go/applyconfigurations/coordination/v1" - coordinationv1beta1 "k8s.io/client-go/applyconfigurations/coordination/v1beta1" - corev1 "k8s.io/client-go/applyconfigurations/core/v1" - discoveryv1 "k8s.io/client-go/applyconfigurations/discovery/v1" - discoveryv1beta1 "k8s.io/client-go/applyconfigurations/discovery/v1beta1" - eventsv1 "k8s.io/client-go/applyconfigurations/events/v1" - eventsv1beta1 "k8s.io/client-go/applyconfigurations/events/v1beta1" - extensionsv1beta1 "k8s.io/client-go/applyconfigurations/extensions/v1beta1" - flowcontrolv1alpha1 "k8s.io/client-go/applyconfigurations/flowcontrol/v1alpha1" - flowcontrolv1beta1 "k8s.io/client-go/applyconfigurations/flowcontrol/v1beta1" - flowcontrolv1beta2 "k8s.io/client-go/applyconfigurations/flowcontrol/v1beta2" - networkingv1 "k8s.io/client-go/applyconfigurations/networking/v1" - networkingv1alpha1 "k8s.io/client-go/applyconfigurations/networking/v1alpha1" - networkingv1beta1 "k8s.io/client-go/applyconfigurations/networking/v1beta1" - nodev1 "k8s.io/client-go/applyconfigurations/node/v1" - nodev1alpha1 "k8s.io/client-go/applyconfigurations/node/v1alpha1" - nodev1beta1 "k8s.io/client-go/applyconfigurations/node/v1beta1" - policyv1 "k8s.io/client-go/applyconfigurations/policy/v1" - policyv1beta1 "k8s.io/client-go/applyconfigurations/policy/v1beta1" - rbacv1 "k8s.io/client-go/applyconfigurations/rbac/v1" - rbacv1alpha1 "k8s.io/client-go/applyconfigurations/rbac/v1alpha1" - rbacv1beta1 "k8s.io/client-go/applyconfigurations/rbac/v1beta1" - schedulingv1 "k8s.io/client-go/applyconfigurations/scheduling/v1" - schedulingv1alpha1 "k8s.io/client-go/applyconfigurations/scheduling/v1alpha1" - schedulingv1beta1 "k8s.io/client-go/applyconfigurations/scheduling/v1beta1" - storagev1 "k8s.io/client-go/applyconfigurations/storage/v1" - storagev1alpha1 "k8s.io/client-go/applyconfigurations/storage/v1alpha1" - storagev1beta1 "k8s.io/client-go/applyconfigurations/storage/v1beta1" - discovery "k8s.io/client-go/discovery" - dynamic "k8s.io/client-go/dynamic" kubernetes "k8s.io/client-go/kubernetes" - typedadmissionregistrationv1 "k8s.io/client-go/kubernetes/typed/admissionregistration/v1" - typedadmissionregistrationv1beta1 "k8s.io/client-go/kubernetes/typed/admissionregistration/v1beta1" - typedinternalv1alpha1 "k8s.io/client-go/kubernetes/typed/apiserverinternal/v1alpha1" - typedappsv1 "k8s.io/client-go/kubernetes/typed/apps/v1" - typedappsv1beta1 "k8s.io/client-go/kubernetes/typed/apps/v1beta1" - typedappsv1beta2 "k8s.io/client-go/kubernetes/typed/apps/v1beta2" - typedauthenticationv1 "k8s.io/client-go/kubernetes/typed/authentication/v1" - typedauthenticationv1beta1 "k8s.io/client-go/kubernetes/typed/authentication/v1beta1" - typedauthorizationv1 "k8s.io/client-go/kubernetes/typed/authorization/v1" - typedauthorizationv1beta1 "k8s.io/client-go/kubernetes/typed/authorization/v1beta1" - typedautoscalingv1 "k8s.io/client-go/kubernetes/typed/autoscaling/v1" - typedautoscalingv2 "k8s.io/client-go/kubernetes/typed/autoscaling/v2" - typedautoscalingv2beta1 "k8s.io/client-go/kubernetes/typed/autoscaling/v2beta1" - typedautoscalingv2beta2 "k8s.io/client-go/kubernetes/typed/autoscaling/v2beta2" - typedbatchv1 "k8s.io/client-go/kubernetes/typed/batch/v1" - typedbatchv1beta1 "k8s.io/client-go/kubernetes/typed/batch/v1beta1" - typedcertificatesv1 "k8s.io/client-go/kubernetes/typed/certificates/v1" - typedcertificatesv1beta1 "k8s.io/client-go/kubernetes/typed/certificates/v1beta1" - typedcoordinationv1 "k8s.io/client-go/kubernetes/typed/coordination/v1" - typedcoordinationv1beta1 "k8s.io/client-go/kubernetes/typed/coordination/v1beta1" - typedcorev1 "k8s.io/client-go/kubernetes/typed/core/v1" - typeddiscoveryv1 "k8s.io/client-go/kubernetes/typed/discovery/v1" - typeddiscoveryv1beta1 "k8s.io/client-go/kubernetes/typed/discovery/v1beta1" - typedeventsv1 "k8s.io/client-go/kubernetes/typed/events/v1" - typedeventsv1beta1 "k8s.io/client-go/kubernetes/typed/events/v1beta1" - typedextensionsv1beta1 "k8s.io/client-go/kubernetes/typed/extensions/v1beta1" - typedflowcontrolv1alpha1 "k8s.io/client-go/kubernetes/typed/flowcontrol/v1alpha1" - typedflowcontrolv1beta1 "k8s.io/client-go/kubernetes/typed/flowcontrol/v1beta1" - typedflowcontrolv1beta2 "k8s.io/client-go/kubernetes/typed/flowcontrol/v1beta2" - typednetworkingv1 "k8s.io/client-go/kubernetes/typed/networking/v1" - typednetworkingv1alpha1 "k8s.io/client-go/kubernetes/typed/networking/v1alpha1" - typednetworkingv1beta1 "k8s.io/client-go/kubernetes/typed/networking/v1beta1" - typednodev1 "k8s.io/client-go/kubernetes/typed/node/v1" - typednodev1alpha1 "k8s.io/client-go/kubernetes/typed/node/v1alpha1" - typednodev1beta1 "k8s.io/client-go/kubernetes/typed/node/v1beta1" - typedpolicyv1 "k8s.io/client-go/kubernetes/typed/policy/v1" - typedpolicyv1beta1 "k8s.io/client-go/kubernetes/typed/policy/v1beta1" - typedrbacv1 "k8s.io/client-go/kubernetes/typed/rbac/v1" - typedrbacv1alpha1 "k8s.io/client-go/kubernetes/typed/rbac/v1alpha1" - typedrbacv1beta1 "k8s.io/client-go/kubernetes/typed/rbac/v1beta1" - typedschedulingv1 "k8s.io/client-go/kubernetes/typed/scheduling/v1" - typedschedulingv1alpha1 "k8s.io/client-go/kubernetes/typed/scheduling/v1alpha1" - typedschedulingv1beta1 "k8s.io/client-go/kubernetes/typed/scheduling/v1beta1" - typedstoragev1 "k8s.io/client-go/kubernetes/typed/storage/v1" - typedstoragev1alpha1 "k8s.io/client-go/kubernetes/typed/storage/v1alpha1" - typedstoragev1beta1 "k8s.io/client-go/kubernetes/typed/storage/v1beta1" rest "k8s.io/client-go/rest" injection "knative.dev/pkg/injection" - dynamicclient "knative.dev/pkg/injection/clients/dynamicclient" logging "knative.dev/pkg/logging" - ptr "knative.dev/pkg/ptr" ) func init() { @@ -179,7 +32,6 @@ func init() { injection.Default.RegisterClientFetcher(func(ctx context.Context) interface{} { return Get(ctx) }) - injection.Dynamic.RegisterDynamicClient(withClientFromDynamic) } // Key is used as the key for associating information with a context.Context. @@ -189,10 +41,6 @@ func withClientFromConfig(ctx context.Context, cfg *rest.Config) context.Context return context.WithValue(ctx, Key{}, kubernetes.NewForConfigOrDie(cfg)) } -func withClientFromDynamic(ctx context.Context) context.Context { - return context.WithValue(ctx, Key{}, &wrapClient{dyn: dynamicclient.Get(ctx)}) -} - // Get extracts the kubernetes.Interface client from the context. func Get(ctx context.Context) kubernetes.Interface { untyped := ctx.Value(Key{}) @@ -207,18144 +55,3 @@ func Get(ctx context.Context) kubernetes.Interface { } return untyped.(kubernetes.Interface) } - -type wrapClient struct { - dyn dynamic.Interface -} - -var _ kubernetes.Interface = (*wrapClient)(nil) - -func (w *wrapClient) Discovery() discovery.DiscoveryInterface { - panic("Discovery called on dynamic client!") -} - -func convert(from interface{}, to runtime.Object) error { - bs, err := json.Marshal(from) - if err != nil { - return fmt.Errorf("Marshal() = %w", err) - } - if err := json.Unmarshal(bs, to); err != nil { - return fmt.Errorf("Unmarshal() = %w", err) - } - return nil -} - -// AdmissionregistrationV1 retrieves the AdmissionregistrationV1Client -func (w *wrapClient) AdmissionregistrationV1() typedadmissionregistrationv1.AdmissionregistrationV1Interface { - return &wrapAdmissionregistrationV1{ - dyn: w.dyn, - } -} - -type wrapAdmissionregistrationV1 struct { - dyn dynamic.Interface -} - -func (w *wrapAdmissionregistrationV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAdmissionregistrationV1) MutatingWebhookConfigurations() typedadmissionregistrationv1.MutatingWebhookConfigurationInterface { - return &wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "admissionregistration.k8s.io", - Version: "v1", - Resource: "mutatingwebhookconfigurations", - }), - } -} - -type wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedadmissionregistrationv1.MutatingWebhookConfigurationInterface = (*wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl)(nil) - -func (w *wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl) Apply(ctx context.Context, in *v1.MutatingWebhookConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *admissionregistrationv1.MutatingWebhookConfiguration, err error) { - in.Kind = ptr.String("MutatingWebhookConfiguration") - - in.APIVersion = ptr.String("admissionregistration.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl) ApplyStatus(ctx context.Context, in *v1.MutatingWebhookConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *admissionregistrationv1.MutatingWebhookConfiguration, err error) { - in.Kind = ptr.String("MutatingWebhookConfiguration") - - in.APIVersion = ptr.String("admissionregistration.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl) Create(ctx context.Context, in *admissionregistrationv1.MutatingWebhookConfiguration, opts metav1.CreateOptions) (*admissionregistrationv1.MutatingWebhookConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "admissionregistration.k8s.io", - Version: "v1", - Kind: "MutatingWebhookConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*admissionregistrationv1.MutatingWebhookConfiguration, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl) List(ctx context.Context, opts metav1.ListOptions) (*admissionregistrationv1.MutatingWebhookConfigurationList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.MutatingWebhookConfigurationList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *admissionregistrationv1.MutatingWebhookConfiguration, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl) Update(ctx context.Context, in *admissionregistrationv1.MutatingWebhookConfiguration, opts metav1.UpdateOptions) (*admissionregistrationv1.MutatingWebhookConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "admissionregistration.k8s.io", - Version: "v1", - Kind: "MutatingWebhookConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl) UpdateStatus(ctx context.Context, in *admissionregistrationv1.MutatingWebhookConfiguration, opts metav1.UpdateOptions) (*admissionregistrationv1.MutatingWebhookConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "admissionregistration.k8s.io", - Version: "v1", - Kind: "MutatingWebhookConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1MutatingWebhookConfigurationImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAdmissionregistrationV1) ValidatingWebhookConfigurations() typedadmissionregistrationv1.ValidatingWebhookConfigurationInterface { - return &wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "admissionregistration.k8s.io", - Version: "v1", - Resource: "validatingwebhookconfigurations", - }), - } -} - -type wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedadmissionregistrationv1.ValidatingWebhookConfigurationInterface = (*wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl)(nil) - -func (w *wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl) Apply(ctx context.Context, in *v1.ValidatingWebhookConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *admissionregistrationv1.ValidatingWebhookConfiguration, err error) { - in.Kind = ptr.String("ValidatingWebhookConfiguration") - - in.APIVersion = ptr.String("admissionregistration.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl) ApplyStatus(ctx context.Context, in *v1.ValidatingWebhookConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *admissionregistrationv1.ValidatingWebhookConfiguration, err error) { - in.Kind = ptr.String("ValidatingWebhookConfiguration") - - in.APIVersion = ptr.String("admissionregistration.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl) Create(ctx context.Context, in *admissionregistrationv1.ValidatingWebhookConfiguration, opts metav1.CreateOptions) (*admissionregistrationv1.ValidatingWebhookConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "admissionregistration.k8s.io", - Version: "v1", - Kind: "ValidatingWebhookConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*admissionregistrationv1.ValidatingWebhookConfiguration, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl) List(ctx context.Context, opts metav1.ListOptions) (*admissionregistrationv1.ValidatingWebhookConfigurationList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.ValidatingWebhookConfigurationList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *admissionregistrationv1.ValidatingWebhookConfiguration, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl) Update(ctx context.Context, in *admissionregistrationv1.ValidatingWebhookConfiguration, opts metav1.UpdateOptions) (*admissionregistrationv1.ValidatingWebhookConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "admissionregistration.k8s.io", - Version: "v1", - Kind: "ValidatingWebhookConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl) UpdateStatus(ctx context.Context, in *admissionregistrationv1.ValidatingWebhookConfiguration, opts metav1.UpdateOptions) (*admissionregistrationv1.ValidatingWebhookConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "admissionregistration.k8s.io", - Version: "v1", - Kind: "ValidatingWebhookConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1ValidatingWebhookConfigurationImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// AdmissionregistrationV1beta1 retrieves the AdmissionregistrationV1beta1Client -func (w *wrapClient) AdmissionregistrationV1beta1() typedadmissionregistrationv1beta1.AdmissionregistrationV1beta1Interface { - return &wrapAdmissionregistrationV1beta1{ - dyn: w.dyn, - } -} - -type wrapAdmissionregistrationV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapAdmissionregistrationV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAdmissionregistrationV1beta1) MutatingWebhookConfigurations() typedadmissionregistrationv1beta1.MutatingWebhookConfigurationInterface { - return &wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "admissionregistration.k8s.io", - Version: "v1beta1", - Resource: "mutatingwebhookconfigurations", - }), - } -} - -type wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedadmissionregistrationv1beta1.MutatingWebhookConfigurationInterface = (*wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl)(nil) - -func (w *wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl) Apply(ctx context.Context, in *v1beta1.MutatingWebhookConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *admissionregistrationv1beta1.MutatingWebhookConfiguration, err error) { - in.Kind = ptr.String("MutatingWebhookConfiguration") - - in.APIVersion = ptr.String("admissionregistration.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl) ApplyStatus(ctx context.Context, in *v1beta1.MutatingWebhookConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *admissionregistrationv1beta1.MutatingWebhookConfiguration, err error) { - in.Kind = ptr.String("MutatingWebhookConfiguration") - - in.APIVersion = ptr.String("admissionregistration.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl) Create(ctx context.Context, in *admissionregistrationv1beta1.MutatingWebhookConfiguration, opts metav1.CreateOptions) (*admissionregistrationv1beta1.MutatingWebhookConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "admissionregistration.k8s.io", - Version: "v1beta1", - Kind: "MutatingWebhookConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*admissionregistrationv1beta1.MutatingWebhookConfiguration, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl) List(ctx context.Context, opts metav1.ListOptions) (*admissionregistrationv1beta1.MutatingWebhookConfigurationList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.MutatingWebhookConfigurationList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *admissionregistrationv1beta1.MutatingWebhookConfiguration, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl) Update(ctx context.Context, in *admissionregistrationv1beta1.MutatingWebhookConfiguration, opts metav1.UpdateOptions) (*admissionregistrationv1beta1.MutatingWebhookConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "admissionregistration.k8s.io", - Version: "v1beta1", - Kind: "MutatingWebhookConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl) UpdateStatus(ctx context.Context, in *admissionregistrationv1beta1.MutatingWebhookConfiguration, opts metav1.UpdateOptions) (*admissionregistrationv1beta1.MutatingWebhookConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "admissionregistration.k8s.io", - Version: "v1beta1", - Kind: "MutatingWebhookConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.MutatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1MutatingWebhookConfigurationImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAdmissionregistrationV1beta1) ValidatingWebhookConfigurations() typedadmissionregistrationv1beta1.ValidatingWebhookConfigurationInterface { - return &wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "admissionregistration.k8s.io", - Version: "v1beta1", - Resource: "validatingwebhookconfigurations", - }), - } -} - -type wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedadmissionregistrationv1beta1.ValidatingWebhookConfigurationInterface = (*wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl)(nil) - -func (w *wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl) Apply(ctx context.Context, in *v1beta1.ValidatingWebhookConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *admissionregistrationv1beta1.ValidatingWebhookConfiguration, err error) { - in.Kind = ptr.String("ValidatingWebhookConfiguration") - - in.APIVersion = ptr.String("admissionregistration.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl) ApplyStatus(ctx context.Context, in *v1beta1.ValidatingWebhookConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *admissionregistrationv1beta1.ValidatingWebhookConfiguration, err error) { - in.Kind = ptr.String("ValidatingWebhookConfiguration") - - in.APIVersion = ptr.String("admissionregistration.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl) Create(ctx context.Context, in *admissionregistrationv1beta1.ValidatingWebhookConfiguration, opts metav1.CreateOptions) (*admissionregistrationv1beta1.ValidatingWebhookConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "admissionregistration.k8s.io", - Version: "v1beta1", - Kind: "ValidatingWebhookConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*admissionregistrationv1beta1.ValidatingWebhookConfiguration, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl) List(ctx context.Context, opts metav1.ListOptions) (*admissionregistrationv1beta1.ValidatingWebhookConfigurationList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.ValidatingWebhookConfigurationList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *admissionregistrationv1beta1.ValidatingWebhookConfiguration, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl) Update(ctx context.Context, in *admissionregistrationv1beta1.ValidatingWebhookConfiguration, opts metav1.UpdateOptions) (*admissionregistrationv1beta1.ValidatingWebhookConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "admissionregistration.k8s.io", - Version: "v1beta1", - Kind: "ValidatingWebhookConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl) UpdateStatus(ctx context.Context, in *admissionregistrationv1beta1.ValidatingWebhookConfiguration, opts metav1.UpdateOptions) (*admissionregistrationv1beta1.ValidatingWebhookConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "admissionregistration.k8s.io", - Version: "v1beta1", - Kind: "ValidatingWebhookConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &admissionregistrationv1beta1.ValidatingWebhookConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAdmissionregistrationV1beta1ValidatingWebhookConfigurationImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// InternalV1alpha1 retrieves the InternalV1alpha1Client -func (w *wrapClient) InternalV1alpha1() typedinternalv1alpha1.InternalV1alpha1Interface { - return &wrapInternalV1alpha1{ - dyn: w.dyn, - } -} - -type wrapInternalV1alpha1 struct { - dyn dynamic.Interface -} - -func (w *wrapInternalV1alpha1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapInternalV1alpha1) StorageVersions() typedinternalv1alpha1.StorageVersionInterface { - return &wrapInternalV1alpha1StorageVersionImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "internal.apiserver.k8s.io", - Version: "v1alpha1", - Resource: "storageversions", - }), - } -} - -type wrapInternalV1alpha1StorageVersionImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedinternalv1alpha1.StorageVersionInterface = (*wrapInternalV1alpha1StorageVersionImpl)(nil) - -func (w *wrapInternalV1alpha1StorageVersionImpl) Apply(ctx context.Context, in *v1alpha1.StorageVersionApplyConfiguration, opts metav1.ApplyOptions) (result *apiserverinternalv1alpha1.StorageVersion, err error) { - in.Kind = ptr.String("StorageVersion") - - in.APIVersion = ptr.String("internal.apiserver.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiserverinternalv1alpha1.StorageVersion{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapInternalV1alpha1StorageVersionImpl) ApplyStatus(ctx context.Context, in *v1alpha1.StorageVersionApplyConfiguration, opts metav1.ApplyOptions) (result *apiserverinternalv1alpha1.StorageVersion, err error) { - in.Kind = ptr.String("StorageVersion") - - in.APIVersion = ptr.String("internal.apiserver.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiserverinternalv1alpha1.StorageVersion{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapInternalV1alpha1StorageVersionImpl) Create(ctx context.Context, in *apiserverinternalv1alpha1.StorageVersion, opts metav1.CreateOptions) (*apiserverinternalv1alpha1.StorageVersion, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "internal.apiserver.k8s.io", - Version: "v1alpha1", - Kind: "StorageVersion", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiserverinternalv1alpha1.StorageVersion{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapInternalV1alpha1StorageVersionImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapInternalV1alpha1StorageVersionImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapInternalV1alpha1StorageVersionImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiserverinternalv1alpha1.StorageVersion, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiserverinternalv1alpha1.StorageVersion{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapInternalV1alpha1StorageVersionImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiserverinternalv1alpha1.StorageVersionList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiserverinternalv1alpha1.StorageVersionList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapInternalV1alpha1StorageVersionImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiserverinternalv1alpha1.StorageVersion, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiserverinternalv1alpha1.StorageVersion{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapInternalV1alpha1StorageVersionImpl) Update(ctx context.Context, in *apiserverinternalv1alpha1.StorageVersion, opts metav1.UpdateOptions) (*apiserverinternalv1alpha1.StorageVersion, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "internal.apiserver.k8s.io", - Version: "v1alpha1", - Kind: "StorageVersion", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiserverinternalv1alpha1.StorageVersion{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapInternalV1alpha1StorageVersionImpl) UpdateStatus(ctx context.Context, in *apiserverinternalv1alpha1.StorageVersion, opts metav1.UpdateOptions) (*apiserverinternalv1alpha1.StorageVersion, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "internal.apiserver.k8s.io", - Version: "v1alpha1", - Kind: "StorageVersion", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiserverinternalv1alpha1.StorageVersion{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapInternalV1alpha1StorageVersionImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// AppsV1 retrieves the AppsV1Client -func (w *wrapClient) AppsV1() typedappsv1.AppsV1Interface { - return &wrapAppsV1{ - dyn: w.dyn, - } -} - -type wrapAppsV1 struct { - dyn dynamic.Interface -} - -func (w *wrapAppsV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAppsV1) ControllerRevisions(namespace string) typedappsv1.ControllerRevisionInterface { - return &wrapAppsV1ControllerRevisionImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1", - Resource: "controllerrevisions", - }), - - namespace: namespace, - } -} - -type wrapAppsV1ControllerRevisionImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1.ControllerRevisionInterface = (*wrapAppsV1ControllerRevisionImpl)(nil) - -func (w *wrapAppsV1ControllerRevisionImpl) Apply(ctx context.Context, in *appsv1.ControllerRevisionApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1.ControllerRevision, err error) { - in.Kind = ptr.String("ControllerRevision") - - in.APIVersion = ptr.String("apps/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ControllerRevisionImpl) ApplyStatus(ctx context.Context, in *appsv1.ControllerRevisionApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1.ControllerRevision, err error) { - in.Kind = ptr.String("ControllerRevision") - - in.APIVersion = ptr.String("apps/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ControllerRevisionImpl) Create(ctx context.Context, in *apiappsv1.ControllerRevision, opts metav1.CreateOptions) (*apiappsv1.ControllerRevision, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "ControllerRevision", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ControllerRevisionImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1ControllerRevisionImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1ControllerRevisionImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiappsv1.ControllerRevision, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ControllerRevisionImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiappsv1.ControllerRevisionList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ControllerRevisionList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ControllerRevisionImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiappsv1.ControllerRevision, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ControllerRevisionImpl) Update(ctx context.Context, in *apiappsv1.ControllerRevision, opts metav1.UpdateOptions) (*apiappsv1.ControllerRevision, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "ControllerRevision", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ControllerRevisionImpl) UpdateStatus(ctx context.Context, in *apiappsv1.ControllerRevision, opts metav1.UpdateOptions) (*apiappsv1.ControllerRevision, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "ControllerRevision", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ControllerRevisionImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAppsV1) DaemonSets(namespace string) typedappsv1.DaemonSetInterface { - return &wrapAppsV1DaemonSetImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1", - Resource: "daemonsets", - }), - - namespace: namespace, - } -} - -type wrapAppsV1DaemonSetImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1.DaemonSetInterface = (*wrapAppsV1DaemonSetImpl)(nil) - -func (w *wrapAppsV1DaemonSetImpl) Apply(ctx context.Context, in *appsv1.DaemonSetApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1.DaemonSet, err error) { - in.Kind = ptr.String("DaemonSet") - - in.APIVersion = ptr.String("apps/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DaemonSetImpl) ApplyStatus(ctx context.Context, in *appsv1.DaemonSetApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1.DaemonSet, err error) { - in.Kind = ptr.String("DaemonSet") - - in.APIVersion = ptr.String("apps/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DaemonSetImpl) Create(ctx context.Context, in *apiappsv1.DaemonSet, opts metav1.CreateOptions) (*apiappsv1.DaemonSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "DaemonSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DaemonSetImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1DaemonSetImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1DaemonSetImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiappsv1.DaemonSet, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DaemonSetImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiappsv1.DaemonSetList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.DaemonSetList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DaemonSetImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiappsv1.DaemonSet, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DaemonSetImpl) Update(ctx context.Context, in *apiappsv1.DaemonSet, opts metav1.UpdateOptions) (*apiappsv1.DaemonSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "DaemonSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DaemonSetImpl) UpdateStatus(ctx context.Context, in *apiappsv1.DaemonSet, opts metav1.UpdateOptions) (*apiappsv1.DaemonSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "DaemonSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DaemonSetImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAppsV1) Deployments(namespace string) typedappsv1.DeploymentInterface { - return &wrapAppsV1DeploymentImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1", - Resource: "deployments", - }), - - namespace: namespace, - } -} - -type wrapAppsV1DeploymentImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1.DeploymentInterface = (*wrapAppsV1DeploymentImpl)(nil) - -func (w *wrapAppsV1DeploymentImpl) Apply(ctx context.Context, in *appsv1.DeploymentApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1.Deployment, err error) { - in.Kind = ptr.String("Deployment") - - in.APIVersion = ptr.String("apps/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DeploymentImpl) ApplyStatus(ctx context.Context, in *appsv1.DeploymentApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1.Deployment, err error) { - in.Kind = ptr.String("Deployment") - - in.APIVersion = ptr.String("apps/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DeploymentImpl) Create(ctx context.Context, in *apiappsv1.Deployment, opts metav1.CreateOptions) (*apiappsv1.Deployment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "Deployment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DeploymentImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1DeploymentImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1DeploymentImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiappsv1.Deployment, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DeploymentImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiappsv1.DeploymentList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.DeploymentList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DeploymentImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiappsv1.Deployment, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DeploymentImpl) Update(ctx context.Context, in *apiappsv1.Deployment, opts metav1.UpdateOptions) (*apiappsv1.Deployment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "Deployment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DeploymentImpl) UpdateStatus(ctx context.Context, in *apiappsv1.Deployment, opts metav1.UpdateOptions) (*apiappsv1.Deployment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "Deployment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1DeploymentImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAppsV1DeploymentImpl) GetScale(ctx context.Context, name string, opts metav1.GetOptions) (*autoscalingv1.Scale, error) { - panic("NYI") -} - -func (w *wrapAppsV1DeploymentImpl) UpdateScale(ctx context.Context, _ string, in *autoscalingv1.Scale, opts metav1.UpdateOptions) (*autoscalingv1.Scale, error) { - panic("NYI") -} - -func (w *wrapAppsV1DeploymentImpl) ApplyScale(ctx context.Context, name string, in *applyconfigurationsautoscalingv1.ScaleApplyConfiguration, opts metav1.ApplyOptions) (*autoscalingv1.Scale, error) { - panic("NYI") -} - -func (w *wrapAppsV1) ReplicaSets(namespace string) typedappsv1.ReplicaSetInterface { - return &wrapAppsV1ReplicaSetImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1", - Resource: "replicasets", - }), - - namespace: namespace, - } -} - -type wrapAppsV1ReplicaSetImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1.ReplicaSetInterface = (*wrapAppsV1ReplicaSetImpl)(nil) - -func (w *wrapAppsV1ReplicaSetImpl) Apply(ctx context.Context, in *appsv1.ReplicaSetApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1.ReplicaSet, err error) { - in.Kind = ptr.String("ReplicaSet") - - in.APIVersion = ptr.String("apps/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ReplicaSetImpl) ApplyStatus(ctx context.Context, in *appsv1.ReplicaSetApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1.ReplicaSet, err error) { - in.Kind = ptr.String("ReplicaSet") - - in.APIVersion = ptr.String("apps/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ReplicaSetImpl) Create(ctx context.Context, in *apiappsv1.ReplicaSet, opts metav1.CreateOptions) (*apiappsv1.ReplicaSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "ReplicaSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ReplicaSetImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1ReplicaSetImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1ReplicaSetImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiappsv1.ReplicaSet, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ReplicaSetImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiappsv1.ReplicaSetList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ReplicaSetList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ReplicaSetImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiappsv1.ReplicaSet, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ReplicaSetImpl) Update(ctx context.Context, in *apiappsv1.ReplicaSet, opts metav1.UpdateOptions) (*apiappsv1.ReplicaSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "ReplicaSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ReplicaSetImpl) UpdateStatus(ctx context.Context, in *apiappsv1.ReplicaSet, opts metav1.UpdateOptions) (*apiappsv1.ReplicaSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "ReplicaSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1ReplicaSetImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAppsV1ReplicaSetImpl) GetScale(ctx context.Context, name string, opts metav1.GetOptions) (*autoscalingv1.Scale, error) { - panic("NYI") -} - -func (w *wrapAppsV1ReplicaSetImpl) UpdateScale(ctx context.Context, _ string, in *autoscalingv1.Scale, opts metav1.UpdateOptions) (*autoscalingv1.Scale, error) { - panic("NYI") -} - -func (w *wrapAppsV1ReplicaSetImpl) ApplyScale(ctx context.Context, name string, in *applyconfigurationsautoscalingv1.ScaleApplyConfiguration, opts metav1.ApplyOptions) (*autoscalingv1.Scale, error) { - panic("NYI") -} - -func (w *wrapAppsV1) StatefulSets(namespace string) typedappsv1.StatefulSetInterface { - return &wrapAppsV1StatefulSetImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1", - Resource: "statefulsets", - }), - - namespace: namespace, - } -} - -type wrapAppsV1StatefulSetImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1.StatefulSetInterface = (*wrapAppsV1StatefulSetImpl)(nil) - -func (w *wrapAppsV1StatefulSetImpl) Apply(ctx context.Context, in *appsv1.StatefulSetApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1.StatefulSet, err error) { - in.Kind = ptr.String("StatefulSet") - - in.APIVersion = ptr.String("apps/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1StatefulSetImpl) ApplyStatus(ctx context.Context, in *appsv1.StatefulSetApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1.StatefulSet, err error) { - in.Kind = ptr.String("StatefulSet") - - in.APIVersion = ptr.String("apps/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1StatefulSetImpl) Create(ctx context.Context, in *apiappsv1.StatefulSet, opts metav1.CreateOptions) (*apiappsv1.StatefulSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "StatefulSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1StatefulSetImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1StatefulSetImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1StatefulSetImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiappsv1.StatefulSet, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1StatefulSetImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiappsv1.StatefulSetList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.StatefulSetList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1StatefulSetImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiappsv1.StatefulSet, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1StatefulSetImpl) Update(ctx context.Context, in *apiappsv1.StatefulSet, opts metav1.UpdateOptions) (*apiappsv1.StatefulSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "StatefulSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1StatefulSetImpl) UpdateStatus(ctx context.Context, in *apiappsv1.StatefulSet, opts metav1.UpdateOptions) (*apiappsv1.StatefulSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1", - Kind: "StatefulSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1StatefulSetImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAppsV1StatefulSetImpl) GetScale(ctx context.Context, name string, opts metav1.GetOptions) (*autoscalingv1.Scale, error) { - panic("NYI") -} - -func (w *wrapAppsV1StatefulSetImpl) UpdateScale(ctx context.Context, _ string, in *autoscalingv1.Scale, opts metav1.UpdateOptions) (*autoscalingv1.Scale, error) { - panic("NYI") -} - -func (w *wrapAppsV1StatefulSetImpl) ApplyScale(ctx context.Context, name string, in *applyconfigurationsautoscalingv1.ScaleApplyConfiguration, opts metav1.ApplyOptions) (*autoscalingv1.Scale, error) { - panic("NYI") -} - -// AppsV1beta1 retrieves the AppsV1beta1Client -func (w *wrapClient) AppsV1beta1() typedappsv1beta1.AppsV1beta1Interface { - return &wrapAppsV1beta1{ - dyn: w.dyn, - } -} - -type wrapAppsV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapAppsV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAppsV1beta1) ControllerRevisions(namespace string) typedappsv1beta1.ControllerRevisionInterface { - return &wrapAppsV1beta1ControllerRevisionImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1beta1", - Resource: "controllerrevisions", - }), - - namespace: namespace, - } -} - -type wrapAppsV1beta1ControllerRevisionImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1beta1.ControllerRevisionInterface = (*wrapAppsV1beta1ControllerRevisionImpl)(nil) - -func (w *wrapAppsV1beta1ControllerRevisionImpl) Apply(ctx context.Context, in *appsv1beta1.ControllerRevisionApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1beta1.ControllerRevision, err error) { - in.Kind = ptr.String("ControllerRevision") - - in.APIVersion = ptr.String("apps/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1ControllerRevisionImpl) ApplyStatus(ctx context.Context, in *appsv1beta1.ControllerRevisionApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1beta1.ControllerRevision, err error) { - in.Kind = ptr.String("ControllerRevision") - - in.APIVersion = ptr.String("apps/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1ControllerRevisionImpl) Create(ctx context.Context, in *apiappsv1beta1.ControllerRevision, opts metav1.CreateOptions) (*apiappsv1beta1.ControllerRevision, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta1", - Kind: "ControllerRevision", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1ControllerRevisionImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1beta1ControllerRevisionImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1beta1ControllerRevisionImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiappsv1beta1.ControllerRevision, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1ControllerRevisionImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiappsv1beta1.ControllerRevisionList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.ControllerRevisionList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1ControllerRevisionImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiappsv1beta1.ControllerRevision, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1ControllerRevisionImpl) Update(ctx context.Context, in *apiappsv1beta1.ControllerRevision, opts metav1.UpdateOptions) (*apiappsv1beta1.ControllerRevision, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta1", - Kind: "ControllerRevision", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1ControllerRevisionImpl) UpdateStatus(ctx context.Context, in *apiappsv1beta1.ControllerRevision, opts metav1.UpdateOptions) (*apiappsv1beta1.ControllerRevision, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta1", - Kind: "ControllerRevision", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1ControllerRevisionImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAppsV1beta1) Deployments(namespace string) typedappsv1beta1.DeploymentInterface { - return &wrapAppsV1beta1DeploymentImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1beta1", - Resource: "deployments", - }), - - namespace: namespace, - } -} - -type wrapAppsV1beta1DeploymentImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1beta1.DeploymentInterface = (*wrapAppsV1beta1DeploymentImpl)(nil) - -func (w *wrapAppsV1beta1DeploymentImpl) Apply(ctx context.Context, in *appsv1beta1.DeploymentApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1beta1.Deployment, err error) { - in.Kind = ptr.String("Deployment") - - in.APIVersion = ptr.String("apps/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1DeploymentImpl) ApplyStatus(ctx context.Context, in *appsv1beta1.DeploymentApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1beta1.Deployment, err error) { - in.Kind = ptr.String("Deployment") - - in.APIVersion = ptr.String("apps/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1DeploymentImpl) Create(ctx context.Context, in *apiappsv1beta1.Deployment, opts metav1.CreateOptions) (*apiappsv1beta1.Deployment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta1", - Kind: "Deployment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1DeploymentImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1beta1DeploymentImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1beta1DeploymentImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiappsv1beta1.Deployment, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1DeploymentImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiappsv1beta1.DeploymentList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.DeploymentList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1DeploymentImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiappsv1beta1.Deployment, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1DeploymentImpl) Update(ctx context.Context, in *apiappsv1beta1.Deployment, opts metav1.UpdateOptions) (*apiappsv1beta1.Deployment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta1", - Kind: "Deployment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1DeploymentImpl) UpdateStatus(ctx context.Context, in *apiappsv1beta1.Deployment, opts metav1.UpdateOptions) (*apiappsv1beta1.Deployment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta1", - Kind: "Deployment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1DeploymentImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAppsV1beta1) StatefulSets(namespace string) typedappsv1beta1.StatefulSetInterface { - return &wrapAppsV1beta1StatefulSetImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1beta1", - Resource: "statefulsets", - }), - - namespace: namespace, - } -} - -type wrapAppsV1beta1StatefulSetImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1beta1.StatefulSetInterface = (*wrapAppsV1beta1StatefulSetImpl)(nil) - -func (w *wrapAppsV1beta1StatefulSetImpl) Apply(ctx context.Context, in *appsv1beta1.StatefulSetApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1beta1.StatefulSet, err error) { - in.Kind = ptr.String("StatefulSet") - - in.APIVersion = ptr.String("apps/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1StatefulSetImpl) ApplyStatus(ctx context.Context, in *appsv1beta1.StatefulSetApplyConfiguration, opts metav1.ApplyOptions) (result *apiappsv1beta1.StatefulSet, err error) { - in.Kind = ptr.String("StatefulSet") - - in.APIVersion = ptr.String("apps/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1StatefulSetImpl) Create(ctx context.Context, in *apiappsv1beta1.StatefulSet, opts metav1.CreateOptions) (*apiappsv1beta1.StatefulSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta1", - Kind: "StatefulSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1StatefulSetImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1beta1StatefulSetImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1beta1StatefulSetImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiappsv1beta1.StatefulSet, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1StatefulSetImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiappsv1beta1.StatefulSetList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.StatefulSetList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1StatefulSetImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiappsv1beta1.StatefulSet, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1StatefulSetImpl) Update(ctx context.Context, in *apiappsv1beta1.StatefulSet, opts metav1.UpdateOptions) (*apiappsv1beta1.StatefulSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta1", - Kind: "StatefulSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1StatefulSetImpl) UpdateStatus(ctx context.Context, in *apiappsv1beta1.StatefulSet, opts metav1.UpdateOptions) (*apiappsv1beta1.StatefulSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta1", - Kind: "StatefulSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiappsv1beta1.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta1StatefulSetImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// AppsV1beta2 retrieves the AppsV1beta2Client -func (w *wrapClient) AppsV1beta2() typedappsv1beta2.AppsV1beta2Interface { - return &wrapAppsV1beta2{ - dyn: w.dyn, - } -} - -type wrapAppsV1beta2 struct { - dyn dynamic.Interface -} - -func (w *wrapAppsV1beta2) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAppsV1beta2) ControllerRevisions(namespace string) typedappsv1beta2.ControllerRevisionInterface { - return &wrapAppsV1beta2ControllerRevisionImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1beta2", - Resource: "controllerrevisions", - }), - - namespace: namespace, - } -} - -type wrapAppsV1beta2ControllerRevisionImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1beta2.ControllerRevisionInterface = (*wrapAppsV1beta2ControllerRevisionImpl)(nil) - -func (w *wrapAppsV1beta2ControllerRevisionImpl) Apply(ctx context.Context, in *v1beta2.ControllerRevisionApplyConfiguration, opts metav1.ApplyOptions) (result *appsv1beta2.ControllerRevision, err error) { - in.Kind = ptr.String("ControllerRevision") - - in.APIVersion = ptr.String("apps/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ControllerRevisionImpl) ApplyStatus(ctx context.Context, in *v1beta2.ControllerRevisionApplyConfiguration, opts metav1.ApplyOptions) (result *appsv1beta2.ControllerRevision, err error) { - in.Kind = ptr.String("ControllerRevision") - - in.APIVersion = ptr.String("apps/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ControllerRevisionImpl) Create(ctx context.Context, in *appsv1beta2.ControllerRevision, opts metav1.CreateOptions) (*appsv1beta2.ControllerRevision, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "ControllerRevision", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ControllerRevisionImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1beta2ControllerRevisionImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1beta2ControllerRevisionImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*appsv1beta2.ControllerRevision, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ControllerRevisionImpl) List(ctx context.Context, opts metav1.ListOptions) (*appsv1beta2.ControllerRevisionList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ControllerRevisionList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ControllerRevisionImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *appsv1beta2.ControllerRevision, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ControllerRevisionImpl) Update(ctx context.Context, in *appsv1beta2.ControllerRevision, opts metav1.UpdateOptions) (*appsv1beta2.ControllerRevision, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "ControllerRevision", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ControllerRevisionImpl) UpdateStatus(ctx context.Context, in *appsv1beta2.ControllerRevision, opts metav1.UpdateOptions) (*appsv1beta2.ControllerRevision, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "ControllerRevision", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ControllerRevision{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ControllerRevisionImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAppsV1beta2) DaemonSets(namespace string) typedappsv1beta2.DaemonSetInterface { - return &wrapAppsV1beta2DaemonSetImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1beta2", - Resource: "daemonsets", - }), - - namespace: namespace, - } -} - -type wrapAppsV1beta2DaemonSetImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1beta2.DaemonSetInterface = (*wrapAppsV1beta2DaemonSetImpl)(nil) - -func (w *wrapAppsV1beta2DaemonSetImpl) Apply(ctx context.Context, in *v1beta2.DaemonSetApplyConfiguration, opts metav1.ApplyOptions) (result *appsv1beta2.DaemonSet, err error) { - in.Kind = ptr.String("DaemonSet") - - in.APIVersion = ptr.String("apps/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DaemonSetImpl) ApplyStatus(ctx context.Context, in *v1beta2.DaemonSetApplyConfiguration, opts metav1.ApplyOptions) (result *appsv1beta2.DaemonSet, err error) { - in.Kind = ptr.String("DaemonSet") - - in.APIVersion = ptr.String("apps/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DaemonSetImpl) Create(ctx context.Context, in *appsv1beta2.DaemonSet, opts metav1.CreateOptions) (*appsv1beta2.DaemonSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "DaemonSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DaemonSetImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1beta2DaemonSetImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1beta2DaemonSetImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*appsv1beta2.DaemonSet, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DaemonSetImpl) List(ctx context.Context, opts metav1.ListOptions) (*appsv1beta2.DaemonSetList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.DaemonSetList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DaemonSetImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *appsv1beta2.DaemonSet, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DaemonSetImpl) Update(ctx context.Context, in *appsv1beta2.DaemonSet, opts metav1.UpdateOptions) (*appsv1beta2.DaemonSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "DaemonSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DaemonSetImpl) UpdateStatus(ctx context.Context, in *appsv1beta2.DaemonSet, opts metav1.UpdateOptions) (*appsv1beta2.DaemonSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "DaemonSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DaemonSetImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAppsV1beta2) Deployments(namespace string) typedappsv1beta2.DeploymentInterface { - return &wrapAppsV1beta2DeploymentImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1beta2", - Resource: "deployments", - }), - - namespace: namespace, - } -} - -type wrapAppsV1beta2DeploymentImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1beta2.DeploymentInterface = (*wrapAppsV1beta2DeploymentImpl)(nil) - -func (w *wrapAppsV1beta2DeploymentImpl) Apply(ctx context.Context, in *v1beta2.DeploymentApplyConfiguration, opts metav1.ApplyOptions) (result *appsv1beta2.Deployment, err error) { - in.Kind = ptr.String("Deployment") - - in.APIVersion = ptr.String("apps/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DeploymentImpl) ApplyStatus(ctx context.Context, in *v1beta2.DeploymentApplyConfiguration, opts metav1.ApplyOptions) (result *appsv1beta2.Deployment, err error) { - in.Kind = ptr.String("Deployment") - - in.APIVersion = ptr.String("apps/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DeploymentImpl) Create(ctx context.Context, in *appsv1beta2.Deployment, opts metav1.CreateOptions) (*appsv1beta2.Deployment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "Deployment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DeploymentImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1beta2DeploymentImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1beta2DeploymentImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*appsv1beta2.Deployment, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DeploymentImpl) List(ctx context.Context, opts metav1.ListOptions) (*appsv1beta2.DeploymentList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.DeploymentList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DeploymentImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *appsv1beta2.Deployment, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DeploymentImpl) Update(ctx context.Context, in *appsv1beta2.Deployment, opts metav1.UpdateOptions) (*appsv1beta2.Deployment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "Deployment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DeploymentImpl) UpdateStatus(ctx context.Context, in *appsv1beta2.Deployment, opts metav1.UpdateOptions) (*appsv1beta2.Deployment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "Deployment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2DeploymentImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAppsV1beta2) ReplicaSets(namespace string) typedappsv1beta2.ReplicaSetInterface { - return &wrapAppsV1beta2ReplicaSetImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1beta2", - Resource: "replicasets", - }), - - namespace: namespace, - } -} - -type wrapAppsV1beta2ReplicaSetImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1beta2.ReplicaSetInterface = (*wrapAppsV1beta2ReplicaSetImpl)(nil) - -func (w *wrapAppsV1beta2ReplicaSetImpl) Apply(ctx context.Context, in *v1beta2.ReplicaSetApplyConfiguration, opts metav1.ApplyOptions) (result *appsv1beta2.ReplicaSet, err error) { - in.Kind = ptr.String("ReplicaSet") - - in.APIVersion = ptr.String("apps/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ReplicaSetImpl) ApplyStatus(ctx context.Context, in *v1beta2.ReplicaSetApplyConfiguration, opts metav1.ApplyOptions) (result *appsv1beta2.ReplicaSet, err error) { - in.Kind = ptr.String("ReplicaSet") - - in.APIVersion = ptr.String("apps/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ReplicaSetImpl) Create(ctx context.Context, in *appsv1beta2.ReplicaSet, opts metav1.CreateOptions) (*appsv1beta2.ReplicaSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "ReplicaSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ReplicaSetImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1beta2ReplicaSetImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1beta2ReplicaSetImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*appsv1beta2.ReplicaSet, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ReplicaSetImpl) List(ctx context.Context, opts metav1.ListOptions) (*appsv1beta2.ReplicaSetList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ReplicaSetList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ReplicaSetImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *appsv1beta2.ReplicaSet, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ReplicaSetImpl) Update(ctx context.Context, in *appsv1beta2.ReplicaSet, opts metav1.UpdateOptions) (*appsv1beta2.ReplicaSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "ReplicaSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ReplicaSetImpl) UpdateStatus(ctx context.Context, in *appsv1beta2.ReplicaSet, opts metav1.UpdateOptions) (*appsv1beta2.ReplicaSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "ReplicaSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2ReplicaSetImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAppsV1beta2) StatefulSets(namespace string) typedappsv1beta2.StatefulSetInterface { - return &wrapAppsV1beta2StatefulSetImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "apps", - Version: "v1beta2", - Resource: "statefulsets", - }), - - namespace: namespace, - } -} - -type wrapAppsV1beta2StatefulSetImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedappsv1beta2.StatefulSetInterface = (*wrapAppsV1beta2StatefulSetImpl)(nil) - -func (w *wrapAppsV1beta2StatefulSetImpl) Apply(ctx context.Context, in *v1beta2.StatefulSetApplyConfiguration, opts metav1.ApplyOptions) (result *appsv1beta2.StatefulSet, err error) { - in.Kind = ptr.String("StatefulSet") - - in.APIVersion = ptr.String("apps/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2StatefulSetImpl) ApplyStatus(ctx context.Context, in *v1beta2.StatefulSetApplyConfiguration, opts metav1.ApplyOptions) (result *appsv1beta2.StatefulSet, err error) { - in.Kind = ptr.String("StatefulSet") - - in.APIVersion = ptr.String("apps/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2StatefulSetImpl) Create(ctx context.Context, in *appsv1beta2.StatefulSet, opts metav1.CreateOptions) (*appsv1beta2.StatefulSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "StatefulSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2StatefulSetImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAppsV1beta2StatefulSetImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAppsV1beta2StatefulSetImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*appsv1beta2.StatefulSet, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2StatefulSetImpl) List(ctx context.Context, opts metav1.ListOptions) (*appsv1beta2.StatefulSetList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.StatefulSetList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2StatefulSetImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *appsv1beta2.StatefulSet, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2StatefulSetImpl) Update(ctx context.Context, in *appsv1beta2.StatefulSet, opts metav1.UpdateOptions) (*appsv1beta2.StatefulSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "StatefulSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2StatefulSetImpl) UpdateStatus(ctx context.Context, in *appsv1beta2.StatefulSet, opts metav1.UpdateOptions) (*appsv1beta2.StatefulSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "apps", - Version: "v1beta2", - Kind: "StatefulSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &appsv1beta2.StatefulSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAppsV1beta2StatefulSetImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapAppsV1beta2StatefulSetImpl) GetScale(ctx context.Context, name string, opts metav1.GetOptions) (*appsv1beta2.Scale, error) { - panic("NYI") -} - -func (w *wrapAppsV1beta2StatefulSetImpl) UpdateScale(ctx context.Context, _ string, in *appsv1beta2.Scale, opts metav1.UpdateOptions) (*appsv1beta2.Scale, error) { - panic("NYI") -} - -func (w *wrapAppsV1beta2StatefulSetImpl) ApplyScale(ctx context.Context, name string, in *v1beta2.ScaleApplyConfiguration, opts metav1.ApplyOptions) (*appsv1beta2.Scale, error) { - panic("NYI") -} - -// AuthenticationV1 retrieves the AuthenticationV1Client -func (w *wrapClient) AuthenticationV1() typedauthenticationv1.AuthenticationV1Interface { - return &wrapAuthenticationV1{ - dyn: w.dyn, - } -} - -type wrapAuthenticationV1 struct { - dyn dynamic.Interface -} - -func (w *wrapAuthenticationV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAuthenticationV1) TokenReviews() typedauthenticationv1.TokenReviewInterface { - return &wrapAuthenticationV1TokenReviewImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "authentication.k8s.io", - Version: "v1", - Resource: "tokenreviews", - }), - } -} - -type wrapAuthenticationV1TokenReviewImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedauthenticationv1.TokenReviewInterface = (*wrapAuthenticationV1TokenReviewImpl)(nil) - -func (w *wrapAuthenticationV1TokenReviewImpl) Create(ctx context.Context, in *authenticationv1.TokenReview, opts metav1.CreateOptions) (*authenticationv1.TokenReview, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "authentication.k8s.io", - Version: "v1", - Kind: "TokenReview", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &authenticationv1.TokenReview{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -// AuthenticationV1beta1 retrieves the AuthenticationV1beta1Client -func (w *wrapClient) AuthenticationV1beta1() typedauthenticationv1beta1.AuthenticationV1beta1Interface { - return &wrapAuthenticationV1beta1{ - dyn: w.dyn, - } -} - -type wrapAuthenticationV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapAuthenticationV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAuthenticationV1beta1) TokenReviews() typedauthenticationv1beta1.TokenReviewInterface { - return &wrapAuthenticationV1beta1TokenReviewImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "authentication.k8s.io", - Version: "v1beta1", - Resource: "tokenreviews", - }), - } -} - -type wrapAuthenticationV1beta1TokenReviewImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedauthenticationv1beta1.TokenReviewInterface = (*wrapAuthenticationV1beta1TokenReviewImpl)(nil) - -func (w *wrapAuthenticationV1beta1TokenReviewImpl) Create(ctx context.Context, in *authenticationv1beta1.TokenReview, opts metav1.CreateOptions) (*authenticationv1beta1.TokenReview, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "authentication.k8s.io", - Version: "v1beta1", - Kind: "TokenReview", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &authenticationv1beta1.TokenReview{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -// AuthorizationV1 retrieves the AuthorizationV1Client -func (w *wrapClient) AuthorizationV1() typedauthorizationv1.AuthorizationV1Interface { - return &wrapAuthorizationV1{ - dyn: w.dyn, - } -} - -type wrapAuthorizationV1 struct { - dyn dynamic.Interface -} - -func (w *wrapAuthorizationV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAuthorizationV1) LocalSubjectAccessReviews(namespace string) typedauthorizationv1.LocalSubjectAccessReviewInterface { - return &wrapAuthorizationV1LocalSubjectAccessReviewImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "authorization.k8s.io", - Version: "v1", - Resource: "localsubjectaccessreviews", - }), - - namespace: namespace, - } -} - -type wrapAuthorizationV1LocalSubjectAccessReviewImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedauthorizationv1.LocalSubjectAccessReviewInterface = (*wrapAuthorizationV1LocalSubjectAccessReviewImpl)(nil) - -func (w *wrapAuthorizationV1LocalSubjectAccessReviewImpl) Create(ctx context.Context, in *authorizationv1.LocalSubjectAccessReview, opts metav1.CreateOptions) (*authorizationv1.LocalSubjectAccessReview, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "authorization.k8s.io", - Version: "v1", - Kind: "LocalSubjectAccessReview", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &authorizationv1.LocalSubjectAccessReview{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAuthorizationV1) SelfSubjectAccessReviews() typedauthorizationv1.SelfSubjectAccessReviewInterface { - return &wrapAuthorizationV1SelfSubjectAccessReviewImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "authorization.k8s.io", - Version: "v1", - Resource: "selfsubjectaccessreviews", - }), - } -} - -type wrapAuthorizationV1SelfSubjectAccessReviewImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedauthorizationv1.SelfSubjectAccessReviewInterface = (*wrapAuthorizationV1SelfSubjectAccessReviewImpl)(nil) - -func (w *wrapAuthorizationV1SelfSubjectAccessReviewImpl) Create(ctx context.Context, in *authorizationv1.SelfSubjectAccessReview, opts metav1.CreateOptions) (*authorizationv1.SelfSubjectAccessReview, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "authorization.k8s.io", - Version: "v1", - Kind: "SelfSubjectAccessReview", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &authorizationv1.SelfSubjectAccessReview{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAuthorizationV1) SelfSubjectRulesReviews() typedauthorizationv1.SelfSubjectRulesReviewInterface { - return &wrapAuthorizationV1SelfSubjectRulesReviewImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "authorization.k8s.io", - Version: "v1", - Resource: "selfsubjectrulesreviews", - }), - } -} - -type wrapAuthorizationV1SelfSubjectRulesReviewImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedauthorizationv1.SelfSubjectRulesReviewInterface = (*wrapAuthorizationV1SelfSubjectRulesReviewImpl)(nil) - -func (w *wrapAuthorizationV1SelfSubjectRulesReviewImpl) Create(ctx context.Context, in *authorizationv1.SelfSubjectRulesReview, opts metav1.CreateOptions) (*authorizationv1.SelfSubjectRulesReview, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "authorization.k8s.io", - Version: "v1", - Kind: "SelfSubjectRulesReview", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &authorizationv1.SelfSubjectRulesReview{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAuthorizationV1) SubjectAccessReviews() typedauthorizationv1.SubjectAccessReviewInterface { - return &wrapAuthorizationV1SubjectAccessReviewImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "authorization.k8s.io", - Version: "v1", - Resource: "subjectaccessreviews", - }), - } -} - -type wrapAuthorizationV1SubjectAccessReviewImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedauthorizationv1.SubjectAccessReviewInterface = (*wrapAuthorizationV1SubjectAccessReviewImpl)(nil) - -func (w *wrapAuthorizationV1SubjectAccessReviewImpl) Create(ctx context.Context, in *authorizationv1.SubjectAccessReview, opts metav1.CreateOptions) (*authorizationv1.SubjectAccessReview, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "authorization.k8s.io", - Version: "v1", - Kind: "SubjectAccessReview", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &authorizationv1.SubjectAccessReview{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -// AuthorizationV1beta1 retrieves the AuthorizationV1beta1Client -func (w *wrapClient) AuthorizationV1beta1() typedauthorizationv1beta1.AuthorizationV1beta1Interface { - return &wrapAuthorizationV1beta1{ - dyn: w.dyn, - } -} - -type wrapAuthorizationV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapAuthorizationV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAuthorizationV1beta1) LocalSubjectAccessReviews(namespace string) typedauthorizationv1beta1.LocalSubjectAccessReviewInterface { - return &wrapAuthorizationV1beta1LocalSubjectAccessReviewImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "authorization.k8s.io", - Version: "v1beta1", - Resource: "localsubjectaccessreviews", - }), - - namespace: namespace, - } -} - -type wrapAuthorizationV1beta1LocalSubjectAccessReviewImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedauthorizationv1beta1.LocalSubjectAccessReviewInterface = (*wrapAuthorizationV1beta1LocalSubjectAccessReviewImpl)(nil) - -func (w *wrapAuthorizationV1beta1LocalSubjectAccessReviewImpl) Create(ctx context.Context, in *authorizationv1beta1.LocalSubjectAccessReview, opts metav1.CreateOptions) (*authorizationv1beta1.LocalSubjectAccessReview, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "authorization.k8s.io", - Version: "v1beta1", - Kind: "LocalSubjectAccessReview", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &authorizationv1beta1.LocalSubjectAccessReview{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAuthorizationV1beta1) SelfSubjectAccessReviews() typedauthorizationv1beta1.SelfSubjectAccessReviewInterface { - return &wrapAuthorizationV1beta1SelfSubjectAccessReviewImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "authorization.k8s.io", - Version: "v1beta1", - Resource: "selfsubjectaccessreviews", - }), - } -} - -type wrapAuthorizationV1beta1SelfSubjectAccessReviewImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedauthorizationv1beta1.SelfSubjectAccessReviewInterface = (*wrapAuthorizationV1beta1SelfSubjectAccessReviewImpl)(nil) - -func (w *wrapAuthorizationV1beta1SelfSubjectAccessReviewImpl) Create(ctx context.Context, in *authorizationv1beta1.SelfSubjectAccessReview, opts metav1.CreateOptions) (*authorizationv1beta1.SelfSubjectAccessReview, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "authorization.k8s.io", - Version: "v1beta1", - Kind: "SelfSubjectAccessReview", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &authorizationv1beta1.SelfSubjectAccessReview{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAuthorizationV1beta1) SelfSubjectRulesReviews() typedauthorizationv1beta1.SelfSubjectRulesReviewInterface { - return &wrapAuthorizationV1beta1SelfSubjectRulesReviewImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "authorization.k8s.io", - Version: "v1beta1", - Resource: "selfsubjectrulesreviews", - }), - } -} - -type wrapAuthorizationV1beta1SelfSubjectRulesReviewImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedauthorizationv1beta1.SelfSubjectRulesReviewInterface = (*wrapAuthorizationV1beta1SelfSubjectRulesReviewImpl)(nil) - -func (w *wrapAuthorizationV1beta1SelfSubjectRulesReviewImpl) Create(ctx context.Context, in *authorizationv1beta1.SelfSubjectRulesReview, opts metav1.CreateOptions) (*authorizationv1beta1.SelfSubjectRulesReview, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "authorization.k8s.io", - Version: "v1beta1", - Kind: "SelfSubjectRulesReview", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &authorizationv1beta1.SelfSubjectRulesReview{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAuthorizationV1beta1) SubjectAccessReviews() typedauthorizationv1beta1.SubjectAccessReviewInterface { - return &wrapAuthorizationV1beta1SubjectAccessReviewImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "authorization.k8s.io", - Version: "v1beta1", - Resource: "subjectaccessreviews", - }), - } -} - -type wrapAuthorizationV1beta1SubjectAccessReviewImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedauthorizationv1beta1.SubjectAccessReviewInterface = (*wrapAuthorizationV1beta1SubjectAccessReviewImpl)(nil) - -func (w *wrapAuthorizationV1beta1SubjectAccessReviewImpl) Create(ctx context.Context, in *authorizationv1beta1.SubjectAccessReview, opts metav1.CreateOptions) (*authorizationv1beta1.SubjectAccessReview, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "authorization.k8s.io", - Version: "v1beta1", - Kind: "SubjectAccessReview", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &authorizationv1beta1.SubjectAccessReview{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -// AutoscalingV1 retrieves the AutoscalingV1Client -func (w *wrapClient) AutoscalingV1() typedautoscalingv1.AutoscalingV1Interface { - return &wrapAutoscalingV1{ - dyn: w.dyn, - } -} - -type wrapAutoscalingV1 struct { - dyn dynamic.Interface -} - -func (w *wrapAutoscalingV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAutoscalingV1) HorizontalPodAutoscalers(namespace string) typedautoscalingv1.HorizontalPodAutoscalerInterface { - return &wrapAutoscalingV1HorizontalPodAutoscalerImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "autoscaling", - Version: "v1", - Resource: "horizontalpodautoscalers", - }), - - namespace: namespace, - } -} - -type wrapAutoscalingV1HorizontalPodAutoscalerImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedautoscalingv1.HorizontalPodAutoscalerInterface = (*wrapAutoscalingV1HorizontalPodAutoscalerImpl)(nil) - -func (w *wrapAutoscalingV1HorizontalPodAutoscalerImpl) Apply(ctx context.Context, in *applyconfigurationsautoscalingv1.HorizontalPodAutoscalerApplyConfiguration, opts metav1.ApplyOptions) (result *autoscalingv1.HorizontalPodAutoscaler, err error) { - in.Kind = ptr.String("HorizontalPodAutoscaler") - - in.APIVersion = ptr.String("autoscaling/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV1HorizontalPodAutoscalerImpl) ApplyStatus(ctx context.Context, in *applyconfigurationsautoscalingv1.HorizontalPodAutoscalerApplyConfiguration, opts metav1.ApplyOptions) (result *autoscalingv1.HorizontalPodAutoscaler, err error) { - in.Kind = ptr.String("HorizontalPodAutoscaler") - - in.APIVersion = ptr.String("autoscaling/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV1HorizontalPodAutoscalerImpl) Create(ctx context.Context, in *autoscalingv1.HorizontalPodAutoscaler, opts metav1.CreateOptions) (*autoscalingv1.HorizontalPodAutoscaler, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "autoscaling", - Version: "v1", - Kind: "HorizontalPodAutoscaler", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV1HorizontalPodAutoscalerImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAutoscalingV1HorizontalPodAutoscalerImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAutoscalingV1HorizontalPodAutoscalerImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*autoscalingv1.HorizontalPodAutoscaler, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &autoscalingv1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV1HorizontalPodAutoscalerImpl) List(ctx context.Context, opts metav1.ListOptions) (*autoscalingv1.HorizontalPodAutoscalerList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &autoscalingv1.HorizontalPodAutoscalerList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV1HorizontalPodAutoscalerImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *autoscalingv1.HorizontalPodAutoscaler, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &autoscalingv1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV1HorizontalPodAutoscalerImpl) Update(ctx context.Context, in *autoscalingv1.HorizontalPodAutoscaler, opts metav1.UpdateOptions) (*autoscalingv1.HorizontalPodAutoscaler, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "autoscaling", - Version: "v1", - Kind: "HorizontalPodAutoscaler", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV1HorizontalPodAutoscalerImpl) UpdateStatus(ctx context.Context, in *autoscalingv1.HorizontalPodAutoscaler, opts metav1.UpdateOptions) (*autoscalingv1.HorizontalPodAutoscaler, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "autoscaling", - Version: "v1", - Kind: "HorizontalPodAutoscaler", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV1HorizontalPodAutoscalerImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// AutoscalingV2 retrieves the AutoscalingV2Client -func (w *wrapClient) AutoscalingV2() typedautoscalingv2.AutoscalingV2Interface { - return &wrapAutoscalingV2{ - dyn: w.dyn, - } -} - -type wrapAutoscalingV2 struct { - dyn dynamic.Interface -} - -func (w *wrapAutoscalingV2) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAutoscalingV2) HorizontalPodAutoscalers(namespace string) typedautoscalingv2.HorizontalPodAutoscalerInterface { - return &wrapAutoscalingV2HorizontalPodAutoscalerImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "autoscaling", - Version: "v2", - Resource: "horizontalpodautoscalers", - }), - - namespace: namespace, - } -} - -type wrapAutoscalingV2HorizontalPodAutoscalerImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedautoscalingv2.HorizontalPodAutoscalerInterface = (*wrapAutoscalingV2HorizontalPodAutoscalerImpl)(nil) - -func (w *wrapAutoscalingV2HorizontalPodAutoscalerImpl) Apply(ctx context.Context, in *v2.HorizontalPodAutoscalerApplyConfiguration, opts metav1.ApplyOptions) (result *autoscalingv2.HorizontalPodAutoscaler, err error) { - in.Kind = ptr.String("HorizontalPodAutoscaler") - - in.APIVersion = ptr.String("autoscaling/v2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2HorizontalPodAutoscalerImpl) ApplyStatus(ctx context.Context, in *v2.HorizontalPodAutoscalerApplyConfiguration, opts metav1.ApplyOptions) (result *autoscalingv2.HorizontalPodAutoscaler, err error) { - in.Kind = ptr.String("HorizontalPodAutoscaler") - - in.APIVersion = ptr.String("autoscaling/v2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2HorizontalPodAutoscalerImpl) Create(ctx context.Context, in *autoscalingv2.HorizontalPodAutoscaler, opts metav1.CreateOptions) (*autoscalingv2.HorizontalPodAutoscaler, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "autoscaling", - Version: "v2", - Kind: "HorizontalPodAutoscaler", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2HorizontalPodAutoscalerImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAutoscalingV2HorizontalPodAutoscalerImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAutoscalingV2HorizontalPodAutoscalerImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*autoscalingv2.HorizontalPodAutoscaler, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2HorizontalPodAutoscalerImpl) List(ctx context.Context, opts metav1.ListOptions) (*autoscalingv2.HorizontalPodAutoscalerList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2.HorizontalPodAutoscalerList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2HorizontalPodAutoscalerImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *autoscalingv2.HorizontalPodAutoscaler, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2HorizontalPodAutoscalerImpl) Update(ctx context.Context, in *autoscalingv2.HorizontalPodAutoscaler, opts metav1.UpdateOptions) (*autoscalingv2.HorizontalPodAutoscaler, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "autoscaling", - Version: "v2", - Kind: "HorizontalPodAutoscaler", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2HorizontalPodAutoscalerImpl) UpdateStatus(ctx context.Context, in *autoscalingv2.HorizontalPodAutoscaler, opts metav1.UpdateOptions) (*autoscalingv2.HorizontalPodAutoscaler, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "autoscaling", - Version: "v2", - Kind: "HorizontalPodAutoscaler", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2HorizontalPodAutoscalerImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// AutoscalingV2beta1 retrieves the AutoscalingV2beta1Client -func (w *wrapClient) AutoscalingV2beta1() typedautoscalingv2beta1.AutoscalingV2beta1Interface { - return &wrapAutoscalingV2beta1{ - dyn: w.dyn, - } -} - -type wrapAutoscalingV2beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapAutoscalingV2beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAutoscalingV2beta1) HorizontalPodAutoscalers(namespace string) typedautoscalingv2beta1.HorizontalPodAutoscalerInterface { - return &wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "autoscaling", - Version: "v2beta1", - Resource: "horizontalpodautoscalers", - }), - - namespace: namespace, - } -} - -type wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedautoscalingv2beta1.HorizontalPodAutoscalerInterface = (*wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl)(nil) - -func (w *wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl) Apply(ctx context.Context, in *v2beta1.HorizontalPodAutoscalerApplyConfiguration, opts metav1.ApplyOptions) (result *autoscalingv2beta1.HorizontalPodAutoscaler, err error) { - in.Kind = ptr.String("HorizontalPodAutoscaler") - - in.APIVersion = ptr.String("autoscaling/v2beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl) ApplyStatus(ctx context.Context, in *v2beta1.HorizontalPodAutoscalerApplyConfiguration, opts metav1.ApplyOptions) (result *autoscalingv2beta1.HorizontalPodAutoscaler, err error) { - in.Kind = ptr.String("HorizontalPodAutoscaler") - - in.APIVersion = ptr.String("autoscaling/v2beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl) Create(ctx context.Context, in *autoscalingv2beta1.HorizontalPodAutoscaler, opts metav1.CreateOptions) (*autoscalingv2beta1.HorizontalPodAutoscaler, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "autoscaling", - Version: "v2beta1", - Kind: "HorizontalPodAutoscaler", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*autoscalingv2beta1.HorizontalPodAutoscaler, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl) List(ctx context.Context, opts metav1.ListOptions) (*autoscalingv2beta1.HorizontalPodAutoscalerList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta1.HorizontalPodAutoscalerList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *autoscalingv2beta1.HorizontalPodAutoscaler, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl) Update(ctx context.Context, in *autoscalingv2beta1.HorizontalPodAutoscaler, opts metav1.UpdateOptions) (*autoscalingv2beta1.HorizontalPodAutoscaler, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "autoscaling", - Version: "v2beta1", - Kind: "HorizontalPodAutoscaler", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl) UpdateStatus(ctx context.Context, in *autoscalingv2beta1.HorizontalPodAutoscaler, opts metav1.UpdateOptions) (*autoscalingv2beta1.HorizontalPodAutoscaler, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "autoscaling", - Version: "v2beta1", - Kind: "HorizontalPodAutoscaler", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta1.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta1HorizontalPodAutoscalerImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// AutoscalingV2beta2 retrieves the AutoscalingV2beta2Client -func (w *wrapClient) AutoscalingV2beta2() typedautoscalingv2beta2.AutoscalingV2beta2Interface { - return &wrapAutoscalingV2beta2{ - dyn: w.dyn, - } -} - -type wrapAutoscalingV2beta2 struct { - dyn dynamic.Interface -} - -func (w *wrapAutoscalingV2beta2) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapAutoscalingV2beta2) HorizontalPodAutoscalers(namespace string) typedautoscalingv2beta2.HorizontalPodAutoscalerInterface { - return &wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "autoscaling", - Version: "v2beta2", - Resource: "horizontalpodautoscalers", - }), - - namespace: namespace, - } -} - -type wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedautoscalingv2beta2.HorizontalPodAutoscalerInterface = (*wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl)(nil) - -func (w *wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl) Apply(ctx context.Context, in *v2beta2.HorizontalPodAutoscalerApplyConfiguration, opts metav1.ApplyOptions) (result *autoscalingv2beta2.HorizontalPodAutoscaler, err error) { - in.Kind = ptr.String("HorizontalPodAutoscaler") - - in.APIVersion = ptr.String("autoscaling/v2beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl) ApplyStatus(ctx context.Context, in *v2beta2.HorizontalPodAutoscalerApplyConfiguration, opts metav1.ApplyOptions) (result *autoscalingv2beta2.HorizontalPodAutoscaler, err error) { - in.Kind = ptr.String("HorizontalPodAutoscaler") - - in.APIVersion = ptr.String("autoscaling/v2beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl) Create(ctx context.Context, in *autoscalingv2beta2.HorizontalPodAutoscaler, opts metav1.CreateOptions) (*autoscalingv2beta2.HorizontalPodAutoscaler, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "autoscaling", - Version: "v2beta2", - Kind: "HorizontalPodAutoscaler", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*autoscalingv2beta2.HorizontalPodAutoscaler, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl) List(ctx context.Context, opts metav1.ListOptions) (*autoscalingv2beta2.HorizontalPodAutoscalerList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta2.HorizontalPodAutoscalerList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *autoscalingv2beta2.HorizontalPodAutoscaler, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl) Update(ctx context.Context, in *autoscalingv2beta2.HorizontalPodAutoscaler, opts metav1.UpdateOptions) (*autoscalingv2beta2.HorizontalPodAutoscaler, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "autoscaling", - Version: "v2beta2", - Kind: "HorizontalPodAutoscaler", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl) UpdateStatus(ctx context.Context, in *autoscalingv2beta2.HorizontalPodAutoscaler, opts metav1.UpdateOptions) (*autoscalingv2beta2.HorizontalPodAutoscaler, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "autoscaling", - Version: "v2beta2", - Kind: "HorizontalPodAutoscaler", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &autoscalingv2beta2.HorizontalPodAutoscaler{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapAutoscalingV2beta2HorizontalPodAutoscalerImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// BatchV1 retrieves the BatchV1Client -func (w *wrapClient) BatchV1() typedbatchv1.BatchV1Interface { - return &wrapBatchV1{ - dyn: w.dyn, - } -} - -type wrapBatchV1 struct { - dyn dynamic.Interface -} - -func (w *wrapBatchV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapBatchV1) CronJobs(namespace string) typedbatchv1.CronJobInterface { - return &wrapBatchV1CronJobImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "batch", - Version: "v1", - Resource: "cronjobs", - }), - - namespace: namespace, - } -} - -type wrapBatchV1CronJobImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedbatchv1.CronJobInterface = (*wrapBatchV1CronJobImpl)(nil) - -func (w *wrapBatchV1CronJobImpl) Apply(ctx context.Context, in *batchv1.CronJobApplyConfiguration, opts metav1.ApplyOptions) (result *apibatchv1.CronJob, err error) { - in.Kind = ptr.String("CronJob") - - in.APIVersion = ptr.String("batch/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1CronJobImpl) ApplyStatus(ctx context.Context, in *batchv1.CronJobApplyConfiguration, opts metav1.ApplyOptions) (result *apibatchv1.CronJob, err error) { - in.Kind = ptr.String("CronJob") - - in.APIVersion = ptr.String("batch/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1CronJobImpl) Create(ctx context.Context, in *apibatchv1.CronJob, opts metav1.CreateOptions) (*apibatchv1.CronJob, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "batch", - Version: "v1", - Kind: "CronJob", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1CronJobImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapBatchV1CronJobImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapBatchV1CronJobImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apibatchv1.CronJob, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1CronJobImpl) List(ctx context.Context, opts metav1.ListOptions) (*apibatchv1.CronJobList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.CronJobList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1CronJobImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apibatchv1.CronJob, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1CronJobImpl) Update(ctx context.Context, in *apibatchv1.CronJob, opts metav1.UpdateOptions) (*apibatchv1.CronJob, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "batch", - Version: "v1", - Kind: "CronJob", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1CronJobImpl) UpdateStatus(ctx context.Context, in *apibatchv1.CronJob, opts metav1.UpdateOptions) (*apibatchv1.CronJob, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "batch", - Version: "v1", - Kind: "CronJob", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1CronJobImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapBatchV1) Jobs(namespace string) typedbatchv1.JobInterface { - return &wrapBatchV1JobImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "batch", - Version: "v1", - Resource: "jobs", - }), - - namespace: namespace, - } -} - -type wrapBatchV1JobImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedbatchv1.JobInterface = (*wrapBatchV1JobImpl)(nil) - -func (w *wrapBatchV1JobImpl) Apply(ctx context.Context, in *batchv1.JobApplyConfiguration, opts metav1.ApplyOptions) (result *apibatchv1.Job, err error) { - in.Kind = ptr.String("Job") - - in.APIVersion = ptr.String("batch/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.Job{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1JobImpl) ApplyStatus(ctx context.Context, in *batchv1.JobApplyConfiguration, opts metav1.ApplyOptions) (result *apibatchv1.Job, err error) { - in.Kind = ptr.String("Job") - - in.APIVersion = ptr.String("batch/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.Job{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1JobImpl) Create(ctx context.Context, in *apibatchv1.Job, opts metav1.CreateOptions) (*apibatchv1.Job, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "batch", - Version: "v1", - Kind: "Job", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.Job{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1JobImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapBatchV1JobImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapBatchV1JobImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apibatchv1.Job, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.Job{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1JobImpl) List(ctx context.Context, opts metav1.ListOptions) (*apibatchv1.JobList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.JobList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1JobImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apibatchv1.Job, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.Job{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1JobImpl) Update(ctx context.Context, in *apibatchv1.Job, opts metav1.UpdateOptions) (*apibatchv1.Job, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "batch", - Version: "v1", - Kind: "Job", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.Job{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1JobImpl) UpdateStatus(ctx context.Context, in *apibatchv1.Job, opts metav1.UpdateOptions) (*apibatchv1.Job, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "batch", - Version: "v1", - Kind: "Job", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1.Job{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1JobImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// BatchV1beta1 retrieves the BatchV1beta1Client -func (w *wrapClient) BatchV1beta1() typedbatchv1beta1.BatchV1beta1Interface { - return &wrapBatchV1beta1{ - dyn: w.dyn, - } -} - -type wrapBatchV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapBatchV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapBatchV1beta1) CronJobs(namespace string) typedbatchv1beta1.CronJobInterface { - return &wrapBatchV1beta1CronJobImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "batch", - Version: "v1beta1", - Resource: "cronjobs", - }), - - namespace: namespace, - } -} - -type wrapBatchV1beta1CronJobImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedbatchv1beta1.CronJobInterface = (*wrapBatchV1beta1CronJobImpl)(nil) - -func (w *wrapBatchV1beta1CronJobImpl) Apply(ctx context.Context, in *batchv1beta1.CronJobApplyConfiguration, opts metav1.ApplyOptions) (result *apibatchv1beta1.CronJob, err error) { - in.Kind = ptr.String("CronJob") - - in.APIVersion = ptr.String("batch/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1beta1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1beta1CronJobImpl) ApplyStatus(ctx context.Context, in *batchv1beta1.CronJobApplyConfiguration, opts metav1.ApplyOptions) (result *apibatchv1beta1.CronJob, err error) { - in.Kind = ptr.String("CronJob") - - in.APIVersion = ptr.String("batch/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1beta1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1beta1CronJobImpl) Create(ctx context.Context, in *apibatchv1beta1.CronJob, opts metav1.CreateOptions) (*apibatchv1beta1.CronJob, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "batch", - Version: "v1beta1", - Kind: "CronJob", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1beta1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1beta1CronJobImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapBatchV1beta1CronJobImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapBatchV1beta1CronJobImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apibatchv1beta1.CronJob, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apibatchv1beta1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1beta1CronJobImpl) List(ctx context.Context, opts metav1.ListOptions) (*apibatchv1beta1.CronJobList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apibatchv1beta1.CronJobList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1beta1CronJobImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apibatchv1beta1.CronJob, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apibatchv1beta1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1beta1CronJobImpl) Update(ctx context.Context, in *apibatchv1beta1.CronJob, opts metav1.UpdateOptions) (*apibatchv1beta1.CronJob, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "batch", - Version: "v1beta1", - Kind: "CronJob", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1beta1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1beta1CronJobImpl) UpdateStatus(ctx context.Context, in *apibatchv1beta1.CronJob, opts metav1.UpdateOptions) (*apibatchv1beta1.CronJob, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "batch", - Version: "v1beta1", - Kind: "CronJob", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apibatchv1beta1.CronJob{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapBatchV1beta1CronJobImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// CertificatesV1 retrieves the CertificatesV1Client -func (w *wrapClient) CertificatesV1() typedcertificatesv1.CertificatesV1Interface { - return &wrapCertificatesV1{ - dyn: w.dyn, - } -} - -type wrapCertificatesV1 struct { - dyn dynamic.Interface -} - -func (w *wrapCertificatesV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapCertificatesV1) CertificateSigningRequests() typedcertificatesv1.CertificateSigningRequestInterface { - return &wrapCertificatesV1CertificateSigningRequestImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "certificates.k8s.io", - Version: "v1", - Resource: "certificatesigningrequests", - }), - } -} - -type wrapCertificatesV1CertificateSigningRequestImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedcertificatesv1.CertificateSigningRequestInterface = (*wrapCertificatesV1CertificateSigningRequestImpl)(nil) - -func (w *wrapCertificatesV1CertificateSigningRequestImpl) Apply(ctx context.Context, in *certificatesv1.CertificateSigningRequestApplyConfiguration, opts metav1.ApplyOptions) (result *apicertificatesv1.CertificateSigningRequest, err error) { - in.Kind = ptr.String("CertificateSigningRequest") - - in.APIVersion = ptr.String("certificates.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1CertificateSigningRequestImpl) ApplyStatus(ctx context.Context, in *certificatesv1.CertificateSigningRequestApplyConfiguration, opts metav1.ApplyOptions) (result *apicertificatesv1.CertificateSigningRequest, err error) { - in.Kind = ptr.String("CertificateSigningRequest") - - in.APIVersion = ptr.String("certificates.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1CertificateSigningRequestImpl) Create(ctx context.Context, in *apicertificatesv1.CertificateSigningRequest, opts metav1.CreateOptions) (*apicertificatesv1.CertificateSigningRequest, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "certificates.k8s.io", - Version: "v1", - Kind: "CertificateSigningRequest", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1CertificateSigningRequestImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapCertificatesV1CertificateSigningRequestImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCertificatesV1CertificateSigningRequestImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicertificatesv1.CertificateSigningRequest, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1CertificateSigningRequestImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicertificatesv1.CertificateSigningRequestList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1.CertificateSigningRequestList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1CertificateSigningRequestImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicertificatesv1.CertificateSigningRequest, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1CertificateSigningRequestImpl) Update(ctx context.Context, in *apicertificatesv1.CertificateSigningRequest, opts metav1.UpdateOptions) (*apicertificatesv1.CertificateSigningRequest, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "certificates.k8s.io", - Version: "v1", - Kind: "CertificateSigningRequest", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1CertificateSigningRequestImpl) UpdateStatus(ctx context.Context, in *apicertificatesv1.CertificateSigningRequest, opts metav1.UpdateOptions) (*apicertificatesv1.CertificateSigningRequest, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "certificates.k8s.io", - Version: "v1", - Kind: "CertificateSigningRequest", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1CertificateSigningRequestImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCertificatesV1CertificateSigningRequestImpl) UpdateApproval(ctx context.Context, _ string, in *apicertificatesv1.CertificateSigningRequest, opts metav1.UpdateOptions) (*apicertificatesv1.CertificateSigningRequest, error) { - panic("NYI") -} - -// CertificatesV1beta1 retrieves the CertificatesV1beta1Client -func (w *wrapClient) CertificatesV1beta1() typedcertificatesv1beta1.CertificatesV1beta1Interface { - return &wrapCertificatesV1beta1{ - dyn: w.dyn, - } -} - -type wrapCertificatesV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapCertificatesV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapCertificatesV1beta1) CertificateSigningRequests() typedcertificatesv1beta1.CertificateSigningRequestInterface { - return &wrapCertificatesV1beta1CertificateSigningRequestImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "certificates.k8s.io", - Version: "v1beta1", - Resource: "certificatesigningrequests", - }), - } -} - -type wrapCertificatesV1beta1CertificateSigningRequestImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedcertificatesv1beta1.CertificateSigningRequestInterface = (*wrapCertificatesV1beta1CertificateSigningRequestImpl)(nil) - -func (w *wrapCertificatesV1beta1CertificateSigningRequestImpl) Apply(ctx context.Context, in *certificatesv1beta1.CertificateSigningRequestApplyConfiguration, opts metav1.ApplyOptions) (result *apicertificatesv1beta1.CertificateSigningRequest, err error) { - in.Kind = ptr.String("CertificateSigningRequest") - - in.APIVersion = ptr.String("certificates.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1beta1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1beta1CertificateSigningRequestImpl) ApplyStatus(ctx context.Context, in *certificatesv1beta1.CertificateSigningRequestApplyConfiguration, opts metav1.ApplyOptions) (result *apicertificatesv1beta1.CertificateSigningRequest, err error) { - in.Kind = ptr.String("CertificateSigningRequest") - - in.APIVersion = ptr.String("certificates.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1beta1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1beta1CertificateSigningRequestImpl) Create(ctx context.Context, in *apicertificatesv1beta1.CertificateSigningRequest, opts metav1.CreateOptions) (*apicertificatesv1beta1.CertificateSigningRequest, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "certificates.k8s.io", - Version: "v1beta1", - Kind: "CertificateSigningRequest", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1beta1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1beta1CertificateSigningRequestImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapCertificatesV1beta1CertificateSigningRequestImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCertificatesV1beta1CertificateSigningRequestImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicertificatesv1beta1.CertificateSigningRequest, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1beta1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1beta1CertificateSigningRequestImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicertificatesv1beta1.CertificateSigningRequestList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1beta1.CertificateSigningRequestList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1beta1CertificateSigningRequestImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicertificatesv1beta1.CertificateSigningRequest, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1beta1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1beta1CertificateSigningRequestImpl) Update(ctx context.Context, in *apicertificatesv1beta1.CertificateSigningRequest, opts metav1.UpdateOptions) (*apicertificatesv1beta1.CertificateSigningRequest, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "certificates.k8s.io", - Version: "v1beta1", - Kind: "CertificateSigningRequest", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1beta1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1beta1CertificateSigningRequestImpl) UpdateStatus(ctx context.Context, in *apicertificatesv1beta1.CertificateSigningRequest, opts metav1.UpdateOptions) (*apicertificatesv1beta1.CertificateSigningRequest, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "certificates.k8s.io", - Version: "v1beta1", - Kind: "CertificateSigningRequest", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicertificatesv1beta1.CertificateSigningRequest{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCertificatesV1beta1CertificateSigningRequestImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// CoordinationV1 retrieves the CoordinationV1Client -func (w *wrapClient) CoordinationV1() typedcoordinationv1.CoordinationV1Interface { - return &wrapCoordinationV1{ - dyn: w.dyn, - } -} - -type wrapCoordinationV1 struct { - dyn dynamic.Interface -} - -func (w *wrapCoordinationV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapCoordinationV1) Leases(namespace string) typedcoordinationv1.LeaseInterface { - return &wrapCoordinationV1LeaseImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "coordination.k8s.io", - Version: "v1", - Resource: "leases", - }), - - namespace: namespace, - } -} - -type wrapCoordinationV1LeaseImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcoordinationv1.LeaseInterface = (*wrapCoordinationV1LeaseImpl)(nil) - -func (w *wrapCoordinationV1LeaseImpl) Apply(ctx context.Context, in *coordinationv1.LeaseApplyConfiguration, opts metav1.ApplyOptions) (result *apicoordinationv1.Lease, err error) { - in.Kind = ptr.String("Lease") - - in.APIVersion = ptr.String("coordination.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1LeaseImpl) ApplyStatus(ctx context.Context, in *coordinationv1.LeaseApplyConfiguration, opts metav1.ApplyOptions) (result *apicoordinationv1.Lease, err error) { - in.Kind = ptr.String("Lease") - - in.APIVersion = ptr.String("coordination.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1LeaseImpl) Create(ctx context.Context, in *apicoordinationv1.Lease, opts metav1.CreateOptions) (*apicoordinationv1.Lease, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "coordination.k8s.io", - Version: "v1", - Kind: "Lease", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1LeaseImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoordinationV1LeaseImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoordinationV1LeaseImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicoordinationv1.Lease, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1LeaseImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicoordinationv1.LeaseList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1.LeaseList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1LeaseImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicoordinationv1.Lease, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1LeaseImpl) Update(ctx context.Context, in *apicoordinationv1.Lease, opts metav1.UpdateOptions) (*apicoordinationv1.Lease, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "coordination.k8s.io", - Version: "v1", - Kind: "Lease", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1LeaseImpl) UpdateStatus(ctx context.Context, in *apicoordinationv1.Lease, opts metav1.UpdateOptions) (*apicoordinationv1.Lease, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "coordination.k8s.io", - Version: "v1", - Kind: "Lease", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1LeaseImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// CoordinationV1beta1 retrieves the CoordinationV1beta1Client -func (w *wrapClient) CoordinationV1beta1() typedcoordinationv1beta1.CoordinationV1beta1Interface { - return &wrapCoordinationV1beta1{ - dyn: w.dyn, - } -} - -type wrapCoordinationV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapCoordinationV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapCoordinationV1beta1) Leases(namespace string) typedcoordinationv1beta1.LeaseInterface { - return &wrapCoordinationV1beta1LeaseImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "coordination.k8s.io", - Version: "v1beta1", - Resource: "leases", - }), - - namespace: namespace, - } -} - -type wrapCoordinationV1beta1LeaseImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcoordinationv1beta1.LeaseInterface = (*wrapCoordinationV1beta1LeaseImpl)(nil) - -func (w *wrapCoordinationV1beta1LeaseImpl) Apply(ctx context.Context, in *coordinationv1beta1.LeaseApplyConfiguration, opts metav1.ApplyOptions) (result *apicoordinationv1beta1.Lease, err error) { - in.Kind = ptr.String("Lease") - - in.APIVersion = ptr.String("coordination.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1beta1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1beta1LeaseImpl) ApplyStatus(ctx context.Context, in *coordinationv1beta1.LeaseApplyConfiguration, opts metav1.ApplyOptions) (result *apicoordinationv1beta1.Lease, err error) { - in.Kind = ptr.String("Lease") - - in.APIVersion = ptr.String("coordination.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1beta1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1beta1LeaseImpl) Create(ctx context.Context, in *apicoordinationv1beta1.Lease, opts metav1.CreateOptions) (*apicoordinationv1beta1.Lease, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "coordination.k8s.io", - Version: "v1beta1", - Kind: "Lease", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1beta1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1beta1LeaseImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoordinationV1beta1LeaseImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoordinationV1beta1LeaseImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicoordinationv1beta1.Lease, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1beta1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1beta1LeaseImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicoordinationv1beta1.LeaseList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1beta1.LeaseList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1beta1LeaseImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicoordinationv1beta1.Lease, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1beta1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1beta1LeaseImpl) Update(ctx context.Context, in *apicoordinationv1beta1.Lease, opts metav1.UpdateOptions) (*apicoordinationv1beta1.Lease, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "coordination.k8s.io", - Version: "v1beta1", - Kind: "Lease", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1beta1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1beta1LeaseImpl) UpdateStatus(ctx context.Context, in *apicoordinationv1beta1.Lease, opts metav1.UpdateOptions) (*apicoordinationv1beta1.Lease, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "coordination.k8s.io", - Version: "v1beta1", - Kind: "Lease", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicoordinationv1beta1.Lease{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoordinationV1beta1LeaseImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// CoreV1 retrieves the CoreV1Client -func (w *wrapClient) CoreV1() typedcorev1.CoreV1Interface { - return &wrapCoreV1{ - dyn: w.dyn, - } -} - -type wrapCoreV1 struct { - dyn dynamic.Interface -} - -func (w *wrapCoreV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapCoreV1) ComponentStatuses() typedcorev1.ComponentStatusInterface { - return &wrapCoreV1ComponentStatusImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "componentstatuses", - }), - } -} - -type wrapCoreV1ComponentStatusImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedcorev1.ComponentStatusInterface = (*wrapCoreV1ComponentStatusImpl)(nil) - -func (w *wrapCoreV1ComponentStatusImpl) Apply(ctx context.Context, in *corev1.ComponentStatusApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.ComponentStatus, err error) { - in.Kind = ptr.String("ComponentStatus") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ComponentStatus{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ComponentStatusImpl) ApplyStatus(ctx context.Context, in *corev1.ComponentStatusApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.ComponentStatus, err error) { - in.Kind = ptr.String("ComponentStatus") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ComponentStatus{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ComponentStatusImpl) Create(ctx context.Context, in *apicorev1.ComponentStatus, opts metav1.CreateOptions) (*apicorev1.ComponentStatus, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ComponentStatus", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ComponentStatus{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ComponentStatusImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapCoreV1ComponentStatusImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1ComponentStatusImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.ComponentStatus, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ComponentStatus{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ComponentStatusImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.ComponentStatusList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ComponentStatusList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ComponentStatusImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.ComponentStatus, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ComponentStatus{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ComponentStatusImpl) Update(ctx context.Context, in *apicorev1.ComponentStatus, opts metav1.UpdateOptions) (*apicorev1.ComponentStatus, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ComponentStatus", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ComponentStatus{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ComponentStatusImpl) UpdateStatus(ctx context.Context, in *apicorev1.ComponentStatus, opts metav1.UpdateOptions) (*apicorev1.ComponentStatus, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ComponentStatus", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ComponentStatus{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ComponentStatusImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) ConfigMaps(namespace string) typedcorev1.ConfigMapInterface { - return &wrapCoreV1ConfigMapImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "configmaps", - }), - - namespace: namespace, - } -} - -type wrapCoreV1ConfigMapImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcorev1.ConfigMapInterface = (*wrapCoreV1ConfigMapImpl)(nil) - -func (w *wrapCoreV1ConfigMapImpl) Apply(ctx context.Context, in *corev1.ConfigMapApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.ConfigMap, err error) { - in.Kind = ptr.String("ConfigMap") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ConfigMap{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ConfigMapImpl) ApplyStatus(ctx context.Context, in *corev1.ConfigMapApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.ConfigMap, err error) { - in.Kind = ptr.String("ConfigMap") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ConfigMap{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ConfigMapImpl) Create(ctx context.Context, in *apicorev1.ConfigMap, opts metav1.CreateOptions) (*apicorev1.ConfigMap, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ConfigMap", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ConfigMap{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ConfigMapImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoreV1ConfigMapImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1ConfigMapImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.ConfigMap, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ConfigMap{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ConfigMapImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.ConfigMapList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ConfigMapList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ConfigMapImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.ConfigMap, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ConfigMap{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ConfigMapImpl) Update(ctx context.Context, in *apicorev1.ConfigMap, opts metav1.UpdateOptions) (*apicorev1.ConfigMap, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ConfigMap", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ConfigMap{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ConfigMapImpl) UpdateStatus(ctx context.Context, in *apicorev1.ConfigMap, opts metav1.UpdateOptions) (*apicorev1.ConfigMap, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ConfigMap", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ConfigMap{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ConfigMapImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) Endpoints(namespace string) typedcorev1.EndpointsInterface { - return &wrapCoreV1EndpointsImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "endpoints", - }), - - namespace: namespace, - } -} - -type wrapCoreV1EndpointsImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcorev1.EndpointsInterface = (*wrapCoreV1EndpointsImpl)(nil) - -func (w *wrapCoreV1EndpointsImpl) Apply(ctx context.Context, in *corev1.EndpointsApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Endpoints, err error) { - in.Kind = ptr.String("Endpoints") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Endpoints{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EndpointsImpl) ApplyStatus(ctx context.Context, in *corev1.EndpointsApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Endpoints, err error) { - in.Kind = ptr.String("Endpoints") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Endpoints{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EndpointsImpl) Create(ctx context.Context, in *apicorev1.Endpoints, opts metav1.CreateOptions) (*apicorev1.Endpoints, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Endpoints", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Endpoints{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EndpointsImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoreV1EndpointsImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1EndpointsImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.Endpoints, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Endpoints{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EndpointsImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.EndpointsList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.EndpointsList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EndpointsImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.Endpoints, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Endpoints{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EndpointsImpl) Update(ctx context.Context, in *apicorev1.Endpoints, opts metav1.UpdateOptions) (*apicorev1.Endpoints, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Endpoints", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Endpoints{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EndpointsImpl) UpdateStatus(ctx context.Context, in *apicorev1.Endpoints, opts metav1.UpdateOptions) (*apicorev1.Endpoints, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Endpoints", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Endpoints{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EndpointsImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) Events(namespace string) typedcorev1.EventInterface { - return &wrapCoreV1EventImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "events", - }), - - namespace: namespace, - } -} - -type wrapCoreV1EventImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcorev1.EventInterface = (*wrapCoreV1EventImpl)(nil) - -func (w *wrapCoreV1EventImpl) Apply(ctx context.Context, in *corev1.EventApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Event, err error) { - in.Kind = ptr.String("Event") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EventImpl) ApplyStatus(ctx context.Context, in *corev1.EventApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Event, err error) { - in.Kind = ptr.String("Event") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EventImpl) Create(ctx context.Context, in *apicorev1.Event, opts metav1.CreateOptions) (*apicorev1.Event, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Event", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EventImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoreV1EventImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1EventImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.Event, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EventImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.EventList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.EventList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EventImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.Event, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EventImpl) Update(ctx context.Context, in *apicorev1.Event, opts metav1.UpdateOptions) (*apicorev1.Event, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Event", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EventImpl) UpdateStatus(ctx context.Context, in *apicorev1.Event, opts metav1.UpdateOptions) (*apicorev1.Event, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Event", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1EventImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) LimitRanges(namespace string) typedcorev1.LimitRangeInterface { - return &wrapCoreV1LimitRangeImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "limitranges", - }), - - namespace: namespace, - } -} - -type wrapCoreV1LimitRangeImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcorev1.LimitRangeInterface = (*wrapCoreV1LimitRangeImpl)(nil) - -func (w *wrapCoreV1LimitRangeImpl) Apply(ctx context.Context, in *corev1.LimitRangeApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.LimitRange, err error) { - in.Kind = ptr.String("LimitRange") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.LimitRange{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1LimitRangeImpl) ApplyStatus(ctx context.Context, in *corev1.LimitRangeApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.LimitRange, err error) { - in.Kind = ptr.String("LimitRange") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.LimitRange{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1LimitRangeImpl) Create(ctx context.Context, in *apicorev1.LimitRange, opts metav1.CreateOptions) (*apicorev1.LimitRange, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "LimitRange", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.LimitRange{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1LimitRangeImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoreV1LimitRangeImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1LimitRangeImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.LimitRange, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.LimitRange{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1LimitRangeImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.LimitRangeList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.LimitRangeList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1LimitRangeImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.LimitRange, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.LimitRange{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1LimitRangeImpl) Update(ctx context.Context, in *apicorev1.LimitRange, opts metav1.UpdateOptions) (*apicorev1.LimitRange, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "LimitRange", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.LimitRange{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1LimitRangeImpl) UpdateStatus(ctx context.Context, in *apicorev1.LimitRange, opts metav1.UpdateOptions) (*apicorev1.LimitRange, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "LimitRange", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.LimitRange{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1LimitRangeImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) Namespaces() typedcorev1.NamespaceInterface { - return &wrapCoreV1NamespaceImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "namespaces", - }), - } -} - -type wrapCoreV1NamespaceImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedcorev1.NamespaceInterface = (*wrapCoreV1NamespaceImpl)(nil) - -func (w *wrapCoreV1NamespaceImpl) Apply(ctx context.Context, in *corev1.NamespaceApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Namespace, err error) { - in.Kind = ptr.String("Namespace") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Namespace{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NamespaceImpl) ApplyStatus(ctx context.Context, in *corev1.NamespaceApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Namespace, err error) { - in.Kind = ptr.String("Namespace") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Namespace{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NamespaceImpl) Create(ctx context.Context, in *apicorev1.Namespace, opts metav1.CreateOptions) (*apicorev1.Namespace, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Namespace", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Namespace{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NamespaceImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapCoreV1NamespaceImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.Namespace, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Namespace{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NamespaceImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.NamespaceList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.NamespaceList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NamespaceImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.Namespace, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Namespace{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NamespaceImpl) Update(ctx context.Context, in *apicorev1.Namespace, opts metav1.UpdateOptions) (*apicorev1.Namespace, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Namespace", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Namespace{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NamespaceImpl) UpdateStatus(ctx context.Context, in *apicorev1.Namespace, opts metav1.UpdateOptions) (*apicorev1.Namespace, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Namespace", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Namespace{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NamespaceImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) Nodes() typedcorev1.NodeInterface { - return &wrapCoreV1NodeImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "nodes", - }), - } -} - -type wrapCoreV1NodeImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedcorev1.NodeInterface = (*wrapCoreV1NodeImpl)(nil) - -func (w *wrapCoreV1NodeImpl) Apply(ctx context.Context, in *corev1.NodeApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Node, err error) { - in.Kind = ptr.String("Node") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Node{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NodeImpl) ApplyStatus(ctx context.Context, in *corev1.NodeApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Node, err error) { - in.Kind = ptr.String("Node") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Node{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NodeImpl) Create(ctx context.Context, in *apicorev1.Node, opts metav1.CreateOptions) (*apicorev1.Node, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Node", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Node{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NodeImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapCoreV1NodeImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1NodeImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.Node, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Node{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NodeImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.NodeList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.NodeList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NodeImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.Node, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Node{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NodeImpl) Update(ctx context.Context, in *apicorev1.Node, opts metav1.UpdateOptions) (*apicorev1.Node, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Node", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Node{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NodeImpl) UpdateStatus(ctx context.Context, in *apicorev1.Node, opts metav1.UpdateOptions) (*apicorev1.Node, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Node", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Node{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1NodeImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) PersistentVolumes() typedcorev1.PersistentVolumeInterface { - return &wrapCoreV1PersistentVolumeImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "persistentvolumes", - }), - } -} - -type wrapCoreV1PersistentVolumeImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedcorev1.PersistentVolumeInterface = (*wrapCoreV1PersistentVolumeImpl)(nil) - -func (w *wrapCoreV1PersistentVolumeImpl) Apply(ctx context.Context, in *corev1.PersistentVolumeApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.PersistentVolume, err error) { - in.Kind = ptr.String("PersistentVolume") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolume{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeImpl) ApplyStatus(ctx context.Context, in *corev1.PersistentVolumeApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.PersistentVolume, err error) { - in.Kind = ptr.String("PersistentVolume") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolume{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeImpl) Create(ctx context.Context, in *apicorev1.PersistentVolume, opts metav1.CreateOptions) (*apicorev1.PersistentVolume, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "PersistentVolume", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolume{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapCoreV1PersistentVolumeImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1PersistentVolumeImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.PersistentVolume, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolume{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.PersistentVolumeList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolumeList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.PersistentVolume, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolume{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeImpl) Update(ctx context.Context, in *apicorev1.PersistentVolume, opts metav1.UpdateOptions) (*apicorev1.PersistentVolume, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "PersistentVolume", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolume{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeImpl) UpdateStatus(ctx context.Context, in *apicorev1.PersistentVolume, opts metav1.UpdateOptions) (*apicorev1.PersistentVolume, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "PersistentVolume", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolume{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) PersistentVolumeClaims(namespace string) typedcorev1.PersistentVolumeClaimInterface { - return &wrapCoreV1PersistentVolumeClaimImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "persistentvolumeclaims", - }), - - namespace: namespace, - } -} - -type wrapCoreV1PersistentVolumeClaimImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcorev1.PersistentVolumeClaimInterface = (*wrapCoreV1PersistentVolumeClaimImpl)(nil) - -func (w *wrapCoreV1PersistentVolumeClaimImpl) Apply(ctx context.Context, in *corev1.PersistentVolumeClaimApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.PersistentVolumeClaim, err error) { - in.Kind = ptr.String("PersistentVolumeClaim") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolumeClaim{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeClaimImpl) ApplyStatus(ctx context.Context, in *corev1.PersistentVolumeClaimApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.PersistentVolumeClaim, err error) { - in.Kind = ptr.String("PersistentVolumeClaim") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolumeClaim{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeClaimImpl) Create(ctx context.Context, in *apicorev1.PersistentVolumeClaim, opts metav1.CreateOptions) (*apicorev1.PersistentVolumeClaim, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "PersistentVolumeClaim", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolumeClaim{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeClaimImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoreV1PersistentVolumeClaimImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1PersistentVolumeClaimImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.PersistentVolumeClaim, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolumeClaim{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeClaimImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.PersistentVolumeClaimList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolumeClaimList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeClaimImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.PersistentVolumeClaim, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolumeClaim{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeClaimImpl) Update(ctx context.Context, in *apicorev1.PersistentVolumeClaim, opts metav1.UpdateOptions) (*apicorev1.PersistentVolumeClaim, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "PersistentVolumeClaim", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolumeClaim{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeClaimImpl) UpdateStatus(ctx context.Context, in *apicorev1.PersistentVolumeClaim, opts metav1.UpdateOptions) (*apicorev1.PersistentVolumeClaim, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "PersistentVolumeClaim", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PersistentVolumeClaim{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PersistentVolumeClaimImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) Pods(namespace string) typedcorev1.PodInterface { - return &wrapCoreV1PodImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "pods", - }), - - namespace: namespace, - } -} - -type wrapCoreV1PodImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcorev1.PodInterface = (*wrapCoreV1PodImpl)(nil) - -func (w *wrapCoreV1PodImpl) Apply(ctx context.Context, in *corev1.PodApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Pod, err error) { - in.Kind = ptr.String("Pod") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Pod{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodImpl) ApplyStatus(ctx context.Context, in *corev1.PodApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Pod, err error) { - in.Kind = ptr.String("Pod") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Pod{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodImpl) Create(ctx context.Context, in *apicorev1.Pod, opts metav1.CreateOptions) (*apicorev1.Pod, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Pod", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Pod{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoreV1PodImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1PodImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.Pod, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Pod{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.PodList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PodList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.Pod, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Pod{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodImpl) Update(ctx context.Context, in *apicorev1.Pod, opts metav1.UpdateOptions) (*apicorev1.Pod, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Pod", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Pod{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodImpl) UpdateStatus(ctx context.Context, in *apicorev1.Pod, opts metav1.UpdateOptions) (*apicorev1.Pod, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Pod", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Pod{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1PodImpl) UpdateEphemeralContainers(ctx context.Context, _ string, in *apicorev1.Pod, opts metav1.UpdateOptions) (*apicorev1.Pod, error) { - panic("NYI") -} - -func (w *wrapCoreV1) PodTemplates(namespace string) typedcorev1.PodTemplateInterface { - return &wrapCoreV1PodTemplateImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "podtemplates", - }), - - namespace: namespace, - } -} - -type wrapCoreV1PodTemplateImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcorev1.PodTemplateInterface = (*wrapCoreV1PodTemplateImpl)(nil) - -func (w *wrapCoreV1PodTemplateImpl) Apply(ctx context.Context, in *corev1.PodTemplateApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.PodTemplate, err error) { - in.Kind = ptr.String("PodTemplate") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PodTemplate{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodTemplateImpl) ApplyStatus(ctx context.Context, in *corev1.PodTemplateApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.PodTemplate, err error) { - in.Kind = ptr.String("PodTemplate") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PodTemplate{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodTemplateImpl) Create(ctx context.Context, in *apicorev1.PodTemplate, opts metav1.CreateOptions) (*apicorev1.PodTemplate, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "PodTemplate", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PodTemplate{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodTemplateImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoreV1PodTemplateImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1PodTemplateImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.PodTemplate, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PodTemplate{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodTemplateImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.PodTemplateList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PodTemplateList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodTemplateImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.PodTemplate, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PodTemplate{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodTemplateImpl) Update(ctx context.Context, in *apicorev1.PodTemplate, opts metav1.UpdateOptions) (*apicorev1.PodTemplate, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "PodTemplate", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PodTemplate{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodTemplateImpl) UpdateStatus(ctx context.Context, in *apicorev1.PodTemplate, opts metav1.UpdateOptions) (*apicorev1.PodTemplate, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "PodTemplate", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.PodTemplate{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1PodTemplateImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) ReplicationControllers(namespace string) typedcorev1.ReplicationControllerInterface { - return &wrapCoreV1ReplicationControllerImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "replicationcontrollers", - }), - - namespace: namespace, - } -} - -type wrapCoreV1ReplicationControllerImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcorev1.ReplicationControllerInterface = (*wrapCoreV1ReplicationControllerImpl)(nil) - -func (w *wrapCoreV1ReplicationControllerImpl) Apply(ctx context.Context, in *corev1.ReplicationControllerApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.ReplicationController, err error) { - in.Kind = ptr.String("ReplicationController") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ReplicationController{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ReplicationControllerImpl) ApplyStatus(ctx context.Context, in *corev1.ReplicationControllerApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.ReplicationController, err error) { - in.Kind = ptr.String("ReplicationController") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ReplicationController{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ReplicationControllerImpl) Create(ctx context.Context, in *apicorev1.ReplicationController, opts metav1.CreateOptions) (*apicorev1.ReplicationController, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ReplicationController", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ReplicationController{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ReplicationControllerImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoreV1ReplicationControllerImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1ReplicationControllerImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.ReplicationController, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ReplicationController{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ReplicationControllerImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.ReplicationControllerList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ReplicationControllerList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ReplicationControllerImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.ReplicationController, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ReplicationController{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ReplicationControllerImpl) Update(ctx context.Context, in *apicorev1.ReplicationController, opts metav1.UpdateOptions) (*apicorev1.ReplicationController, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ReplicationController", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ReplicationController{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ReplicationControllerImpl) UpdateStatus(ctx context.Context, in *apicorev1.ReplicationController, opts metav1.UpdateOptions) (*apicorev1.ReplicationController, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ReplicationController", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ReplicationController{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ReplicationControllerImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1ReplicationControllerImpl) GetScale(ctx context.Context, name string, opts metav1.GetOptions) (*autoscalingv1.Scale, error) { - panic("NYI") -} - -func (w *wrapCoreV1ReplicationControllerImpl) UpdateScale(ctx context.Context, _ string, in *autoscalingv1.Scale, opts metav1.UpdateOptions) (*autoscalingv1.Scale, error) { - panic("NYI") -} - -func (w *wrapCoreV1) ResourceQuotas(namespace string) typedcorev1.ResourceQuotaInterface { - return &wrapCoreV1ResourceQuotaImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "resourcequotas", - }), - - namespace: namespace, - } -} - -type wrapCoreV1ResourceQuotaImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcorev1.ResourceQuotaInterface = (*wrapCoreV1ResourceQuotaImpl)(nil) - -func (w *wrapCoreV1ResourceQuotaImpl) Apply(ctx context.Context, in *corev1.ResourceQuotaApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.ResourceQuota, err error) { - in.Kind = ptr.String("ResourceQuota") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ResourceQuota{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ResourceQuotaImpl) ApplyStatus(ctx context.Context, in *corev1.ResourceQuotaApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.ResourceQuota, err error) { - in.Kind = ptr.String("ResourceQuota") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ResourceQuota{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ResourceQuotaImpl) Create(ctx context.Context, in *apicorev1.ResourceQuota, opts metav1.CreateOptions) (*apicorev1.ResourceQuota, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ResourceQuota", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ResourceQuota{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ResourceQuotaImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoreV1ResourceQuotaImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1ResourceQuotaImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.ResourceQuota, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ResourceQuota{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ResourceQuotaImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.ResourceQuotaList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ResourceQuotaList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ResourceQuotaImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.ResourceQuota, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ResourceQuota{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ResourceQuotaImpl) Update(ctx context.Context, in *apicorev1.ResourceQuota, opts metav1.UpdateOptions) (*apicorev1.ResourceQuota, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ResourceQuota", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ResourceQuota{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ResourceQuotaImpl) UpdateStatus(ctx context.Context, in *apicorev1.ResourceQuota, opts metav1.UpdateOptions) (*apicorev1.ResourceQuota, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ResourceQuota", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ResourceQuota{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ResourceQuotaImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) Secrets(namespace string) typedcorev1.SecretInterface { - return &wrapCoreV1SecretImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "secrets", - }), - - namespace: namespace, - } -} - -type wrapCoreV1SecretImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcorev1.SecretInterface = (*wrapCoreV1SecretImpl)(nil) - -func (w *wrapCoreV1SecretImpl) Apply(ctx context.Context, in *corev1.SecretApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Secret, err error) { - in.Kind = ptr.String("Secret") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Secret{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1SecretImpl) ApplyStatus(ctx context.Context, in *corev1.SecretApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Secret, err error) { - in.Kind = ptr.String("Secret") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Secret{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1SecretImpl) Create(ctx context.Context, in *apicorev1.Secret, opts metav1.CreateOptions) (*apicorev1.Secret, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Secret", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Secret{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1SecretImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoreV1SecretImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1SecretImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.Secret, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Secret{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1SecretImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.SecretList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.SecretList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1SecretImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.Secret, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Secret{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1SecretImpl) Update(ctx context.Context, in *apicorev1.Secret, opts metav1.UpdateOptions) (*apicorev1.Secret, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Secret", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Secret{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1SecretImpl) UpdateStatus(ctx context.Context, in *apicorev1.Secret, opts metav1.UpdateOptions) (*apicorev1.Secret, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Secret", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Secret{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1SecretImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) Services(namespace string) typedcorev1.ServiceInterface { - return &wrapCoreV1ServiceImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "services", - }), - - namespace: namespace, - } -} - -type wrapCoreV1ServiceImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcorev1.ServiceInterface = (*wrapCoreV1ServiceImpl)(nil) - -func (w *wrapCoreV1ServiceImpl) Apply(ctx context.Context, in *corev1.ServiceApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Service, err error) { - in.Kind = ptr.String("Service") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Service{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceImpl) ApplyStatus(ctx context.Context, in *corev1.ServiceApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.Service, err error) { - in.Kind = ptr.String("Service") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Service{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceImpl) Create(ctx context.Context, in *apicorev1.Service, opts metav1.CreateOptions) (*apicorev1.Service, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Service", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Service{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoreV1ServiceImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.Service, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Service{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.ServiceList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ServiceList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.Service, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Service{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceImpl) Update(ctx context.Context, in *apicorev1.Service, opts metav1.UpdateOptions) (*apicorev1.Service, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Service", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Service{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceImpl) UpdateStatus(ctx context.Context, in *apicorev1.Service, opts metav1.UpdateOptions) (*apicorev1.Service, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "Service", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.Service{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1) ServiceAccounts(namespace string) typedcorev1.ServiceAccountInterface { - return &wrapCoreV1ServiceAccountImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "", - Version: "v1", - Resource: "serviceaccounts", - }), - - namespace: namespace, - } -} - -type wrapCoreV1ServiceAccountImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedcorev1.ServiceAccountInterface = (*wrapCoreV1ServiceAccountImpl)(nil) - -func (w *wrapCoreV1ServiceAccountImpl) Apply(ctx context.Context, in *corev1.ServiceAccountApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.ServiceAccount, err error) { - in.Kind = ptr.String("ServiceAccount") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ServiceAccount{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceAccountImpl) ApplyStatus(ctx context.Context, in *corev1.ServiceAccountApplyConfiguration, opts metav1.ApplyOptions) (result *apicorev1.ServiceAccount, err error) { - in.Kind = ptr.String("ServiceAccount") - - in.APIVersion = ptr.String("v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ServiceAccount{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceAccountImpl) Create(ctx context.Context, in *apicorev1.ServiceAccount, opts metav1.CreateOptions) (*apicorev1.ServiceAccount, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ServiceAccount", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ServiceAccount{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceAccountImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapCoreV1ServiceAccountImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapCoreV1ServiceAccountImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apicorev1.ServiceAccount, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ServiceAccount{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceAccountImpl) List(ctx context.Context, opts metav1.ListOptions) (*apicorev1.ServiceAccountList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ServiceAccountList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceAccountImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apicorev1.ServiceAccount, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ServiceAccount{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceAccountImpl) Update(ctx context.Context, in *apicorev1.ServiceAccount, opts metav1.UpdateOptions) (*apicorev1.ServiceAccount, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ServiceAccount", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ServiceAccount{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceAccountImpl) UpdateStatus(ctx context.Context, in *apicorev1.ServiceAccount, opts metav1.UpdateOptions) (*apicorev1.ServiceAccount, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "", - Version: "v1", - Kind: "ServiceAccount", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apicorev1.ServiceAccount{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapCoreV1ServiceAccountImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapCoreV1ServiceAccountImpl) CreateToken(ctx context.Context, _ string, in *authenticationv1.TokenRequest, opts metav1.CreateOptions) (*authenticationv1.TokenRequest, error) { - panic("NYI") -} - -// DiscoveryV1 retrieves the DiscoveryV1Client -func (w *wrapClient) DiscoveryV1() typeddiscoveryv1.DiscoveryV1Interface { - return &wrapDiscoveryV1{ - dyn: w.dyn, - } -} - -type wrapDiscoveryV1 struct { - dyn dynamic.Interface -} - -func (w *wrapDiscoveryV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapDiscoveryV1) EndpointSlices(namespace string) typeddiscoveryv1.EndpointSliceInterface { - return &wrapDiscoveryV1EndpointSliceImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "discovery.k8s.io", - Version: "v1", - Resource: "endpointslices", - }), - - namespace: namespace, - } -} - -type wrapDiscoveryV1EndpointSliceImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typeddiscoveryv1.EndpointSliceInterface = (*wrapDiscoveryV1EndpointSliceImpl)(nil) - -func (w *wrapDiscoveryV1EndpointSliceImpl) Apply(ctx context.Context, in *discoveryv1.EndpointSliceApplyConfiguration, opts metav1.ApplyOptions) (result *apidiscoveryv1.EndpointSlice, err error) { - in.Kind = ptr.String("EndpointSlice") - - in.APIVersion = ptr.String("discovery.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1EndpointSliceImpl) ApplyStatus(ctx context.Context, in *discoveryv1.EndpointSliceApplyConfiguration, opts metav1.ApplyOptions) (result *apidiscoveryv1.EndpointSlice, err error) { - in.Kind = ptr.String("EndpointSlice") - - in.APIVersion = ptr.String("discovery.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1EndpointSliceImpl) Create(ctx context.Context, in *apidiscoveryv1.EndpointSlice, opts metav1.CreateOptions) (*apidiscoveryv1.EndpointSlice, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "discovery.k8s.io", - Version: "v1", - Kind: "EndpointSlice", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1EndpointSliceImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapDiscoveryV1EndpointSliceImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapDiscoveryV1EndpointSliceImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apidiscoveryv1.EndpointSlice, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1EndpointSliceImpl) List(ctx context.Context, opts metav1.ListOptions) (*apidiscoveryv1.EndpointSliceList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1.EndpointSliceList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1EndpointSliceImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apidiscoveryv1.EndpointSlice, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1EndpointSliceImpl) Update(ctx context.Context, in *apidiscoveryv1.EndpointSlice, opts metav1.UpdateOptions) (*apidiscoveryv1.EndpointSlice, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "discovery.k8s.io", - Version: "v1", - Kind: "EndpointSlice", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1EndpointSliceImpl) UpdateStatus(ctx context.Context, in *apidiscoveryv1.EndpointSlice, opts metav1.UpdateOptions) (*apidiscoveryv1.EndpointSlice, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "discovery.k8s.io", - Version: "v1", - Kind: "EndpointSlice", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1EndpointSliceImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// DiscoveryV1beta1 retrieves the DiscoveryV1beta1Client -func (w *wrapClient) DiscoveryV1beta1() typeddiscoveryv1beta1.DiscoveryV1beta1Interface { - return &wrapDiscoveryV1beta1{ - dyn: w.dyn, - } -} - -type wrapDiscoveryV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapDiscoveryV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapDiscoveryV1beta1) EndpointSlices(namespace string) typeddiscoveryv1beta1.EndpointSliceInterface { - return &wrapDiscoveryV1beta1EndpointSliceImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "discovery.k8s.io", - Version: "v1beta1", - Resource: "endpointslices", - }), - - namespace: namespace, - } -} - -type wrapDiscoveryV1beta1EndpointSliceImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typeddiscoveryv1beta1.EndpointSliceInterface = (*wrapDiscoveryV1beta1EndpointSliceImpl)(nil) - -func (w *wrapDiscoveryV1beta1EndpointSliceImpl) Apply(ctx context.Context, in *discoveryv1beta1.EndpointSliceApplyConfiguration, opts metav1.ApplyOptions) (result *apidiscoveryv1beta1.EndpointSlice, err error) { - in.Kind = ptr.String("EndpointSlice") - - in.APIVersion = ptr.String("discovery.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1beta1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1beta1EndpointSliceImpl) ApplyStatus(ctx context.Context, in *discoveryv1beta1.EndpointSliceApplyConfiguration, opts metav1.ApplyOptions) (result *apidiscoveryv1beta1.EndpointSlice, err error) { - in.Kind = ptr.String("EndpointSlice") - - in.APIVersion = ptr.String("discovery.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1beta1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1beta1EndpointSliceImpl) Create(ctx context.Context, in *apidiscoveryv1beta1.EndpointSlice, opts metav1.CreateOptions) (*apidiscoveryv1beta1.EndpointSlice, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "discovery.k8s.io", - Version: "v1beta1", - Kind: "EndpointSlice", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1beta1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1beta1EndpointSliceImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapDiscoveryV1beta1EndpointSliceImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapDiscoveryV1beta1EndpointSliceImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apidiscoveryv1beta1.EndpointSlice, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1beta1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1beta1EndpointSliceImpl) List(ctx context.Context, opts metav1.ListOptions) (*apidiscoveryv1beta1.EndpointSliceList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1beta1.EndpointSliceList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1beta1EndpointSliceImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apidiscoveryv1beta1.EndpointSlice, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1beta1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1beta1EndpointSliceImpl) Update(ctx context.Context, in *apidiscoveryv1beta1.EndpointSlice, opts metav1.UpdateOptions) (*apidiscoveryv1beta1.EndpointSlice, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "discovery.k8s.io", - Version: "v1beta1", - Kind: "EndpointSlice", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1beta1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1beta1EndpointSliceImpl) UpdateStatus(ctx context.Context, in *apidiscoveryv1beta1.EndpointSlice, opts metav1.UpdateOptions) (*apidiscoveryv1beta1.EndpointSlice, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "discovery.k8s.io", - Version: "v1beta1", - Kind: "EndpointSlice", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apidiscoveryv1beta1.EndpointSlice{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapDiscoveryV1beta1EndpointSliceImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// EventsV1 retrieves the EventsV1Client -func (w *wrapClient) EventsV1() typedeventsv1.EventsV1Interface { - return &wrapEventsV1{ - dyn: w.dyn, - } -} - -type wrapEventsV1 struct { - dyn dynamic.Interface -} - -func (w *wrapEventsV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapEventsV1) Events(namespace string) typedeventsv1.EventInterface { - return &wrapEventsV1EventImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "events.k8s.io", - Version: "v1", - Resource: "events", - }), - - namespace: namespace, - } -} - -type wrapEventsV1EventImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedeventsv1.EventInterface = (*wrapEventsV1EventImpl)(nil) - -func (w *wrapEventsV1EventImpl) Apply(ctx context.Context, in *eventsv1.EventApplyConfiguration, opts metav1.ApplyOptions) (result *apieventsv1.Event, err error) { - in.Kind = ptr.String("Event") - - in.APIVersion = ptr.String("events.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apieventsv1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1EventImpl) ApplyStatus(ctx context.Context, in *eventsv1.EventApplyConfiguration, opts metav1.ApplyOptions) (result *apieventsv1.Event, err error) { - in.Kind = ptr.String("Event") - - in.APIVersion = ptr.String("events.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apieventsv1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1EventImpl) Create(ctx context.Context, in *apieventsv1.Event, opts metav1.CreateOptions) (*apieventsv1.Event, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "events.k8s.io", - Version: "v1", - Kind: "Event", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apieventsv1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1EventImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapEventsV1EventImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapEventsV1EventImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apieventsv1.Event, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apieventsv1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1EventImpl) List(ctx context.Context, opts metav1.ListOptions) (*apieventsv1.EventList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apieventsv1.EventList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1EventImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apieventsv1.Event, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apieventsv1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1EventImpl) Update(ctx context.Context, in *apieventsv1.Event, opts metav1.UpdateOptions) (*apieventsv1.Event, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "events.k8s.io", - Version: "v1", - Kind: "Event", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apieventsv1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1EventImpl) UpdateStatus(ctx context.Context, in *apieventsv1.Event, opts metav1.UpdateOptions) (*apieventsv1.Event, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "events.k8s.io", - Version: "v1", - Kind: "Event", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apieventsv1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1EventImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// EventsV1beta1 retrieves the EventsV1beta1Client -func (w *wrapClient) EventsV1beta1() typedeventsv1beta1.EventsV1beta1Interface { - return &wrapEventsV1beta1{ - dyn: w.dyn, - } -} - -type wrapEventsV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapEventsV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapEventsV1beta1) Events(namespace string) typedeventsv1beta1.EventInterface { - return &wrapEventsV1beta1EventImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "events.k8s.io", - Version: "v1beta1", - Resource: "events", - }), - - namespace: namespace, - } -} - -type wrapEventsV1beta1EventImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedeventsv1beta1.EventInterface = (*wrapEventsV1beta1EventImpl)(nil) - -func (w *wrapEventsV1beta1EventImpl) Apply(ctx context.Context, in *eventsv1beta1.EventApplyConfiguration, opts metav1.ApplyOptions) (result *apieventsv1beta1.Event, err error) { - in.Kind = ptr.String("Event") - - in.APIVersion = ptr.String("events.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apieventsv1beta1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1beta1EventImpl) ApplyStatus(ctx context.Context, in *eventsv1beta1.EventApplyConfiguration, opts metav1.ApplyOptions) (result *apieventsv1beta1.Event, err error) { - in.Kind = ptr.String("Event") - - in.APIVersion = ptr.String("events.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apieventsv1beta1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1beta1EventImpl) Create(ctx context.Context, in *apieventsv1beta1.Event, opts metav1.CreateOptions) (*apieventsv1beta1.Event, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "events.k8s.io", - Version: "v1beta1", - Kind: "Event", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apieventsv1beta1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1beta1EventImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapEventsV1beta1EventImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapEventsV1beta1EventImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apieventsv1beta1.Event, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apieventsv1beta1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1beta1EventImpl) List(ctx context.Context, opts metav1.ListOptions) (*apieventsv1beta1.EventList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apieventsv1beta1.EventList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1beta1EventImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apieventsv1beta1.Event, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apieventsv1beta1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1beta1EventImpl) Update(ctx context.Context, in *apieventsv1beta1.Event, opts metav1.UpdateOptions) (*apieventsv1beta1.Event, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "events.k8s.io", - Version: "v1beta1", - Kind: "Event", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apieventsv1beta1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1beta1EventImpl) UpdateStatus(ctx context.Context, in *apieventsv1beta1.Event, opts metav1.UpdateOptions) (*apieventsv1beta1.Event, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "events.k8s.io", - Version: "v1beta1", - Kind: "Event", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apieventsv1beta1.Event{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapEventsV1beta1EventImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// ExtensionsV1beta1 retrieves the ExtensionsV1beta1Client -func (w *wrapClient) ExtensionsV1beta1() typedextensionsv1beta1.ExtensionsV1beta1Interface { - return &wrapExtensionsV1beta1{ - dyn: w.dyn, - } -} - -type wrapExtensionsV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapExtensionsV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapExtensionsV1beta1) DaemonSets(namespace string) typedextensionsv1beta1.DaemonSetInterface { - return &wrapExtensionsV1beta1DaemonSetImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "extensions", - Version: "v1beta1", - Resource: "daemonsets", - }), - - namespace: namespace, - } -} - -type wrapExtensionsV1beta1DaemonSetImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedextensionsv1beta1.DaemonSetInterface = (*wrapExtensionsV1beta1DaemonSetImpl)(nil) - -func (w *wrapExtensionsV1beta1DaemonSetImpl) Apply(ctx context.Context, in *extensionsv1beta1.DaemonSetApplyConfiguration, opts metav1.ApplyOptions) (result *apiextensionsv1beta1.DaemonSet, err error) { - in.Kind = ptr.String("DaemonSet") - - in.APIVersion = ptr.String("extensions/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DaemonSetImpl) ApplyStatus(ctx context.Context, in *extensionsv1beta1.DaemonSetApplyConfiguration, opts metav1.ApplyOptions) (result *apiextensionsv1beta1.DaemonSet, err error) { - in.Kind = ptr.String("DaemonSet") - - in.APIVersion = ptr.String("extensions/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DaemonSetImpl) Create(ctx context.Context, in *apiextensionsv1beta1.DaemonSet, opts metav1.CreateOptions) (*apiextensionsv1beta1.DaemonSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "DaemonSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DaemonSetImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapExtensionsV1beta1DaemonSetImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapExtensionsV1beta1DaemonSetImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiextensionsv1beta1.DaemonSet, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DaemonSetImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiextensionsv1beta1.DaemonSetList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.DaemonSetList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DaemonSetImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiextensionsv1beta1.DaemonSet, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DaemonSetImpl) Update(ctx context.Context, in *apiextensionsv1beta1.DaemonSet, opts metav1.UpdateOptions) (*apiextensionsv1beta1.DaemonSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "DaemonSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DaemonSetImpl) UpdateStatus(ctx context.Context, in *apiextensionsv1beta1.DaemonSet, opts metav1.UpdateOptions) (*apiextensionsv1beta1.DaemonSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "DaemonSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.DaemonSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DaemonSetImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapExtensionsV1beta1) Deployments(namespace string) typedextensionsv1beta1.DeploymentInterface { - return &wrapExtensionsV1beta1DeploymentImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "extensions", - Version: "v1beta1", - Resource: "deployments", - }), - - namespace: namespace, - } -} - -type wrapExtensionsV1beta1DeploymentImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedextensionsv1beta1.DeploymentInterface = (*wrapExtensionsV1beta1DeploymentImpl)(nil) - -func (w *wrapExtensionsV1beta1DeploymentImpl) Apply(ctx context.Context, in *extensionsv1beta1.DeploymentApplyConfiguration, opts metav1.ApplyOptions) (result *apiextensionsv1beta1.Deployment, err error) { - in.Kind = ptr.String("Deployment") - - in.APIVersion = ptr.String("extensions/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) ApplyStatus(ctx context.Context, in *extensionsv1beta1.DeploymentApplyConfiguration, opts metav1.ApplyOptions) (result *apiextensionsv1beta1.Deployment, err error) { - in.Kind = ptr.String("Deployment") - - in.APIVersion = ptr.String("extensions/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) Create(ctx context.Context, in *apiextensionsv1beta1.Deployment, opts metav1.CreateOptions) (*apiextensionsv1beta1.Deployment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "Deployment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiextensionsv1beta1.Deployment, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiextensionsv1beta1.DeploymentList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.DeploymentList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiextensionsv1beta1.Deployment, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) Update(ctx context.Context, in *apiextensionsv1beta1.Deployment, opts metav1.UpdateOptions) (*apiextensionsv1beta1.Deployment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "Deployment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) UpdateStatus(ctx context.Context, in *apiextensionsv1beta1.Deployment, opts metav1.UpdateOptions) (*apiextensionsv1beta1.Deployment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "Deployment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Deployment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) GetScale(ctx context.Context, name string, opts metav1.GetOptions) (*apiextensionsv1beta1.Scale, error) { - panic("NYI") -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) UpdateScale(ctx context.Context, _ string, in *apiextensionsv1beta1.Scale, opts metav1.UpdateOptions) (*apiextensionsv1beta1.Scale, error) { - panic("NYI") -} - -func (w *wrapExtensionsV1beta1DeploymentImpl) ApplyScale(ctx context.Context, name string, in *extensionsv1beta1.ScaleApplyConfiguration, opts metav1.ApplyOptions) (*apiextensionsv1beta1.Scale, error) { - panic("NYI") -} - -func (w *wrapExtensionsV1beta1) Ingresses(namespace string) typedextensionsv1beta1.IngressInterface { - return &wrapExtensionsV1beta1IngressImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "extensions", - Version: "v1beta1", - Resource: "ingresses", - }), - - namespace: namespace, - } -} - -type wrapExtensionsV1beta1IngressImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedextensionsv1beta1.IngressInterface = (*wrapExtensionsV1beta1IngressImpl)(nil) - -func (w *wrapExtensionsV1beta1IngressImpl) Apply(ctx context.Context, in *extensionsv1beta1.IngressApplyConfiguration, opts metav1.ApplyOptions) (result *apiextensionsv1beta1.Ingress, err error) { - in.Kind = ptr.String("Ingress") - - in.APIVersion = ptr.String("extensions/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1IngressImpl) ApplyStatus(ctx context.Context, in *extensionsv1beta1.IngressApplyConfiguration, opts metav1.ApplyOptions) (result *apiextensionsv1beta1.Ingress, err error) { - in.Kind = ptr.String("Ingress") - - in.APIVersion = ptr.String("extensions/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1IngressImpl) Create(ctx context.Context, in *apiextensionsv1beta1.Ingress, opts metav1.CreateOptions) (*apiextensionsv1beta1.Ingress, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "Ingress", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1IngressImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapExtensionsV1beta1IngressImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapExtensionsV1beta1IngressImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiextensionsv1beta1.Ingress, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1IngressImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiextensionsv1beta1.IngressList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.IngressList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1IngressImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiextensionsv1beta1.Ingress, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1IngressImpl) Update(ctx context.Context, in *apiextensionsv1beta1.Ingress, opts metav1.UpdateOptions) (*apiextensionsv1beta1.Ingress, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "Ingress", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1IngressImpl) UpdateStatus(ctx context.Context, in *apiextensionsv1beta1.Ingress, opts metav1.UpdateOptions) (*apiextensionsv1beta1.Ingress, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "Ingress", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1IngressImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapExtensionsV1beta1) NetworkPolicies(namespace string) typedextensionsv1beta1.NetworkPolicyInterface { - return &wrapExtensionsV1beta1NetworkPolicyImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "extensions", - Version: "v1beta1", - Resource: "networkpolicies", - }), - - namespace: namespace, - } -} - -type wrapExtensionsV1beta1NetworkPolicyImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedextensionsv1beta1.NetworkPolicyInterface = (*wrapExtensionsV1beta1NetworkPolicyImpl)(nil) - -func (w *wrapExtensionsV1beta1NetworkPolicyImpl) Apply(ctx context.Context, in *extensionsv1beta1.NetworkPolicyApplyConfiguration, opts metav1.ApplyOptions) (result *apiextensionsv1beta1.NetworkPolicy, err error) { - in.Kind = ptr.String("NetworkPolicy") - - in.APIVersion = ptr.String("extensions/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1NetworkPolicyImpl) ApplyStatus(ctx context.Context, in *extensionsv1beta1.NetworkPolicyApplyConfiguration, opts metav1.ApplyOptions) (result *apiextensionsv1beta1.NetworkPolicy, err error) { - in.Kind = ptr.String("NetworkPolicy") - - in.APIVersion = ptr.String("extensions/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1NetworkPolicyImpl) Create(ctx context.Context, in *apiextensionsv1beta1.NetworkPolicy, opts metav1.CreateOptions) (*apiextensionsv1beta1.NetworkPolicy, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "NetworkPolicy", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1NetworkPolicyImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapExtensionsV1beta1NetworkPolicyImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapExtensionsV1beta1NetworkPolicyImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiextensionsv1beta1.NetworkPolicy, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1NetworkPolicyImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiextensionsv1beta1.NetworkPolicyList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.NetworkPolicyList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1NetworkPolicyImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiextensionsv1beta1.NetworkPolicy, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1NetworkPolicyImpl) Update(ctx context.Context, in *apiextensionsv1beta1.NetworkPolicy, opts metav1.UpdateOptions) (*apiextensionsv1beta1.NetworkPolicy, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "NetworkPolicy", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1NetworkPolicyImpl) UpdateStatus(ctx context.Context, in *apiextensionsv1beta1.NetworkPolicy, opts metav1.UpdateOptions) (*apiextensionsv1beta1.NetworkPolicy, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "NetworkPolicy", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1NetworkPolicyImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapExtensionsV1beta1) PodSecurityPolicies() typedextensionsv1beta1.PodSecurityPolicyInterface { - return &wrapExtensionsV1beta1PodSecurityPolicyImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "extensions", - Version: "v1beta1", - Resource: "podsecuritypolicies", - }), - } -} - -type wrapExtensionsV1beta1PodSecurityPolicyImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedextensionsv1beta1.PodSecurityPolicyInterface = (*wrapExtensionsV1beta1PodSecurityPolicyImpl)(nil) - -func (w *wrapExtensionsV1beta1PodSecurityPolicyImpl) Apply(ctx context.Context, in *extensionsv1beta1.PodSecurityPolicyApplyConfiguration, opts metav1.ApplyOptions) (result *apiextensionsv1beta1.PodSecurityPolicy, err error) { - in.Kind = ptr.String("PodSecurityPolicy") - - in.APIVersion = ptr.String("extensions/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1PodSecurityPolicyImpl) ApplyStatus(ctx context.Context, in *extensionsv1beta1.PodSecurityPolicyApplyConfiguration, opts metav1.ApplyOptions) (result *apiextensionsv1beta1.PodSecurityPolicy, err error) { - in.Kind = ptr.String("PodSecurityPolicy") - - in.APIVersion = ptr.String("extensions/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1PodSecurityPolicyImpl) Create(ctx context.Context, in *apiextensionsv1beta1.PodSecurityPolicy, opts metav1.CreateOptions) (*apiextensionsv1beta1.PodSecurityPolicy, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "PodSecurityPolicy", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1PodSecurityPolicyImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapExtensionsV1beta1PodSecurityPolicyImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapExtensionsV1beta1PodSecurityPolicyImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiextensionsv1beta1.PodSecurityPolicy, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1PodSecurityPolicyImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiextensionsv1beta1.PodSecurityPolicyList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.PodSecurityPolicyList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1PodSecurityPolicyImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiextensionsv1beta1.PodSecurityPolicy, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1PodSecurityPolicyImpl) Update(ctx context.Context, in *apiextensionsv1beta1.PodSecurityPolicy, opts metav1.UpdateOptions) (*apiextensionsv1beta1.PodSecurityPolicy, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "PodSecurityPolicy", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1PodSecurityPolicyImpl) UpdateStatus(ctx context.Context, in *apiextensionsv1beta1.PodSecurityPolicy, opts metav1.UpdateOptions) (*apiextensionsv1beta1.PodSecurityPolicy, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "PodSecurityPolicy", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1PodSecurityPolicyImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapExtensionsV1beta1) ReplicaSets(namespace string) typedextensionsv1beta1.ReplicaSetInterface { - return &wrapExtensionsV1beta1ReplicaSetImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "extensions", - Version: "v1beta1", - Resource: "replicasets", - }), - - namespace: namespace, - } -} - -type wrapExtensionsV1beta1ReplicaSetImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedextensionsv1beta1.ReplicaSetInterface = (*wrapExtensionsV1beta1ReplicaSetImpl)(nil) - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) Apply(ctx context.Context, in *extensionsv1beta1.ReplicaSetApplyConfiguration, opts metav1.ApplyOptions) (result *apiextensionsv1beta1.ReplicaSet, err error) { - in.Kind = ptr.String("ReplicaSet") - - in.APIVersion = ptr.String("extensions/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) ApplyStatus(ctx context.Context, in *extensionsv1beta1.ReplicaSetApplyConfiguration, opts metav1.ApplyOptions) (result *apiextensionsv1beta1.ReplicaSet, err error) { - in.Kind = ptr.String("ReplicaSet") - - in.APIVersion = ptr.String("extensions/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) Create(ctx context.Context, in *apiextensionsv1beta1.ReplicaSet, opts metav1.CreateOptions) (*apiextensionsv1beta1.ReplicaSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "ReplicaSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiextensionsv1beta1.ReplicaSet, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiextensionsv1beta1.ReplicaSetList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.ReplicaSetList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiextensionsv1beta1.ReplicaSet, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) Update(ctx context.Context, in *apiextensionsv1beta1.ReplicaSet, opts metav1.UpdateOptions) (*apiextensionsv1beta1.ReplicaSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "ReplicaSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) UpdateStatus(ctx context.Context, in *apiextensionsv1beta1.ReplicaSet, opts metav1.UpdateOptions) (*apiextensionsv1beta1.ReplicaSet, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "extensions", - Version: "v1beta1", - Kind: "ReplicaSet", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiextensionsv1beta1.ReplicaSet{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) GetScale(ctx context.Context, name string, opts metav1.GetOptions) (*apiextensionsv1beta1.Scale, error) { - panic("NYI") -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) UpdateScale(ctx context.Context, _ string, in *apiextensionsv1beta1.Scale, opts metav1.UpdateOptions) (*apiextensionsv1beta1.Scale, error) { - panic("NYI") -} - -func (w *wrapExtensionsV1beta1ReplicaSetImpl) ApplyScale(ctx context.Context, name string, in *extensionsv1beta1.ScaleApplyConfiguration, opts metav1.ApplyOptions) (*apiextensionsv1beta1.Scale, error) { - panic("NYI") -} - -// FlowcontrolV1alpha1 retrieves the FlowcontrolV1alpha1Client -func (w *wrapClient) FlowcontrolV1alpha1() typedflowcontrolv1alpha1.FlowcontrolV1alpha1Interface { - return &wrapFlowcontrolV1alpha1{ - dyn: w.dyn, - } -} - -type wrapFlowcontrolV1alpha1 struct { - dyn dynamic.Interface -} - -func (w *wrapFlowcontrolV1alpha1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapFlowcontrolV1alpha1) FlowSchemas() typedflowcontrolv1alpha1.FlowSchemaInterface { - return &wrapFlowcontrolV1alpha1FlowSchemaImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1alpha1", - Resource: "flowschemas", - }), - } -} - -type wrapFlowcontrolV1alpha1FlowSchemaImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedflowcontrolv1alpha1.FlowSchemaInterface = (*wrapFlowcontrolV1alpha1FlowSchemaImpl)(nil) - -func (w *wrapFlowcontrolV1alpha1FlowSchemaImpl) Apply(ctx context.Context, in *flowcontrolv1alpha1.FlowSchemaApplyConfiguration, opts metav1.ApplyOptions) (result *apiflowcontrolv1alpha1.FlowSchema, err error) { - in.Kind = ptr.String("FlowSchema") - - in.APIVersion = ptr.String("flowcontrol.apiserver.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1FlowSchemaImpl) ApplyStatus(ctx context.Context, in *flowcontrolv1alpha1.FlowSchemaApplyConfiguration, opts metav1.ApplyOptions) (result *apiflowcontrolv1alpha1.FlowSchema, err error) { - in.Kind = ptr.String("FlowSchema") - - in.APIVersion = ptr.String("flowcontrol.apiserver.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1FlowSchemaImpl) Create(ctx context.Context, in *apiflowcontrolv1alpha1.FlowSchema, opts metav1.CreateOptions) (*apiflowcontrolv1alpha1.FlowSchema, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1alpha1", - Kind: "FlowSchema", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1FlowSchemaImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapFlowcontrolV1alpha1FlowSchemaImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapFlowcontrolV1alpha1FlowSchemaImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiflowcontrolv1alpha1.FlowSchema, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1FlowSchemaImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiflowcontrolv1alpha1.FlowSchemaList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.FlowSchemaList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1FlowSchemaImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiflowcontrolv1alpha1.FlowSchema, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1FlowSchemaImpl) Update(ctx context.Context, in *apiflowcontrolv1alpha1.FlowSchema, opts metav1.UpdateOptions) (*apiflowcontrolv1alpha1.FlowSchema, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1alpha1", - Kind: "FlowSchema", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1FlowSchemaImpl) UpdateStatus(ctx context.Context, in *apiflowcontrolv1alpha1.FlowSchema, opts metav1.UpdateOptions) (*apiflowcontrolv1alpha1.FlowSchema, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1alpha1", - Kind: "FlowSchema", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1FlowSchemaImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapFlowcontrolV1alpha1) PriorityLevelConfigurations() typedflowcontrolv1alpha1.PriorityLevelConfigurationInterface { - return &wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1alpha1", - Resource: "prioritylevelconfigurations", - }), - } -} - -type wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedflowcontrolv1alpha1.PriorityLevelConfigurationInterface = (*wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl)(nil) - -func (w *wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl) Apply(ctx context.Context, in *flowcontrolv1alpha1.PriorityLevelConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *apiflowcontrolv1alpha1.PriorityLevelConfiguration, err error) { - in.Kind = ptr.String("PriorityLevelConfiguration") - - in.APIVersion = ptr.String("flowcontrol.apiserver.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl) ApplyStatus(ctx context.Context, in *flowcontrolv1alpha1.PriorityLevelConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *apiflowcontrolv1alpha1.PriorityLevelConfiguration, err error) { - in.Kind = ptr.String("PriorityLevelConfiguration") - - in.APIVersion = ptr.String("flowcontrol.apiserver.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl) Create(ctx context.Context, in *apiflowcontrolv1alpha1.PriorityLevelConfiguration, opts metav1.CreateOptions) (*apiflowcontrolv1alpha1.PriorityLevelConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1alpha1", - Kind: "PriorityLevelConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiflowcontrolv1alpha1.PriorityLevelConfiguration, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiflowcontrolv1alpha1.PriorityLevelConfigurationList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.PriorityLevelConfigurationList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiflowcontrolv1alpha1.PriorityLevelConfiguration, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl) Update(ctx context.Context, in *apiflowcontrolv1alpha1.PriorityLevelConfiguration, opts metav1.UpdateOptions) (*apiflowcontrolv1alpha1.PriorityLevelConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1alpha1", - Kind: "PriorityLevelConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl) UpdateStatus(ctx context.Context, in *apiflowcontrolv1alpha1.PriorityLevelConfiguration, opts metav1.UpdateOptions) (*apiflowcontrolv1alpha1.PriorityLevelConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1alpha1", - Kind: "PriorityLevelConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1alpha1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1alpha1PriorityLevelConfigurationImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// FlowcontrolV1beta1 retrieves the FlowcontrolV1beta1Client -func (w *wrapClient) FlowcontrolV1beta1() typedflowcontrolv1beta1.FlowcontrolV1beta1Interface { - return &wrapFlowcontrolV1beta1{ - dyn: w.dyn, - } -} - -type wrapFlowcontrolV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapFlowcontrolV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapFlowcontrolV1beta1) FlowSchemas() typedflowcontrolv1beta1.FlowSchemaInterface { - return &wrapFlowcontrolV1beta1FlowSchemaImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta1", - Resource: "flowschemas", - }), - } -} - -type wrapFlowcontrolV1beta1FlowSchemaImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedflowcontrolv1beta1.FlowSchemaInterface = (*wrapFlowcontrolV1beta1FlowSchemaImpl)(nil) - -func (w *wrapFlowcontrolV1beta1FlowSchemaImpl) Apply(ctx context.Context, in *flowcontrolv1beta1.FlowSchemaApplyConfiguration, opts metav1.ApplyOptions) (result *apiflowcontrolv1beta1.FlowSchema, err error) { - in.Kind = ptr.String("FlowSchema") - - in.APIVersion = ptr.String("flowcontrol.apiserver.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1FlowSchemaImpl) ApplyStatus(ctx context.Context, in *flowcontrolv1beta1.FlowSchemaApplyConfiguration, opts metav1.ApplyOptions) (result *apiflowcontrolv1beta1.FlowSchema, err error) { - in.Kind = ptr.String("FlowSchema") - - in.APIVersion = ptr.String("flowcontrol.apiserver.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1FlowSchemaImpl) Create(ctx context.Context, in *apiflowcontrolv1beta1.FlowSchema, opts metav1.CreateOptions) (*apiflowcontrolv1beta1.FlowSchema, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta1", - Kind: "FlowSchema", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1FlowSchemaImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapFlowcontrolV1beta1FlowSchemaImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapFlowcontrolV1beta1FlowSchemaImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiflowcontrolv1beta1.FlowSchema, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1FlowSchemaImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiflowcontrolv1beta1.FlowSchemaList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.FlowSchemaList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1FlowSchemaImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiflowcontrolv1beta1.FlowSchema, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1FlowSchemaImpl) Update(ctx context.Context, in *apiflowcontrolv1beta1.FlowSchema, opts metav1.UpdateOptions) (*apiflowcontrolv1beta1.FlowSchema, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta1", - Kind: "FlowSchema", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1FlowSchemaImpl) UpdateStatus(ctx context.Context, in *apiflowcontrolv1beta1.FlowSchema, opts metav1.UpdateOptions) (*apiflowcontrolv1beta1.FlowSchema, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta1", - Kind: "FlowSchema", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1FlowSchemaImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapFlowcontrolV1beta1) PriorityLevelConfigurations() typedflowcontrolv1beta1.PriorityLevelConfigurationInterface { - return &wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta1", - Resource: "prioritylevelconfigurations", - }), - } -} - -type wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedflowcontrolv1beta1.PriorityLevelConfigurationInterface = (*wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl)(nil) - -func (w *wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl) Apply(ctx context.Context, in *flowcontrolv1beta1.PriorityLevelConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *apiflowcontrolv1beta1.PriorityLevelConfiguration, err error) { - in.Kind = ptr.String("PriorityLevelConfiguration") - - in.APIVersion = ptr.String("flowcontrol.apiserver.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl) ApplyStatus(ctx context.Context, in *flowcontrolv1beta1.PriorityLevelConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *apiflowcontrolv1beta1.PriorityLevelConfiguration, err error) { - in.Kind = ptr.String("PriorityLevelConfiguration") - - in.APIVersion = ptr.String("flowcontrol.apiserver.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl) Create(ctx context.Context, in *apiflowcontrolv1beta1.PriorityLevelConfiguration, opts metav1.CreateOptions) (*apiflowcontrolv1beta1.PriorityLevelConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta1", - Kind: "PriorityLevelConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiflowcontrolv1beta1.PriorityLevelConfiguration, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiflowcontrolv1beta1.PriorityLevelConfigurationList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.PriorityLevelConfigurationList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiflowcontrolv1beta1.PriorityLevelConfiguration, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl) Update(ctx context.Context, in *apiflowcontrolv1beta1.PriorityLevelConfiguration, opts metav1.UpdateOptions) (*apiflowcontrolv1beta1.PriorityLevelConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta1", - Kind: "PriorityLevelConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl) UpdateStatus(ctx context.Context, in *apiflowcontrolv1beta1.PriorityLevelConfiguration, opts metav1.UpdateOptions) (*apiflowcontrolv1beta1.PriorityLevelConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta1", - Kind: "PriorityLevelConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta1.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta1PriorityLevelConfigurationImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// FlowcontrolV1beta2 retrieves the FlowcontrolV1beta2Client -func (w *wrapClient) FlowcontrolV1beta2() typedflowcontrolv1beta2.FlowcontrolV1beta2Interface { - return &wrapFlowcontrolV1beta2{ - dyn: w.dyn, - } -} - -type wrapFlowcontrolV1beta2 struct { - dyn dynamic.Interface -} - -func (w *wrapFlowcontrolV1beta2) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapFlowcontrolV1beta2) FlowSchemas() typedflowcontrolv1beta2.FlowSchemaInterface { - return &wrapFlowcontrolV1beta2FlowSchemaImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta2", - Resource: "flowschemas", - }), - } -} - -type wrapFlowcontrolV1beta2FlowSchemaImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedflowcontrolv1beta2.FlowSchemaInterface = (*wrapFlowcontrolV1beta2FlowSchemaImpl)(nil) - -func (w *wrapFlowcontrolV1beta2FlowSchemaImpl) Apply(ctx context.Context, in *flowcontrolv1beta2.FlowSchemaApplyConfiguration, opts metav1.ApplyOptions) (result *apiflowcontrolv1beta2.FlowSchema, err error) { - in.Kind = ptr.String("FlowSchema") - - in.APIVersion = ptr.String("flowcontrol.apiserver.k8s.io/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2FlowSchemaImpl) ApplyStatus(ctx context.Context, in *flowcontrolv1beta2.FlowSchemaApplyConfiguration, opts metav1.ApplyOptions) (result *apiflowcontrolv1beta2.FlowSchema, err error) { - in.Kind = ptr.String("FlowSchema") - - in.APIVersion = ptr.String("flowcontrol.apiserver.k8s.io/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2FlowSchemaImpl) Create(ctx context.Context, in *apiflowcontrolv1beta2.FlowSchema, opts metav1.CreateOptions) (*apiflowcontrolv1beta2.FlowSchema, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta2", - Kind: "FlowSchema", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2FlowSchemaImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapFlowcontrolV1beta2FlowSchemaImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapFlowcontrolV1beta2FlowSchemaImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiflowcontrolv1beta2.FlowSchema, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2FlowSchemaImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiflowcontrolv1beta2.FlowSchemaList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.FlowSchemaList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2FlowSchemaImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiflowcontrolv1beta2.FlowSchema, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2FlowSchemaImpl) Update(ctx context.Context, in *apiflowcontrolv1beta2.FlowSchema, opts metav1.UpdateOptions) (*apiflowcontrolv1beta2.FlowSchema, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta2", - Kind: "FlowSchema", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2FlowSchemaImpl) UpdateStatus(ctx context.Context, in *apiflowcontrolv1beta2.FlowSchema, opts metav1.UpdateOptions) (*apiflowcontrolv1beta2.FlowSchema, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta2", - Kind: "FlowSchema", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.FlowSchema{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2FlowSchemaImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapFlowcontrolV1beta2) PriorityLevelConfigurations() typedflowcontrolv1beta2.PriorityLevelConfigurationInterface { - return &wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta2", - Resource: "prioritylevelconfigurations", - }), - } -} - -type wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedflowcontrolv1beta2.PriorityLevelConfigurationInterface = (*wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl)(nil) - -func (w *wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl) Apply(ctx context.Context, in *flowcontrolv1beta2.PriorityLevelConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *apiflowcontrolv1beta2.PriorityLevelConfiguration, err error) { - in.Kind = ptr.String("PriorityLevelConfiguration") - - in.APIVersion = ptr.String("flowcontrol.apiserver.k8s.io/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl) ApplyStatus(ctx context.Context, in *flowcontrolv1beta2.PriorityLevelConfigurationApplyConfiguration, opts metav1.ApplyOptions) (result *apiflowcontrolv1beta2.PriorityLevelConfiguration, err error) { - in.Kind = ptr.String("PriorityLevelConfiguration") - - in.APIVersion = ptr.String("flowcontrol.apiserver.k8s.io/v1beta2") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl) Create(ctx context.Context, in *apiflowcontrolv1beta2.PriorityLevelConfiguration, opts metav1.CreateOptions) (*apiflowcontrolv1beta2.PriorityLevelConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta2", - Kind: "PriorityLevelConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apiflowcontrolv1beta2.PriorityLevelConfiguration, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl) List(ctx context.Context, opts metav1.ListOptions) (*apiflowcontrolv1beta2.PriorityLevelConfigurationList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.PriorityLevelConfigurationList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apiflowcontrolv1beta2.PriorityLevelConfiguration, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl) Update(ctx context.Context, in *apiflowcontrolv1beta2.PriorityLevelConfiguration, opts metav1.UpdateOptions) (*apiflowcontrolv1beta2.PriorityLevelConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta2", - Kind: "PriorityLevelConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl) UpdateStatus(ctx context.Context, in *apiflowcontrolv1beta2.PriorityLevelConfiguration, opts metav1.UpdateOptions) (*apiflowcontrolv1beta2.PriorityLevelConfiguration, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "flowcontrol.apiserver.k8s.io", - Version: "v1beta2", - Kind: "PriorityLevelConfiguration", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apiflowcontrolv1beta2.PriorityLevelConfiguration{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapFlowcontrolV1beta2PriorityLevelConfigurationImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// NetworkingV1 retrieves the NetworkingV1Client -func (w *wrapClient) NetworkingV1() typednetworkingv1.NetworkingV1Interface { - return &wrapNetworkingV1{ - dyn: w.dyn, - } -} - -type wrapNetworkingV1 struct { - dyn dynamic.Interface -} - -func (w *wrapNetworkingV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapNetworkingV1) Ingresses(namespace string) typednetworkingv1.IngressInterface { - return &wrapNetworkingV1IngressImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.k8s.io", - Version: "v1", - Resource: "ingresses", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1IngressImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1.IngressInterface = (*wrapNetworkingV1IngressImpl)(nil) - -func (w *wrapNetworkingV1IngressImpl) Apply(ctx context.Context, in *networkingv1.IngressApplyConfiguration, opts metav1.ApplyOptions) (result *apinetworkingv1.Ingress, err error) { - in.Kind = ptr.String("Ingress") - - in.APIVersion = ptr.String("networking.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressImpl) ApplyStatus(ctx context.Context, in *networkingv1.IngressApplyConfiguration, opts metav1.ApplyOptions) (result *apinetworkingv1.Ingress, err error) { - in.Kind = ptr.String("Ingress") - - in.APIVersion = ptr.String("networking.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressImpl) Create(ctx context.Context, in *apinetworkingv1.Ingress, opts metav1.CreateOptions) (*apinetworkingv1.Ingress, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1", - Kind: "Ingress", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1IngressImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1IngressImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apinetworkingv1.Ingress, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressImpl) List(ctx context.Context, opts metav1.ListOptions) (*apinetworkingv1.IngressList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.IngressList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apinetworkingv1.Ingress, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressImpl) Update(ctx context.Context, in *apinetworkingv1.Ingress, opts metav1.UpdateOptions) (*apinetworkingv1.Ingress, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1", - Kind: "Ingress", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressImpl) UpdateStatus(ctx context.Context, in *apinetworkingv1.Ingress, opts metav1.UpdateOptions) (*apinetworkingv1.Ingress, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1", - Kind: "Ingress", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1) IngressClasses() typednetworkingv1.IngressClassInterface { - return &wrapNetworkingV1IngressClassImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.k8s.io", - Version: "v1", - Resource: "ingressclasses", - }), - } -} - -type wrapNetworkingV1IngressClassImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typednetworkingv1.IngressClassInterface = (*wrapNetworkingV1IngressClassImpl)(nil) - -func (w *wrapNetworkingV1IngressClassImpl) Apply(ctx context.Context, in *networkingv1.IngressClassApplyConfiguration, opts metav1.ApplyOptions) (result *apinetworkingv1.IngressClass, err error) { - in.Kind = ptr.String("IngressClass") - - in.APIVersion = ptr.String("networking.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressClassImpl) ApplyStatus(ctx context.Context, in *networkingv1.IngressClassApplyConfiguration, opts metav1.ApplyOptions) (result *apinetworkingv1.IngressClass, err error) { - in.Kind = ptr.String("IngressClass") - - in.APIVersion = ptr.String("networking.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressClassImpl) Create(ctx context.Context, in *apinetworkingv1.IngressClass, opts metav1.CreateOptions) (*apinetworkingv1.IngressClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1", - Kind: "IngressClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressClassImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1IngressClassImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1IngressClassImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apinetworkingv1.IngressClass, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressClassImpl) List(ctx context.Context, opts metav1.ListOptions) (*apinetworkingv1.IngressClassList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.IngressClassList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressClassImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apinetworkingv1.IngressClass, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressClassImpl) Update(ctx context.Context, in *apinetworkingv1.IngressClass, opts metav1.UpdateOptions) (*apinetworkingv1.IngressClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1", - Kind: "IngressClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressClassImpl) UpdateStatus(ctx context.Context, in *apinetworkingv1.IngressClass, opts metav1.UpdateOptions) (*apinetworkingv1.IngressClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1", - Kind: "IngressClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1IngressClassImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1) NetworkPolicies(namespace string) typednetworkingv1.NetworkPolicyInterface { - return &wrapNetworkingV1NetworkPolicyImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.k8s.io", - Version: "v1", - Resource: "networkpolicies", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1NetworkPolicyImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1.NetworkPolicyInterface = (*wrapNetworkingV1NetworkPolicyImpl)(nil) - -func (w *wrapNetworkingV1NetworkPolicyImpl) Apply(ctx context.Context, in *networkingv1.NetworkPolicyApplyConfiguration, opts metav1.ApplyOptions) (result *apinetworkingv1.NetworkPolicy, err error) { - in.Kind = ptr.String("NetworkPolicy") - - in.APIVersion = ptr.String("networking.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1NetworkPolicyImpl) ApplyStatus(ctx context.Context, in *networkingv1.NetworkPolicyApplyConfiguration, opts metav1.ApplyOptions) (result *apinetworkingv1.NetworkPolicy, err error) { - in.Kind = ptr.String("NetworkPolicy") - - in.APIVersion = ptr.String("networking.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1NetworkPolicyImpl) Create(ctx context.Context, in *apinetworkingv1.NetworkPolicy, opts metav1.CreateOptions) (*apinetworkingv1.NetworkPolicy, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1", - Kind: "NetworkPolicy", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1NetworkPolicyImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1NetworkPolicyImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1NetworkPolicyImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apinetworkingv1.NetworkPolicy, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1NetworkPolicyImpl) List(ctx context.Context, opts metav1.ListOptions) (*apinetworkingv1.NetworkPolicyList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.NetworkPolicyList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1NetworkPolicyImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apinetworkingv1.NetworkPolicy, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1NetworkPolicyImpl) Update(ctx context.Context, in *apinetworkingv1.NetworkPolicy, opts metav1.UpdateOptions) (*apinetworkingv1.NetworkPolicy, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1", - Kind: "NetworkPolicy", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1NetworkPolicyImpl) UpdateStatus(ctx context.Context, in *apinetworkingv1.NetworkPolicy, opts metav1.UpdateOptions) (*apinetworkingv1.NetworkPolicy, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1", - Kind: "NetworkPolicy", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1.NetworkPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1NetworkPolicyImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// NetworkingV1alpha1 retrieves the NetworkingV1alpha1Client -func (w *wrapClient) NetworkingV1alpha1() typednetworkingv1alpha1.NetworkingV1alpha1Interface { - return &wrapNetworkingV1alpha1{ - dyn: w.dyn, - } -} - -type wrapNetworkingV1alpha1 struct { - dyn dynamic.Interface -} - -func (w *wrapNetworkingV1alpha1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapNetworkingV1alpha1) ClusterCIDRs() typednetworkingv1alpha1.ClusterCIDRInterface { - return &wrapNetworkingV1alpha1ClusterCIDRImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.k8s.io", - Version: "v1alpha1", - Resource: "clustercidrs", - }), - } -} - -type wrapNetworkingV1alpha1ClusterCIDRImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typednetworkingv1alpha1.ClusterCIDRInterface = (*wrapNetworkingV1alpha1ClusterCIDRImpl)(nil) - -func (w *wrapNetworkingV1alpha1ClusterCIDRImpl) Apply(ctx context.Context, in *networkingv1alpha1.ClusterCIDRApplyConfiguration, opts metav1.ApplyOptions) (result *apinetworkingv1alpha1.ClusterCIDR, err error) { - in.Kind = ptr.String("ClusterCIDR") - - in.APIVersion = ptr.String("networking.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1alpha1.ClusterCIDR{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterCIDRImpl) ApplyStatus(ctx context.Context, in *networkingv1alpha1.ClusterCIDRApplyConfiguration, opts metav1.ApplyOptions) (result *apinetworkingv1alpha1.ClusterCIDR, err error) { - in.Kind = ptr.String("ClusterCIDR") - - in.APIVersion = ptr.String("networking.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1alpha1.ClusterCIDR{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterCIDRImpl) Create(ctx context.Context, in *apinetworkingv1alpha1.ClusterCIDR, opts metav1.CreateOptions) (*apinetworkingv1alpha1.ClusterCIDR, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1alpha1", - Kind: "ClusterCIDR", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1alpha1.ClusterCIDR{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterCIDRImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1alpha1ClusterCIDRImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1alpha1ClusterCIDRImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apinetworkingv1alpha1.ClusterCIDR, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1alpha1.ClusterCIDR{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterCIDRImpl) List(ctx context.Context, opts metav1.ListOptions) (*apinetworkingv1alpha1.ClusterCIDRList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1alpha1.ClusterCIDRList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterCIDRImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apinetworkingv1alpha1.ClusterCIDR, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1alpha1.ClusterCIDR{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterCIDRImpl) Update(ctx context.Context, in *apinetworkingv1alpha1.ClusterCIDR, opts metav1.UpdateOptions) (*apinetworkingv1alpha1.ClusterCIDR, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1alpha1", - Kind: "ClusterCIDR", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1alpha1.ClusterCIDR{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterCIDRImpl) UpdateStatus(ctx context.Context, in *apinetworkingv1alpha1.ClusterCIDR, opts metav1.UpdateOptions) (*apinetworkingv1alpha1.ClusterCIDR, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1alpha1", - Kind: "ClusterCIDR", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1alpha1.ClusterCIDR{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1alpha1ClusterCIDRImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// NetworkingV1beta1 retrieves the NetworkingV1beta1Client -func (w *wrapClient) NetworkingV1beta1() typednetworkingv1beta1.NetworkingV1beta1Interface { - return &wrapNetworkingV1beta1{ - dyn: w.dyn, - } -} - -type wrapNetworkingV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapNetworkingV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapNetworkingV1beta1) Ingresses(namespace string) typednetworkingv1beta1.IngressInterface { - return &wrapNetworkingV1beta1IngressImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.k8s.io", - Version: "v1beta1", - Resource: "ingresses", - }), - - namespace: namespace, - } -} - -type wrapNetworkingV1beta1IngressImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typednetworkingv1beta1.IngressInterface = (*wrapNetworkingV1beta1IngressImpl)(nil) - -func (w *wrapNetworkingV1beta1IngressImpl) Apply(ctx context.Context, in *networkingv1beta1.IngressApplyConfiguration, opts metav1.ApplyOptions) (result *apinetworkingv1beta1.Ingress, err error) { - in.Kind = ptr.String("Ingress") - - in.APIVersion = ptr.String("networking.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressImpl) ApplyStatus(ctx context.Context, in *networkingv1beta1.IngressApplyConfiguration, opts metav1.ApplyOptions) (result *apinetworkingv1beta1.Ingress, err error) { - in.Kind = ptr.String("Ingress") - - in.APIVersion = ptr.String("networking.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressImpl) Create(ctx context.Context, in *apinetworkingv1beta1.Ingress, opts metav1.CreateOptions) (*apinetworkingv1beta1.Ingress, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1beta1", - Kind: "Ingress", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1beta1IngressImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1beta1IngressImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apinetworkingv1beta1.Ingress, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressImpl) List(ctx context.Context, opts metav1.ListOptions) (*apinetworkingv1beta1.IngressList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.IngressList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apinetworkingv1beta1.Ingress, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressImpl) Update(ctx context.Context, in *apinetworkingv1beta1.Ingress, opts metav1.UpdateOptions) (*apinetworkingv1beta1.Ingress, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1beta1", - Kind: "Ingress", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressImpl) UpdateStatus(ctx context.Context, in *apinetworkingv1beta1.Ingress, opts metav1.UpdateOptions) (*apinetworkingv1beta1.Ingress, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1beta1", - Kind: "Ingress", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.Ingress{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapNetworkingV1beta1) IngressClasses() typednetworkingv1beta1.IngressClassInterface { - return &wrapNetworkingV1beta1IngressClassImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "networking.k8s.io", - Version: "v1beta1", - Resource: "ingressclasses", - }), - } -} - -type wrapNetworkingV1beta1IngressClassImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typednetworkingv1beta1.IngressClassInterface = (*wrapNetworkingV1beta1IngressClassImpl)(nil) - -func (w *wrapNetworkingV1beta1IngressClassImpl) Apply(ctx context.Context, in *networkingv1beta1.IngressClassApplyConfiguration, opts metav1.ApplyOptions) (result *apinetworkingv1beta1.IngressClass, err error) { - in.Kind = ptr.String("IngressClass") - - in.APIVersion = ptr.String("networking.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressClassImpl) ApplyStatus(ctx context.Context, in *networkingv1beta1.IngressClassApplyConfiguration, opts metav1.ApplyOptions) (result *apinetworkingv1beta1.IngressClass, err error) { - in.Kind = ptr.String("IngressClass") - - in.APIVersion = ptr.String("networking.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressClassImpl) Create(ctx context.Context, in *apinetworkingv1beta1.IngressClass, opts metav1.CreateOptions) (*apinetworkingv1beta1.IngressClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1beta1", - Kind: "IngressClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressClassImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapNetworkingV1beta1IngressClassImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNetworkingV1beta1IngressClassImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apinetworkingv1beta1.IngressClass, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressClassImpl) List(ctx context.Context, opts metav1.ListOptions) (*apinetworkingv1beta1.IngressClassList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.IngressClassList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressClassImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apinetworkingv1beta1.IngressClass, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressClassImpl) Update(ctx context.Context, in *apinetworkingv1beta1.IngressClass, opts metav1.UpdateOptions) (*apinetworkingv1beta1.IngressClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1beta1", - Kind: "IngressClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressClassImpl) UpdateStatus(ctx context.Context, in *apinetworkingv1beta1.IngressClass, opts metav1.UpdateOptions) (*apinetworkingv1beta1.IngressClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "networking.k8s.io", - Version: "v1beta1", - Kind: "IngressClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinetworkingv1beta1.IngressClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNetworkingV1beta1IngressClassImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// NodeV1 retrieves the NodeV1Client -func (w *wrapClient) NodeV1() typednodev1.NodeV1Interface { - return &wrapNodeV1{ - dyn: w.dyn, - } -} - -type wrapNodeV1 struct { - dyn dynamic.Interface -} - -func (w *wrapNodeV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapNodeV1) RuntimeClasses() typednodev1.RuntimeClassInterface { - return &wrapNodeV1RuntimeClassImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "node.k8s.io", - Version: "v1", - Resource: "runtimeclasses", - }), - } -} - -type wrapNodeV1RuntimeClassImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typednodev1.RuntimeClassInterface = (*wrapNodeV1RuntimeClassImpl)(nil) - -func (w *wrapNodeV1RuntimeClassImpl) Apply(ctx context.Context, in *nodev1.RuntimeClassApplyConfiguration, opts metav1.ApplyOptions) (result *apinodev1.RuntimeClass, err error) { - in.Kind = ptr.String("RuntimeClass") - - in.APIVersion = ptr.String("node.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1RuntimeClassImpl) ApplyStatus(ctx context.Context, in *nodev1.RuntimeClassApplyConfiguration, opts metav1.ApplyOptions) (result *apinodev1.RuntimeClass, err error) { - in.Kind = ptr.String("RuntimeClass") - - in.APIVersion = ptr.String("node.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1RuntimeClassImpl) Create(ctx context.Context, in *apinodev1.RuntimeClass, opts metav1.CreateOptions) (*apinodev1.RuntimeClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "node.k8s.io", - Version: "v1", - Kind: "RuntimeClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1RuntimeClassImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapNodeV1RuntimeClassImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNodeV1RuntimeClassImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apinodev1.RuntimeClass, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apinodev1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1RuntimeClassImpl) List(ctx context.Context, opts metav1.ListOptions) (*apinodev1.RuntimeClassList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apinodev1.RuntimeClassList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1RuntimeClassImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apinodev1.RuntimeClass, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apinodev1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1RuntimeClassImpl) Update(ctx context.Context, in *apinodev1.RuntimeClass, opts metav1.UpdateOptions) (*apinodev1.RuntimeClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "node.k8s.io", - Version: "v1", - Kind: "RuntimeClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1RuntimeClassImpl) UpdateStatus(ctx context.Context, in *apinodev1.RuntimeClass, opts metav1.UpdateOptions) (*apinodev1.RuntimeClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "node.k8s.io", - Version: "v1", - Kind: "RuntimeClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1RuntimeClassImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// NodeV1alpha1 retrieves the NodeV1alpha1Client -func (w *wrapClient) NodeV1alpha1() typednodev1alpha1.NodeV1alpha1Interface { - return &wrapNodeV1alpha1{ - dyn: w.dyn, - } -} - -type wrapNodeV1alpha1 struct { - dyn dynamic.Interface -} - -func (w *wrapNodeV1alpha1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapNodeV1alpha1) RuntimeClasses() typednodev1alpha1.RuntimeClassInterface { - return &wrapNodeV1alpha1RuntimeClassImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "node.k8s.io", - Version: "v1alpha1", - Resource: "runtimeclasses", - }), - } -} - -type wrapNodeV1alpha1RuntimeClassImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typednodev1alpha1.RuntimeClassInterface = (*wrapNodeV1alpha1RuntimeClassImpl)(nil) - -func (w *wrapNodeV1alpha1RuntimeClassImpl) Apply(ctx context.Context, in *nodev1alpha1.RuntimeClassApplyConfiguration, opts metav1.ApplyOptions) (result *apinodev1alpha1.RuntimeClass, err error) { - in.Kind = ptr.String("RuntimeClass") - - in.APIVersion = ptr.String("node.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1alpha1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1alpha1RuntimeClassImpl) ApplyStatus(ctx context.Context, in *nodev1alpha1.RuntimeClassApplyConfiguration, opts metav1.ApplyOptions) (result *apinodev1alpha1.RuntimeClass, err error) { - in.Kind = ptr.String("RuntimeClass") - - in.APIVersion = ptr.String("node.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1alpha1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1alpha1RuntimeClassImpl) Create(ctx context.Context, in *apinodev1alpha1.RuntimeClass, opts metav1.CreateOptions) (*apinodev1alpha1.RuntimeClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "node.k8s.io", - Version: "v1alpha1", - Kind: "RuntimeClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1alpha1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1alpha1RuntimeClassImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapNodeV1alpha1RuntimeClassImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNodeV1alpha1RuntimeClassImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apinodev1alpha1.RuntimeClass, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apinodev1alpha1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1alpha1RuntimeClassImpl) List(ctx context.Context, opts metav1.ListOptions) (*apinodev1alpha1.RuntimeClassList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apinodev1alpha1.RuntimeClassList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1alpha1RuntimeClassImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apinodev1alpha1.RuntimeClass, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apinodev1alpha1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1alpha1RuntimeClassImpl) Update(ctx context.Context, in *apinodev1alpha1.RuntimeClass, opts metav1.UpdateOptions) (*apinodev1alpha1.RuntimeClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "node.k8s.io", - Version: "v1alpha1", - Kind: "RuntimeClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1alpha1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1alpha1RuntimeClassImpl) UpdateStatus(ctx context.Context, in *apinodev1alpha1.RuntimeClass, opts metav1.UpdateOptions) (*apinodev1alpha1.RuntimeClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "node.k8s.io", - Version: "v1alpha1", - Kind: "RuntimeClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1alpha1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1alpha1RuntimeClassImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// NodeV1beta1 retrieves the NodeV1beta1Client -func (w *wrapClient) NodeV1beta1() typednodev1beta1.NodeV1beta1Interface { - return &wrapNodeV1beta1{ - dyn: w.dyn, - } -} - -type wrapNodeV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapNodeV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapNodeV1beta1) RuntimeClasses() typednodev1beta1.RuntimeClassInterface { - return &wrapNodeV1beta1RuntimeClassImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "node.k8s.io", - Version: "v1beta1", - Resource: "runtimeclasses", - }), - } -} - -type wrapNodeV1beta1RuntimeClassImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typednodev1beta1.RuntimeClassInterface = (*wrapNodeV1beta1RuntimeClassImpl)(nil) - -func (w *wrapNodeV1beta1RuntimeClassImpl) Apply(ctx context.Context, in *nodev1beta1.RuntimeClassApplyConfiguration, opts metav1.ApplyOptions) (result *apinodev1beta1.RuntimeClass, err error) { - in.Kind = ptr.String("RuntimeClass") - - in.APIVersion = ptr.String("node.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1beta1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1beta1RuntimeClassImpl) ApplyStatus(ctx context.Context, in *nodev1beta1.RuntimeClassApplyConfiguration, opts metav1.ApplyOptions) (result *apinodev1beta1.RuntimeClass, err error) { - in.Kind = ptr.String("RuntimeClass") - - in.APIVersion = ptr.String("node.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1beta1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1beta1RuntimeClassImpl) Create(ctx context.Context, in *apinodev1beta1.RuntimeClass, opts metav1.CreateOptions) (*apinodev1beta1.RuntimeClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "node.k8s.io", - Version: "v1beta1", - Kind: "RuntimeClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1beta1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1beta1RuntimeClassImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapNodeV1beta1RuntimeClassImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapNodeV1beta1RuntimeClassImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apinodev1beta1.RuntimeClass, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apinodev1beta1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1beta1RuntimeClassImpl) List(ctx context.Context, opts metav1.ListOptions) (*apinodev1beta1.RuntimeClassList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apinodev1beta1.RuntimeClassList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1beta1RuntimeClassImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apinodev1beta1.RuntimeClass, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apinodev1beta1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1beta1RuntimeClassImpl) Update(ctx context.Context, in *apinodev1beta1.RuntimeClass, opts metav1.UpdateOptions) (*apinodev1beta1.RuntimeClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "node.k8s.io", - Version: "v1beta1", - Kind: "RuntimeClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1beta1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1beta1RuntimeClassImpl) UpdateStatus(ctx context.Context, in *apinodev1beta1.RuntimeClass, opts metav1.UpdateOptions) (*apinodev1beta1.RuntimeClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "node.k8s.io", - Version: "v1beta1", - Kind: "RuntimeClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apinodev1beta1.RuntimeClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapNodeV1beta1RuntimeClassImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// PolicyV1 retrieves the PolicyV1Client -func (w *wrapClient) PolicyV1() typedpolicyv1.PolicyV1Interface { - return &wrapPolicyV1{ - dyn: w.dyn, - } -} - -type wrapPolicyV1 struct { - dyn dynamic.Interface -} - -func (w *wrapPolicyV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapPolicyV1) Evictions(namespace string) typedpolicyv1.EvictionInterface { - return &wrapPolicyV1EvictionImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "policy", - Version: "v1", - Resource: "evictions", - }), - - namespace: namespace, - } -} - -type wrapPolicyV1EvictionImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedpolicyv1.EvictionInterface = (*wrapPolicyV1EvictionImpl)(nil) - -func (w *wrapPolicyV1) PodDisruptionBudgets(namespace string) typedpolicyv1.PodDisruptionBudgetInterface { - return &wrapPolicyV1PodDisruptionBudgetImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "policy", - Version: "v1", - Resource: "poddisruptionbudgets", - }), - - namespace: namespace, - } -} - -type wrapPolicyV1PodDisruptionBudgetImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedpolicyv1.PodDisruptionBudgetInterface = (*wrapPolicyV1PodDisruptionBudgetImpl)(nil) - -func (w *wrapPolicyV1PodDisruptionBudgetImpl) Apply(ctx context.Context, in *policyv1.PodDisruptionBudgetApplyConfiguration, opts metav1.ApplyOptions) (result *apipolicyv1.PodDisruptionBudget, err error) { - in.Kind = ptr.String("PodDisruptionBudget") - - in.APIVersion = ptr.String("policy/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1PodDisruptionBudgetImpl) ApplyStatus(ctx context.Context, in *policyv1.PodDisruptionBudgetApplyConfiguration, opts metav1.ApplyOptions) (result *apipolicyv1.PodDisruptionBudget, err error) { - in.Kind = ptr.String("PodDisruptionBudget") - - in.APIVersion = ptr.String("policy/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1PodDisruptionBudgetImpl) Create(ctx context.Context, in *apipolicyv1.PodDisruptionBudget, opts metav1.CreateOptions) (*apipolicyv1.PodDisruptionBudget, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "policy", - Version: "v1", - Kind: "PodDisruptionBudget", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1PodDisruptionBudgetImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapPolicyV1PodDisruptionBudgetImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapPolicyV1PodDisruptionBudgetImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apipolicyv1.PodDisruptionBudget, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1PodDisruptionBudgetImpl) List(ctx context.Context, opts metav1.ListOptions) (*apipolicyv1.PodDisruptionBudgetList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1.PodDisruptionBudgetList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1PodDisruptionBudgetImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apipolicyv1.PodDisruptionBudget, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1PodDisruptionBudgetImpl) Update(ctx context.Context, in *apipolicyv1.PodDisruptionBudget, opts metav1.UpdateOptions) (*apipolicyv1.PodDisruptionBudget, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "policy", - Version: "v1", - Kind: "PodDisruptionBudget", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1PodDisruptionBudgetImpl) UpdateStatus(ctx context.Context, in *apipolicyv1.PodDisruptionBudget, opts metav1.UpdateOptions) (*apipolicyv1.PodDisruptionBudget, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "policy", - Version: "v1", - Kind: "PodDisruptionBudget", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1PodDisruptionBudgetImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// PolicyV1beta1 retrieves the PolicyV1beta1Client -func (w *wrapClient) PolicyV1beta1() typedpolicyv1beta1.PolicyV1beta1Interface { - return &wrapPolicyV1beta1{ - dyn: w.dyn, - } -} - -type wrapPolicyV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapPolicyV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapPolicyV1beta1) Evictions(namespace string) typedpolicyv1beta1.EvictionInterface { - return &wrapPolicyV1beta1EvictionImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "policy", - Version: "v1beta1", - Resource: "evictions", - }), - - namespace: namespace, - } -} - -type wrapPolicyV1beta1EvictionImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedpolicyv1beta1.EvictionInterface = (*wrapPolicyV1beta1EvictionImpl)(nil) - -func (w *wrapPolicyV1beta1) PodDisruptionBudgets(namespace string) typedpolicyv1beta1.PodDisruptionBudgetInterface { - return &wrapPolicyV1beta1PodDisruptionBudgetImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "policy", - Version: "v1beta1", - Resource: "poddisruptionbudgets", - }), - - namespace: namespace, - } -} - -type wrapPolicyV1beta1PodDisruptionBudgetImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedpolicyv1beta1.PodDisruptionBudgetInterface = (*wrapPolicyV1beta1PodDisruptionBudgetImpl)(nil) - -func (w *wrapPolicyV1beta1PodDisruptionBudgetImpl) Apply(ctx context.Context, in *policyv1beta1.PodDisruptionBudgetApplyConfiguration, opts metav1.ApplyOptions) (result *apipolicyv1beta1.PodDisruptionBudget, err error) { - in.Kind = ptr.String("PodDisruptionBudget") - - in.APIVersion = ptr.String("policy/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodDisruptionBudgetImpl) ApplyStatus(ctx context.Context, in *policyv1beta1.PodDisruptionBudgetApplyConfiguration, opts metav1.ApplyOptions) (result *apipolicyv1beta1.PodDisruptionBudget, err error) { - in.Kind = ptr.String("PodDisruptionBudget") - - in.APIVersion = ptr.String("policy/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodDisruptionBudgetImpl) Create(ctx context.Context, in *apipolicyv1beta1.PodDisruptionBudget, opts metav1.CreateOptions) (*apipolicyv1beta1.PodDisruptionBudget, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "policy", - Version: "v1beta1", - Kind: "PodDisruptionBudget", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodDisruptionBudgetImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapPolicyV1beta1PodDisruptionBudgetImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapPolicyV1beta1PodDisruptionBudgetImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apipolicyv1beta1.PodDisruptionBudget, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodDisruptionBudgetImpl) List(ctx context.Context, opts metav1.ListOptions) (*apipolicyv1beta1.PodDisruptionBudgetList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodDisruptionBudgetList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodDisruptionBudgetImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apipolicyv1beta1.PodDisruptionBudget, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodDisruptionBudgetImpl) Update(ctx context.Context, in *apipolicyv1beta1.PodDisruptionBudget, opts metav1.UpdateOptions) (*apipolicyv1beta1.PodDisruptionBudget, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "policy", - Version: "v1beta1", - Kind: "PodDisruptionBudget", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodDisruptionBudgetImpl) UpdateStatus(ctx context.Context, in *apipolicyv1beta1.PodDisruptionBudget, opts metav1.UpdateOptions) (*apipolicyv1beta1.PodDisruptionBudget, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "policy", - Version: "v1beta1", - Kind: "PodDisruptionBudget", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodDisruptionBudget{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodDisruptionBudgetImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapPolicyV1beta1) PodSecurityPolicies() typedpolicyv1beta1.PodSecurityPolicyInterface { - return &wrapPolicyV1beta1PodSecurityPolicyImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "policy", - Version: "v1beta1", - Resource: "podsecuritypolicies", - }), - } -} - -type wrapPolicyV1beta1PodSecurityPolicyImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedpolicyv1beta1.PodSecurityPolicyInterface = (*wrapPolicyV1beta1PodSecurityPolicyImpl)(nil) - -func (w *wrapPolicyV1beta1PodSecurityPolicyImpl) Apply(ctx context.Context, in *policyv1beta1.PodSecurityPolicyApplyConfiguration, opts metav1.ApplyOptions) (result *apipolicyv1beta1.PodSecurityPolicy, err error) { - in.Kind = ptr.String("PodSecurityPolicy") - - in.APIVersion = ptr.String("policy/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodSecurityPolicyImpl) ApplyStatus(ctx context.Context, in *policyv1beta1.PodSecurityPolicyApplyConfiguration, opts metav1.ApplyOptions) (result *apipolicyv1beta1.PodSecurityPolicy, err error) { - in.Kind = ptr.String("PodSecurityPolicy") - - in.APIVersion = ptr.String("policy/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodSecurityPolicyImpl) Create(ctx context.Context, in *apipolicyv1beta1.PodSecurityPolicy, opts metav1.CreateOptions) (*apipolicyv1beta1.PodSecurityPolicy, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "policy", - Version: "v1beta1", - Kind: "PodSecurityPolicy", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodSecurityPolicyImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapPolicyV1beta1PodSecurityPolicyImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapPolicyV1beta1PodSecurityPolicyImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apipolicyv1beta1.PodSecurityPolicy, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodSecurityPolicyImpl) List(ctx context.Context, opts metav1.ListOptions) (*apipolicyv1beta1.PodSecurityPolicyList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodSecurityPolicyList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodSecurityPolicyImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apipolicyv1beta1.PodSecurityPolicy, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodSecurityPolicyImpl) Update(ctx context.Context, in *apipolicyv1beta1.PodSecurityPolicy, opts metav1.UpdateOptions) (*apipolicyv1beta1.PodSecurityPolicy, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "policy", - Version: "v1beta1", - Kind: "PodSecurityPolicy", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodSecurityPolicyImpl) UpdateStatus(ctx context.Context, in *apipolicyv1beta1.PodSecurityPolicy, opts metav1.UpdateOptions) (*apipolicyv1beta1.PodSecurityPolicy, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "policy", - Version: "v1beta1", - Kind: "PodSecurityPolicy", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apipolicyv1beta1.PodSecurityPolicy{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapPolicyV1beta1PodSecurityPolicyImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// RbacV1 retrieves the RbacV1Client -func (w *wrapClient) RbacV1() typedrbacv1.RbacV1Interface { - return &wrapRbacV1{ - dyn: w.dyn, - } -} - -type wrapRbacV1 struct { - dyn dynamic.Interface -} - -func (w *wrapRbacV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapRbacV1) ClusterRoles() typedrbacv1.ClusterRoleInterface { - return &wrapRbacV1ClusterRoleImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Resource: "clusterroles", - }), - } -} - -type wrapRbacV1ClusterRoleImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedrbacv1.ClusterRoleInterface = (*wrapRbacV1ClusterRoleImpl)(nil) - -func (w *wrapRbacV1ClusterRoleImpl) Apply(ctx context.Context, in *rbacv1.ClusterRoleApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1.ClusterRole, err error) { - in.Kind = ptr.String("ClusterRole") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleImpl) ApplyStatus(ctx context.Context, in *rbacv1.ClusterRoleApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1.ClusterRole, err error) { - in.Kind = ptr.String("ClusterRole") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleImpl) Create(ctx context.Context, in *apirbacv1.ClusterRole, opts metav1.CreateOptions) (*apirbacv1.ClusterRole, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Kind: "ClusterRole", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapRbacV1ClusterRoleImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapRbacV1ClusterRoleImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apirbacv1.ClusterRole, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleImpl) List(ctx context.Context, opts metav1.ListOptions) (*apirbacv1.ClusterRoleList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRoleList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apirbacv1.ClusterRole, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleImpl) Update(ctx context.Context, in *apirbacv1.ClusterRole, opts metav1.UpdateOptions) (*apirbacv1.ClusterRole, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Kind: "ClusterRole", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleImpl) UpdateStatus(ctx context.Context, in *apirbacv1.ClusterRole, opts metav1.UpdateOptions) (*apirbacv1.ClusterRole, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Kind: "ClusterRole", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapRbacV1) ClusterRoleBindings() typedrbacv1.ClusterRoleBindingInterface { - return &wrapRbacV1ClusterRoleBindingImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Resource: "clusterrolebindings", - }), - } -} - -type wrapRbacV1ClusterRoleBindingImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedrbacv1.ClusterRoleBindingInterface = (*wrapRbacV1ClusterRoleBindingImpl)(nil) - -func (w *wrapRbacV1ClusterRoleBindingImpl) Apply(ctx context.Context, in *rbacv1.ClusterRoleBindingApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1.ClusterRoleBinding, err error) { - in.Kind = ptr.String("ClusterRoleBinding") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleBindingImpl) ApplyStatus(ctx context.Context, in *rbacv1.ClusterRoleBindingApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1.ClusterRoleBinding, err error) { - in.Kind = ptr.String("ClusterRoleBinding") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleBindingImpl) Create(ctx context.Context, in *apirbacv1.ClusterRoleBinding, opts metav1.CreateOptions) (*apirbacv1.ClusterRoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Kind: "ClusterRoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleBindingImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapRbacV1ClusterRoleBindingImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapRbacV1ClusterRoleBindingImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apirbacv1.ClusterRoleBinding, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleBindingImpl) List(ctx context.Context, opts metav1.ListOptions) (*apirbacv1.ClusterRoleBindingList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRoleBindingList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleBindingImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apirbacv1.ClusterRoleBinding, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleBindingImpl) Update(ctx context.Context, in *apirbacv1.ClusterRoleBinding, opts metav1.UpdateOptions) (*apirbacv1.ClusterRoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Kind: "ClusterRoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleBindingImpl) UpdateStatus(ctx context.Context, in *apirbacv1.ClusterRoleBinding, opts metav1.UpdateOptions) (*apirbacv1.ClusterRoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Kind: "ClusterRoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1ClusterRoleBindingImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapRbacV1) Roles(namespace string) typedrbacv1.RoleInterface { - return &wrapRbacV1RoleImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Resource: "roles", - }), - - namespace: namespace, - } -} - -type wrapRbacV1RoleImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedrbacv1.RoleInterface = (*wrapRbacV1RoleImpl)(nil) - -func (w *wrapRbacV1RoleImpl) Apply(ctx context.Context, in *rbacv1.RoleApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1.Role, err error) { - in.Kind = ptr.String("Role") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleImpl) ApplyStatus(ctx context.Context, in *rbacv1.RoleApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1.Role, err error) { - in.Kind = ptr.String("Role") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleImpl) Create(ctx context.Context, in *apirbacv1.Role, opts metav1.CreateOptions) (*apirbacv1.Role, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Kind: "Role", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapRbacV1RoleImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapRbacV1RoleImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apirbacv1.Role, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleImpl) List(ctx context.Context, opts metav1.ListOptions) (*apirbacv1.RoleList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.RoleList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apirbacv1.Role, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleImpl) Update(ctx context.Context, in *apirbacv1.Role, opts metav1.UpdateOptions) (*apirbacv1.Role, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Kind: "Role", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleImpl) UpdateStatus(ctx context.Context, in *apirbacv1.Role, opts metav1.UpdateOptions) (*apirbacv1.Role, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Kind: "Role", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapRbacV1) RoleBindings(namespace string) typedrbacv1.RoleBindingInterface { - return &wrapRbacV1RoleBindingImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Resource: "rolebindings", - }), - - namespace: namespace, - } -} - -type wrapRbacV1RoleBindingImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedrbacv1.RoleBindingInterface = (*wrapRbacV1RoleBindingImpl)(nil) - -func (w *wrapRbacV1RoleBindingImpl) Apply(ctx context.Context, in *rbacv1.RoleBindingApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1.RoleBinding, err error) { - in.Kind = ptr.String("RoleBinding") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleBindingImpl) ApplyStatus(ctx context.Context, in *rbacv1.RoleBindingApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1.RoleBinding, err error) { - in.Kind = ptr.String("RoleBinding") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleBindingImpl) Create(ctx context.Context, in *apirbacv1.RoleBinding, opts metav1.CreateOptions) (*apirbacv1.RoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Kind: "RoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleBindingImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapRbacV1RoleBindingImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapRbacV1RoleBindingImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apirbacv1.RoleBinding, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleBindingImpl) List(ctx context.Context, opts metav1.ListOptions) (*apirbacv1.RoleBindingList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.RoleBindingList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleBindingImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apirbacv1.RoleBinding, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleBindingImpl) Update(ctx context.Context, in *apirbacv1.RoleBinding, opts metav1.UpdateOptions) (*apirbacv1.RoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Kind: "RoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleBindingImpl) UpdateStatus(ctx context.Context, in *apirbacv1.RoleBinding, opts metav1.UpdateOptions) (*apirbacv1.RoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1", - Kind: "RoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1RoleBindingImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// RbacV1alpha1 retrieves the RbacV1alpha1Client -func (w *wrapClient) RbacV1alpha1() typedrbacv1alpha1.RbacV1alpha1Interface { - return &wrapRbacV1alpha1{ - dyn: w.dyn, - } -} - -type wrapRbacV1alpha1 struct { - dyn dynamic.Interface -} - -func (w *wrapRbacV1alpha1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapRbacV1alpha1) ClusterRoles() typedrbacv1alpha1.ClusterRoleInterface { - return &wrapRbacV1alpha1ClusterRoleImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Resource: "clusterroles", - }), - } -} - -type wrapRbacV1alpha1ClusterRoleImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedrbacv1alpha1.ClusterRoleInterface = (*wrapRbacV1alpha1ClusterRoleImpl)(nil) - -func (w *wrapRbacV1alpha1ClusterRoleImpl) Apply(ctx context.Context, in *rbacv1alpha1.ClusterRoleApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1alpha1.ClusterRole, err error) { - in.Kind = ptr.String("ClusterRole") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleImpl) ApplyStatus(ctx context.Context, in *rbacv1alpha1.ClusterRoleApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1alpha1.ClusterRole, err error) { - in.Kind = ptr.String("ClusterRole") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleImpl) Create(ctx context.Context, in *apirbacv1alpha1.ClusterRole, opts metav1.CreateOptions) (*apirbacv1alpha1.ClusterRole, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Kind: "ClusterRole", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapRbacV1alpha1ClusterRoleImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapRbacV1alpha1ClusterRoleImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apirbacv1alpha1.ClusterRole, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleImpl) List(ctx context.Context, opts metav1.ListOptions) (*apirbacv1alpha1.ClusterRoleList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRoleList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apirbacv1alpha1.ClusterRole, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleImpl) Update(ctx context.Context, in *apirbacv1alpha1.ClusterRole, opts metav1.UpdateOptions) (*apirbacv1alpha1.ClusterRole, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Kind: "ClusterRole", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleImpl) UpdateStatus(ctx context.Context, in *apirbacv1alpha1.ClusterRole, opts metav1.UpdateOptions) (*apirbacv1alpha1.ClusterRole, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Kind: "ClusterRole", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapRbacV1alpha1) ClusterRoleBindings() typedrbacv1alpha1.ClusterRoleBindingInterface { - return &wrapRbacV1alpha1ClusterRoleBindingImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Resource: "clusterrolebindings", - }), - } -} - -type wrapRbacV1alpha1ClusterRoleBindingImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedrbacv1alpha1.ClusterRoleBindingInterface = (*wrapRbacV1alpha1ClusterRoleBindingImpl)(nil) - -func (w *wrapRbacV1alpha1ClusterRoleBindingImpl) Apply(ctx context.Context, in *rbacv1alpha1.ClusterRoleBindingApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1alpha1.ClusterRoleBinding, err error) { - in.Kind = ptr.String("ClusterRoleBinding") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleBindingImpl) ApplyStatus(ctx context.Context, in *rbacv1alpha1.ClusterRoleBindingApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1alpha1.ClusterRoleBinding, err error) { - in.Kind = ptr.String("ClusterRoleBinding") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleBindingImpl) Create(ctx context.Context, in *apirbacv1alpha1.ClusterRoleBinding, opts metav1.CreateOptions) (*apirbacv1alpha1.ClusterRoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Kind: "ClusterRoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleBindingImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapRbacV1alpha1ClusterRoleBindingImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapRbacV1alpha1ClusterRoleBindingImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apirbacv1alpha1.ClusterRoleBinding, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleBindingImpl) List(ctx context.Context, opts metav1.ListOptions) (*apirbacv1alpha1.ClusterRoleBindingList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRoleBindingList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleBindingImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apirbacv1alpha1.ClusterRoleBinding, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleBindingImpl) Update(ctx context.Context, in *apirbacv1alpha1.ClusterRoleBinding, opts metav1.UpdateOptions) (*apirbacv1alpha1.ClusterRoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Kind: "ClusterRoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleBindingImpl) UpdateStatus(ctx context.Context, in *apirbacv1alpha1.ClusterRoleBinding, opts metav1.UpdateOptions) (*apirbacv1alpha1.ClusterRoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Kind: "ClusterRoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1ClusterRoleBindingImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapRbacV1alpha1) Roles(namespace string) typedrbacv1alpha1.RoleInterface { - return &wrapRbacV1alpha1RoleImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Resource: "roles", - }), - - namespace: namespace, - } -} - -type wrapRbacV1alpha1RoleImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedrbacv1alpha1.RoleInterface = (*wrapRbacV1alpha1RoleImpl)(nil) - -func (w *wrapRbacV1alpha1RoleImpl) Apply(ctx context.Context, in *rbacv1alpha1.RoleApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1alpha1.Role, err error) { - in.Kind = ptr.String("Role") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleImpl) ApplyStatus(ctx context.Context, in *rbacv1alpha1.RoleApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1alpha1.Role, err error) { - in.Kind = ptr.String("Role") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleImpl) Create(ctx context.Context, in *apirbacv1alpha1.Role, opts metav1.CreateOptions) (*apirbacv1alpha1.Role, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Kind: "Role", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapRbacV1alpha1RoleImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapRbacV1alpha1RoleImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apirbacv1alpha1.Role, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleImpl) List(ctx context.Context, opts metav1.ListOptions) (*apirbacv1alpha1.RoleList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.RoleList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apirbacv1alpha1.Role, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleImpl) Update(ctx context.Context, in *apirbacv1alpha1.Role, opts metav1.UpdateOptions) (*apirbacv1alpha1.Role, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Kind: "Role", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleImpl) UpdateStatus(ctx context.Context, in *apirbacv1alpha1.Role, opts metav1.UpdateOptions) (*apirbacv1alpha1.Role, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Kind: "Role", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapRbacV1alpha1) RoleBindings(namespace string) typedrbacv1alpha1.RoleBindingInterface { - return &wrapRbacV1alpha1RoleBindingImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Resource: "rolebindings", - }), - - namespace: namespace, - } -} - -type wrapRbacV1alpha1RoleBindingImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedrbacv1alpha1.RoleBindingInterface = (*wrapRbacV1alpha1RoleBindingImpl)(nil) - -func (w *wrapRbacV1alpha1RoleBindingImpl) Apply(ctx context.Context, in *rbacv1alpha1.RoleBindingApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1alpha1.RoleBinding, err error) { - in.Kind = ptr.String("RoleBinding") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleBindingImpl) ApplyStatus(ctx context.Context, in *rbacv1alpha1.RoleBindingApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1alpha1.RoleBinding, err error) { - in.Kind = ptr.String("RoleBinding") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleBindingImpl) Create(ctx context.Context, in *apirbacv1alpha1.RoleBinding, opts metav1.CreateOptions) (*apirbacv1alpha1.RoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Kind: "RoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleBindingImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapRbacV1alpha1RoleBindingImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapRbacV1alpha1RoleBindingImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apirbacv1alpha1.RoleBinding, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleBindingImpl) List(ctx context.Context, opts metav1.ListOptions) (*apirbacv1alpha1.RoleBindingList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.RoleBindingList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleBindingImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apirbacv1alpha1.RoleBinding, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleBindingImpl) Update(ctx context.Context, in *apirbacv1alpha1.RoleBinding, opts metav1.UpdateOptions) (*apirbacv1alpha1.RoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Kind: "RoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleBindingImpl) UpdateStatus(ctx context.Context, in *apirbacv1alpha1.RoleBinding, opts metav1.UpdateOptions) (*apirbacv1alpha1.RoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1alpha1", - Kind: "RoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1alpha1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1alpha1RoleBindingImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// RbacV1beta1 retrieves the RbacV1beta1Client -func (w *wrapClient) RbacV1beta1() typedrbacv1beta1.RbacV1beta1Interface { - return &wrapRbacV1beta1{ - dyn: w.dyn, - } -} - -type wrapRbacV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapRbacV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapRbacV1beta1) ClusterRoles() typedrbacv1beta1.ClusterRoleInterface { - return &wrapRbacV1beta1ClusterRoleImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Resource: "clusterroles", - }), - } -} - -type wrapRbacV1beta1ClusterRoleImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedrbacv1beta1.ClusterRoleInterface = (*wrapRbacV1beta1ClusterRoleImpl)(nil) - -func (w *wrapRbacV1beta1ClusterRoleImpl) Apply(ctx context.Context, in *rbacv1beta1.ClusterRoleApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1beta1.ClusterRole, err error) { - in.Kind = ptr.String("ClusterRole") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleImpl) ApplyStatus(ctx context.Context, in *rbacv1beta1.ClusterRoleApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1beta1.ClusterRole, err error) { - in.Kind = ptr.String("ClusterRole") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleImpl) Create(ctx context.Context, in *apirbacv1beta1.ClusterRole, opts metav1.CreateOptions) (*apirbacv1beta1.ClusterRole, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Kind: "ClusterRole", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapRbacV1beta1ClusterRoleImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapRbacV1beta1ClusterRoleImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apirbacv1beta1.ClusterRole, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleImpl) List(ctx context.Context, opts metav1.ListOptions) (*apirbacv1beta1.ClusterRoleList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRoleList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apirbacv1beta1.ClusterRole, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleImpl) Update(ctx context.Context, in *apirbacv1beta1.ClusterRole, opts metav1.UpdateOptions) (*apirbacv1beta1.ClusterRole, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Kind: "ClusterRole", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleImpl) UpdateStatus(ctx context.Context, in *apirbacv1beta1.ClusterRole, opts metav1.UpdateOptions) (*apirbacv1beta1.ClusterRole, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Kind: "ClusterRole", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRole{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapRbacV1beta1) ClusterRoleBindings() typedrbacv1beta1.ClusterRoleBindingInterface { - return &wrapRbacV1beta1ClusterRoleBindingImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Resource: "clusterrolebindings", - }), - } -} - -type wrapRbacV1beta1ClusterRoleBindingImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedrbacv1beta1.ClusterRoleBindingInterface = (*wrapRbacV1beta1ClusterRoleBindingImpl)(nil) - -func (w *wrapRbacV1beta1ClusterRoleBindingImpl) Apply(ctx context.Context, in *rbacv1beta1.ClusterRoleBindingApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1beta1.ClusterRoleBinding, err error) { - in.Kind = ptr.String("ClusterRoleBinding") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleBindingImpl) ApplyStatus(ctx context.Context, in *rbacv1beta1.ClusterRoleBindingApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1beta1.ClusterRoleBinding, err error) { - in.Kind = ptr.String("ClusterRoleBinding") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleBindingImpl) Create(ctx context.Context, in *apirbacv1beta1.ClusterRoleBinding, opts metav1.CreateOptions) (*apirbacv1beta1.ClusterRoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Kind: "ClusterRoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleBindingImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapRbacV1beta1ClusterRoleBindingImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapRbacV1beta1ClusterRoleBindingImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apirbacv1beta1.ClusterRoleBinding, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleBindingImpl) List(ctx context.Context, opts metav1.ListOptions) (*apirbacv1beta1.ClusterRoleBindingList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRoleBindingList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleBindingImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apirbacv1beta1.ClusterRoleBinding, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleBindingImpl) Update(ctx context.Context, in *apirbacv1beta1.ClusterRoleBinding, opts metav1.UpdateOptions) (*apirbacv1beta1.ClusterRoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Kind: "ClusterRoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleBindingImpl) UpdateStatus(ctx context.Context, in *apirbacv1beta1.ClusterRoleBinding, opts metav1.UpdateOptions) (*apirbacv1beta1.ClusterRoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Kind: "ClusterRoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.ClusterRoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1ClusterRoleBindingImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapRbacV1beta1) Roles(namespace string) typedrbacv1beta1.RoleInterface { - return &wrapRbacV1beta1RoleImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Resource: "roles", - }), - - namespace: namespace, - } -} - -type wrapRbacV1beta1RoleImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedrbacv1beta1.RoleInterface = (*wrapRbacV1beta1RoleImpl)(nil) - -func (w *wrapRbacV1beta1RoleImpl) Apply(ctx context.Context, in *rbacv1beta1.RoleApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1beta1.Role, err error) { - in.Kind = ptr.String("Role") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleImpl) ApplyStatus(ctx context.Context, in *rbacv1beta1.RoleApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1beta1.Role, err error) { - in.Kind = ptr.String("Role") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleImpl) Create(ctx context.Context, in *apirbacv1beta1.Role, opts metav1.CreateOptions) (*apirbacv1beta1.Role, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Kind: "Role", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapRbacV1beta1RoleImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapRbacV1beta1RoleImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apirbacv1beta1.Role, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleImpl) List(ctx context.Context, opts metav1.ListOptions) (*apirbacv1beta1.RoleList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.RoleList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apirbacv1beta1.Role, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleImpl) Update(ctx context.Context, in *apirbacv1beta1.Role, opts metav1.UpdateOptions) (*apirbacv1beta1.Role, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Kind: "Role", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleImpl) UpdateStatus(ctx context.Context, in *apirbacv1beta1.Role, opts metav1.UpdateOptions) (*apirbacv1beta1.Role, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Kind: "Role", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.Role{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapRbacV1beta1) RoleBindings(namespace string) typedrbacv1beta1.RoleBindingInterface { - return &wrapRbacV1beta1RoleBindingImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Resource: "rolebindings", - }), - - namespace: namespace, - } -} - -type wrapRbacV1beta1RoleBindingImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedrbacv1beta1.RoleBindingInterface = (*wrapRbacV1beta1RoleBindingImpl)(nil) - -func (w *wrapRbacV1beta1RoleBindingImpl) Apply(ctx context.Context, in *rbacv1beta1.RoleBindingApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1beta1.RoleBinding, err error) { - in.Kind = ptr.String("RoleBinding") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleBindingImpl) ApplyStatus(ctx context.Context, in *rbacv1beta1.RoleBindingApplyConfiguration, opts metav1.ApplyOptions) (result *apirbacv1beta1.RoleBinding, err error) { - in.Kind = ptr.String("RoleBinding") - - in.APIVersion = ptr.String("rbac.authorization.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleBindingImpl) Create(ctx context.Context, in *apirbacv1beta1.RoleBinding, opts metav1.CreateOptions) (*apirbacv1beta1.RoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Kind: "RoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleBindingImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapRbacV1beta1RoleBindingImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapRbacV1beta1RoleBindingImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apirbacv1beta1.RoleBinding, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleBindingImpl) List(ctx context.Context, opts metav1.ListOptions) (*apirbacv1beta1.RoleBindingList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.RoleBindingList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleBindingImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apirbacv1beta1.RoleBinding, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleBindingImpl) Update(ctx context.Context, in *apirbacv1beta1.RoleBinding, opts metav1.UpdateOptions) (*apirbacv1beta1.RoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Kind: "RoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleBindingImpl) UpdateStatus(ctx context.Context, in *apirbacv1beta1.RoleBinding, opts metav1.UpdateOptions) (*apirbacv1beta1.RoleBinding, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "rbac.authorization.k8s.io", - Version: "v1beta1", - Kind: "RoleBinding", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apirbacv1beta1.RoleBinding{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapRbacV1beta1RoleBindingImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// SchedulingV1 retrieves the SchedulingV1Client -func (w *wrapClient) SchedulingV1() typedschedulingv1.SchedulingV1Interface { - return &wrapSchedulingV1{ - dyn: w.dyn, - } -} - -type wrapSchedulingV1 struct { - dyn dynamic.Interface -} - -func (w *wrapSchedulingV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapSchedulingV1) PriorityClasses() typedschedulingv1.PriorityClassInterface { - return &wrapSchedulingV1PriorityClassImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "scheduling.k8s.io", - Version: "v1", - Resource: "priorityclasses", - }), - } -} - -type wrapSchedulingV1PriorityClassImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedschedulingv1.PriorityClassInterface = (*wrapSchedulingV1PriorityClassImpl)(nil) - -func (w *wrapSchedulingV1PriorityClassImpl) Apply(ctx context.Context, in *schedulingv1.PriorityClassApplyConfiguration, opts metav1.ApplyOptions) (result *apischedulingv1.PriorityClass, err error) { - in.Kind = ptr.String("PriorityClass") - - in.APIVersion = ptr.String("scheduling.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1PriorityClassImpl) ApplyStatus(ctx context.Context, in *schedulingv1.PriorityClassApplyConfiguration, opts metav1.ApplyOptions) (result *apischedulingv1.PriorityClass, err error) { - in.Kind = ptr.String("PriorityClass") - - in.APIVersion = ptr.String("scheduling.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1PriorityClassImpl) Create(ctx context.Context, in *apischedulingv1.PriorityClass, opts metav1.CreateOptions) (*apischedulingv1.PriorityClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "scheduling.k8s.io", - Version: "v1", - Kind: "PriorityClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1PriorityClassImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapSchedulingV1PriorityClassImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapSchedulingV1PriorityClassImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apischedulingv1.PriorityClass, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1PriorityClassImpl) List(ctx context.Context, opts metav1.ListOptions) (*apischedulingv1.PriorityClassList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1.PriorityClassList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1PriorityClassImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apischedulingv1.PriorityClass, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1PriorityClassImpl) Update(ctx context.Context, in *apischedulingv1.PriorityClass, opts metav1.UpdateOptions) (*apischedulingv1.PriorityClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "scheduling.k8s.io", - Version: "v1", - Kind: "PriorityClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1PriorityClassImpl) UpdateStatus(ctx context.Context, in *apischedulingv1.PriorityClass, opts metav1.UpdateOptions) (*apischedulingv1.PriorityClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "scheduling.k8s.io", - Version: "v1", - Kind: "PriorityClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1PriorityClassImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// SchedulingV1alpha1 retrieves the SchedulingV1alpha1Client -func (w *wrapClient) SchedulingV1alpha1() typedschedulingv1alpha1.SchedulingV1alpha1Interface { - return &wrapSchedulingV1alpha1{ - dyn: w.dyn, - } -} - -type wrapSchedulingV1alpha1 struct { - dyn dynamic.Interface -} - -func (w *wrapSchedulingV1alpha1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapSchedulingV1alpha1) PriorityClasses() typedschedulingv1alpha1.PriorityClassInterface { - return &wrapSchedulingV1alpha1PriorityClassImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "scheduling.k8s.io", - Version: "v1alpha1", - Resource: "priorityclasses", - }), - } -} - -type wrapSchedulingV1alpha1PriorityClassImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedschedulingv1alpha1.PriorityClassInterface = (*wrapSchedulingV1alpha1PriorityClassImpl)(nil) - -func (w *wrapSchedulingV1alpha1PriorityClassImpl) Apply(ctx context.Context, in *schedulingv1alpha1.PriorityClassApplyConfiguration, opts metav1.ApplyOptions) (result *apischedulingv1alpha1.PriorityClass, err error) { - in.Kind = ptr.String("PriorityClass") - - in.APIVersion = ptr.String("scheduling.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1alpha1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1alpha1PriorityClassImpl) ApplyStatus(ctx context.Context, in *schedulingv1alpha1.PriorityClassApplyConfiguration, opts metav1.ApplyOptions) (result *apischedulingv1alpha1.PriorityClass, err error) { - in.Kind = ptr.String("PriorityClass") - - in.APIVersion = ptr.String("scheduling.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1alpha1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1alpha1PriorityClassImpl) Create(ctx context.Context, in *apischedulingv1alpha1.PriorityClass, opts metav1.CreateOptions) (*apischedulingv1alpha1.PriorityClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "scheduling.k8s.io", - Version: "v1alpha1", - Kind: "PriorityClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1alpha1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1alpha1PriorityClassImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapSchedulingV1alpha1PriorityClassImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapSchedulingV1alpha1PriorityClassImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apischedulingv1alpha1.PriorityClass, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1alpha1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1alpha1PriorityClassImpl) List(ctx context.Context, opts metav1.ListOptions) (*apischedulingv1alpha1.PriorityClassList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1alpha1.PriorityClassList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1alpha1PriorityClassImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apischedulingv1alpha1.PriorityClass, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1alpha1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1alpha1PriorityClassImpl) Update(ctx context.Context, in *apischedulingv1alpha1.PriorityClass, opts metav1.UpdateOptions) (*apischedulingv1alpha1.PriorityClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "scheduling.k8s.io", - Version: "v1alpha1", - Kind: "PriorityClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1alpha1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1alpha1PriorityClassImpl) UpdateStatus(ctx context.Context, in *apischedulingv1alpha1.PriorityClass, opts metav1.UpdateOptions) (*apischedulingv1alpha1.PriorityClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "scheduling.k8s.io", - Version: "v1alpha1", - Kind: "PriorityClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1alpha1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1alpha1PriorityClassImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// SchedulingV1beta1 retrieves the SchedulingV1beta1Client -func (w *wrapClient) SchedulingV1beta1() typedschedulingv1beta1.SchedulingV1beta1Interface { - return &wrapSchedulingV1beta1{ - dyn: w.dyn, - } -} - -type wrapSchedulingV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapSchedulingV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapSchedulingV1beta1) PriorityClasses() typedschedulingv1beta1.PriorityClassInterface { - return &wrapSchedulingV1beta1PriorityClassImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "scheduling.k8s.io", - Version: "v1beta1", - Resource: "priorityclasses", - }), - } -} - -type wrapSchedulingV1beta1PriorityClassImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedschedulingv1beta1.PriorityClassInterface = (*wrapSchedulingV1beta1PriorityClassImpl)(nil) - -func (w *wrapSchedulingV1beta1PriorityClassImpl) Apply(ctx context.Context, in *schedulingv1beta1.PriorityClassApplyConfiguration, opts metav1.ApplyOptions) (result *apischedulingv1beta1.PriorityClass, err error) { - in.Kind = ptr.String("PriorityClass") - - in.APIVersion = ptr.String("scheduling.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1beta1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1beta1PriorityClassImpl) ApplyStatus(ctx context.Context, in *schedulingv1beta1.PriorityClassApplyConfiguration, opts metav1.ApplyOptions) (result *apischedulingv1beta1.PriorityClass, err error) { - in.Kind = ptr.String("PriorityClass") - - in.APIVersion = ptr.String("scheduling.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1beta1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1beta1PriorityClassImpl) Create(ctx context.Context, in *apischedulingv1beta1.PriorityClass, opts metav1.CreateOptions) (*apischedulingv1beta1.PriorityClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "scheduling.k8s.io", - Version: "v1beta1", - Kind: "PriorityClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1beta1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1beta1PriorityClassImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapSchedulingV1beta1PriorityClassImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapSchedulingV1beta1PriorityClassImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apischedulingv1beta1.PriorityClass, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1beta1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1beta1PriorityClassImpl) List(ctx context.Context, opts metav1.ListOptions) (*apischedulingv1beta1.PriorityClassList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1beta1.PriorityClassList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1beta1PriorityClassImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apischedulingv1beta1.PriorityClass, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1beta1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1beta1PriorityClassImpl) Update(ctx context.Context, in *apischedulingv1beta1.PriorityClass, opts metav1.UpdateOptions) (*apischedulingv1beta1.PriorityClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "scheduling.k8s.io", - Version: "v1beta1", - Kind: "PriorityClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1beta1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1beta1PriorityClassImpl) UpdateStatus(ctx context.Context, in *apischedulingv1beta1.PriorityClass, opts metav1.UpdateOptions) (*apischedulingv1beta1.PriorityClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "scheduling.k8s.io", - Version: "v1beta1", - Kind: "PriorityClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apischedulingv1beta1.PriorityClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapSchedulingV1beta1PriorityClassImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// StorageV1 retrieves the StorageV1Client -func (w *wrapClient) StorageV1() typedstoragev1.StorageV1Interface { - return &wrapStorageV1{ - dyn: w.dyn, - } -} - -type wrapStorageV1 struct { - dyn dynamic.Interface -} - -func (w *wrapStorageV1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapStorageV1) CSIDrivers() typedstoragev1.CSIDriverInterface { - return &wrapStorageV1CSIDriverImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "storage.k8s.io", - Version: "v1", - Resource: "csidrivers", - }), - } -} - -type wrapStorageV1CSIDriverImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedstoragev1.CSIDriverInterface = (*wrapStorageV1CSIDriverImpl)(nil) - -func (w *wrapStorageV1CSIDriverImpl) Apply(ctx context.Context, in *storagev1.CSIDriverApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1.CSIDriver, err error) { - in.Kind = ptr.String("CSIDriver") - - in.APIVersion = ptr.String("storage.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIDriverImpl) ApplyStatus(ctx context.Context, in *storagev1.CSIDriverApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1.CSIDriver, err error) { - in.Kind = ptr.String("CSIDriver") - - in.APIVersion = ptr.String("storage.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIDriverImpl) Create(ctx context.Context, in *apistoragev1.CSIDriver, opts metav1.CreateOptions) (*apistoragev1.CSIDriver, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "CSIDriver", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIDriverImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapStorageV1CSIDriverImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapStorageV1CSIDriverImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apistoragev1.CSIDriver, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIDriverImpl) List(ctx context.Context, opts metav1.ListOptions) (*apistoragev1.CSIDriverList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIDriverList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIDriverImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apistoragev1.CSIDriver, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIDriverImpl) Update(ctx context.Context, in *apistoragev1.CSIDriver, opts metav1.UpdateOptions) (*apistoragev1.CSIDriver, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "CSIDriver", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIDriverImpl) UpdateStatus(ctx context.Context, in *apistoragev1.CSIDriver, opts metav1.UpdateOptions) (*apistoragev1.CSIDriver, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "CSIDriver", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIDriverImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapStorageV1) CSINodes() typedstoragev1.CSINodeInterface { - return &wrapStorageV1CSINodeImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "storage.k8s.io", - Version: "v1", - Resource: "csinodes", - }), - } -} - -type wrapStorageV1CSINodeImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedstoragev1.CSINodeInterface = (*wrapStorageV1CSINodeImpl)(nil) - -func (w *wrapStorageV1CSINodeImpl) Apply(ctx context.Context, in *storagev1.CSINodeApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1.CSINode, err error) { - in.Kind = ptr.String("CSINode") - - in.APIVersion = ptr.String("storage.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSINodeImpl) ApplyStatus(ctx context.Context, in *storagev1.CSINodeApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1.CSINode, err error) { - in.Kind = ptr.String("CSINode") - - in.APIVersion = ptr.String("storage.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSINodeImpl) Create(ctx context.Context, in *apistoragev1.CSINode, opts metav1.CreateOptions) (*apistoragev1.CSINode, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "CSINode", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSINodeImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapStorageV1CSINodeImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapStorageV1CSINodeImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apistoragev1.CSINode, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSINodeImpl) List(ctx context.Context, opts metav1.ListOptions) (*apistoragev1.CSINodeList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSINodeList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSINodeImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apistoragev1.CSINode, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSINodeImpl) Update(ctx context.Context, in *apistoragev1.CSINode, opts metav1.UpdateOptions) (*apistoragev1.CSINode, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "CSINode", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSINodeImpl) UpdateStatus(ctx context.Context, in *apistoragev1.CSINode, opts metav1.UpdateOptions) (*apistoragev1.CSINode, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "CSINode", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSINodeImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapStorageV1) CSIStorageCapacities(namespace string) typedstoragev1.CSIStorageCapacityInterface { - return &wrapStorageV1CSIStorageCapacityImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "storage.k8s.io", - Version: "v1", - Resource: "csistoragecapacities", - }), - - namespace: namespace, - } -} - -type wrapStorageV1CSIStorageCapacityImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedstoragev1.CSIStorageCapacityInterface = (*wrapStorageV1CSIStorageCapacityImpl)(nil) - -func (w *wrapStorageV1CSIStorageCapacityImpl) Apply(ctx context.Context, in *storagev1.CSIStorageCapacityApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1.CSIStorageCapacity, err error) { - in.Kind = ptr.String("CSIStorageCapacity") - - in.APIVersion = ptr.String("storage.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIStorageCapacityImpl) ApplyStatus(ctx context.Context, in *storagev1.CSIStorageCapacityApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1.CSIStorageCapacity, err error) { - in.Kind = ptr.String("CSIStorageCapacity") - - in.APIVersion = ptr.String("storage.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIStorageCapacityImpl) Create(ctx context.Context, in *apistoragev1.CSIStorageCapacity, opts metav1.CreateOptions) (*apistoragev1.CSIStorageCapacity, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "CSIStorageCapacity", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIStorageCapacityImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapStorageV1CSIStorageCapacityImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapStorageV1CSIStorageCapacityImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apistoragev1.CSIStorageCapacity, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIStorageCapacityImpl) List(ctx context.Context, opts metav1.ListOptions) (*apistoragev1.CSIStorageCapacityList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIStorageCapacityList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIStorageCapacityImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apistoragev1.CSIStorageCapacity, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIStorageCapacityImpl) Update(ctx context.Context, in *apistoragev1.CSIStorageCapacity, opts metav1.UpdateOptions) (*apistoragev1.CSIStorageCapacity, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "CSIStorageCapacity", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIStorageCapacityImpl) UpdateStatus(ctx context.Context, in *apistoragev1.CSIStorageCapacity, opts metav1.UpdateOptions) (*apistoragev1.CSIStorageCapacity, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "CSIStorageCapacity", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1CSIStorageCapacityImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapStorageV1) StorageClasses() typedstoragev1.StorageClassInterface { - return &wrapStorageV1StorageClassImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "storage.k8s.io", - Version: "v1", - Resource: "storageclasses", - }), - } -} - -type wrapStorageV1StorageClassImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedstoragev1.StorageClassInterface = (*wrapStorageV1StorageClassImpl)(nil) - -func (w *wrapStorageV1StorageClassImpl) Apply(ctx context.Context, in *storagev1.StorageClassApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1.StorageClass, err error) { - in.Kind = ptr.String("StorageClass") - - in.APIVersion = ptr.String("storage.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1StorageClassImpl) ApplyStatus(ctx context.Context, in *storagev1.StorageClassApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1.StorageClass, err error) { - in.Kind = ptr.String("StorageClass") - - in.APIVersion = ptr.String("storage.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1StorageClassImpl) Create(ctx context.Context, in *apistoragev1.StorageClass, opts metav1.CreateOptions) (*apistoragev1.StorageClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "StorageClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1StorageClassImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapStorageV1StorageClassImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapStorageV1StorageClassImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apistoragev1.StorageClass, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1StorageClassImpl) List(ctx context.Context, opts metav1.ListOptions) (*apistoragev1.StorageClassList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.StorageClassList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1StorageClassImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apistoragev1.StorageClass, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1StorageClassImpl) Update(ctx context.Context, in *apistoragev1.StorageClass, opts metav1.UpdateOptions) (*apistoragev1.StorageClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "StorageClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1StorageClassImpl) UpdateStatus(ctx context.Context, in *apistoragev1.StorageClass, opts metav1.UpdateOptions) (*apistoragev1.StorageClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "StorageClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1StorageClassImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapStorageV1) VolumeAttachments() typedstoragev1.VolumeAttachmentInterface { - return &wrapStorageV1VolumeAttachmentImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "storage.k8s.io", - Version: "v1", - Resource: "volumeattachments", - }), - } -} - -type wrapStorageV1VolumeAttachmentImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedstoragev1.VolumeAttachmentInterface = (*wrapStorageV1VolumeAttachmentImpl)(nil) - -func (w *wrapStorageV1VolumeAttachmentImpl) Apply(ctx context.Context, in *storagev1.VolumeAttachmentApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1.VolumeAttachment, err error) { - in.Kind = ptr.String("VolumeAttachment") - - in.APIVersion = ptr.String("storage.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1VolumeAttachmentImpl) ApplyStatus(ctx context.Context, in *storagev1.VolumeAttachmentApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1.VolumeAttachment, err error) { - in.Kind = ptr.String("VolumeAttachment") - - in.APIVersion = ptr.String("storage.k8s.io/v1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1VolumeAttachmentImpl) Create(ctx context.Context, in *apistoragev1.VolumeAttachment, opts metav1.CreateOptions) (*apistoragev1.VolumeAttachment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "VolumeAttachment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1VolumeAttachmentImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapStorageV1VolumeAttachmentImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapStorageV1VolumeAttachmentImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apistoragev1.VolumeAttachment, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1VolumeAttachmentImpl) List(ctx context.Context, opts metav1.ListOptions) (*apistoragev1.VolumeAttachmentList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.VolumeAttachmentList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1VolumeAttachmentImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apistoragev1.VolumeAttachment, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1VolumeAttachmentImpl) Update(ctx context.Context, in *apistoragev1.VolumeAttachment, opts metav1.UpdateOptions) (*apistoragev1.VolumeAttachment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "VolumeAttachment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1VolumeAttachmentImpl) UpdateStatus(ctx context.Context, in *apistoragev1.VolumeAttachment, opts metav1.UpdateOptions) (*apistoragev1.VolumeAttachment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1", - Kind: "VolumeAttachment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1VolumeAttachmentImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// StorageV1alpha1 retrieves the StorageV1alpha1Client -func (w *wrapClient) StorageV1alpha1() typedstoragev1alpha1.StorageV1alpha1Interface { - return &wrapStorageV1alpha1{ - dyn: w.dyn, - } -} - -type wrapStorageV1alpha1 struct { - dyn dynamic.Interface -} - -func (w *wrapStorageV1alpha1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapStorageV1alpha1) CSIStorageCapacities(namespace string) typedstoragev1alpha1.CSIStorageCapacityInterface { - return &wrapStorageV1alpha1CSIStorageCapacityImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "storage.k8s.io", - Version: "v1alpha1", - Resource: "csistoragecapacities", - }), - - namespace: namespace, - } -} - -type wrapStorageV1alpha1CSIStorageCapacityImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedstoragev1alpha1.CSIStorageCapacityInterface = (*wrapStorageV1alpha1CSIStorageCapacityImpl)(nil) - -func (w *wrapStorageV1alpha1CSIStorageCapacityImpl) Apply(ctx context.Context, in *storagev1alpha1.CSIStorageCapacityApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1alpha1.CSIStorageCapacity, err error) { - in.Kind = ptr.String("CSIStorageCapacity") - - in.APIVersion = ptr.String("storage.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1CSIStorageCapacityImpl) ApplyStatus(ctx context.Context, in *storagev1alpha1.CSIStorageCapacityApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1alpha1.CSIStorageCapacity, err error) { - in.Kind = ptr.String("CSIStorageCapacity") - - in.APIVersion = ptr.String("storage.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1CSIStorageCapacityImpl) Create(ctx context.Context, in *apistoragev1alpha1.CSIStorageCapacity, opts metav1.CreateOptions) (*apistoragev1alpha1.CSIStorageCapacity, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1alpha1", - Kind: "CSIStorageCapacity", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1CSIStorageCapacityImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapStorageV1alpha1CSIStorageCapacityImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapStorageV1alpha1CSIStorageCapacityImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apistoragev1alpha1.CSIStorageCapacity, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1CSIStorageCapacityImpl) List(ctx context.Context, opts metav1.ListOptions) (*apistoragev1alpha1.CSIStorageCapacityList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.CSIStorageCapacityList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1CSIStorageCapacityImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apistoragev1alpha1.CSIStorageCapacity, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1CSIStorageCapacityImpl) Update(ctx context.Context, in *apistoragev1alpha1.CSIStorageCapacity, opts metav1.UpdateOptions) (*apistoragev1alpha1.CSIStorageCapacity, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1alpha1", - Kind: "CSIStorageCapacity", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1CSIStorageCapacityImpl) UpdateStatus(ctx context.Context, in *apistoragev1alpha1.CSIStorageCapacity, opts metav1.UpdateOptions) (*apistoragev1alpha1.CSIStorageCapacity, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1alpha1", - Kind: "CSIStorageCapacity", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1CSIStorageCapacityImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapStorageV1alpha1) VolumeAttachments() typedstoragev1alpha1.VolumeAttachmentInterface { - return &wrapStorageV1alpha1VolumeAttachmentImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "storage.k8s.io", - Version: "v1alpha1", - Resource: "volumeattachments", - }), - } -} - -type wrapStorageV1alpha1VolumeAttachmentImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedstoragev1alpha1.VolumeAttachmentInterface = (*wrapStorageV1alpha1VolumeAttachmentImpl)(nil) - -func (w *wrapStorageV1alpha1VolumeAttachmentImpl) Apply(ctx context.Context, in *storagev1alpha1.VolumeAttachmentApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1alpha1.VolumeAttachment, err error) { - in.Kind = ptr.String("VolumeAttachment") - - in.APIVersion = ptr.String("storage.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1VolumeAttachmentImpl) ApplyStatus(ctx context.Context, in *storagev1alpha1.VolumeAttachmentApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1alpha1.VolumeAttachment, err error) { - in.Kind = ptr.String("VolumeAttachment") - - in.APIVersion = ptr.String("storage.k8s.io/v1alpha1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1VolumeAttachmentImpl) Create(ctx context.Context, in *apistoragev1alpha1.VolumeAttachment, opts metav1.CreateOptions) (*apistoragev1alpha1.VolumeAttachment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1alpha1", - Kind: "VolumeAttachment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1VolumeAttachmentImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapStorageV1alpha1VolumeAttachmentImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapStorageV1alpha1VolumeAttachmentImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apistoragev1alpha1.VolumeAttachment, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1VolumeAttachmentImpl) List(ctx context.Context, opts metav1.ListOptions) (*apistoragev1alpha1.VolumeAttachmentList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.VolumeAttachmentList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1VolumeAttachmentImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apistoragev1alpha1.VolumeAttachment, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1VolumeAttachmentImpl) Update(ctx context.Context, in *apistoragev1alpha1.VolumeAttachment, opts metav1.UpdateOptions) (*apistoragev1alpha1.VolumeAttachment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1alpha1", - Kind: "VolumeAttachment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1VolumeAttachmentImpl) UpdateStatus(ctx context.Context, in *apistoragev1alpha1.VolumeAttachment, opts metav1.UpdateOptions) (*apistoragev1alpha1.VolumeAttachment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1alpha1", - Kind: "VolumeAttachment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1alpha1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1alpha1VolumeAttachmentImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -// StorageV1beta1 retrieves the StorageV1beta1Client -func (w *wrapClient) StorageV1beta1() typedstoragev1beta1.StorageV1beta1Interface { - return &wrapStorageV1beta1{ - dyn: w.dyn, - } -} - -type wrapStorageV1beta1 struct { - dyn dynamic.Interface -} - -func (w *wrapStorageV1beta1) RESTClient() rest.Interface { - panic("RESTClient called on dynamic client!") -} - -func (w *wrapStorageV1beta1) CSIDrivers() typedstoragev1beta1.CSIDriverInterface { - return &wrapStorageV1beta1CSIDriverImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "storage.k8s.io", - Version: "v1beta1", - Resource: "csidrivers", - }), - } -} - -type wrapStorageV1beta1CSIDriverImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedstoragev1beta1.CSIDriverInterface = (*wrapStorageV1beta1CSIDriverImpl)(nil) - -func (w *wrapStorageV1beta1CSIDriverImpl) Apply(ctx context.Context, in *storagev1beta1.CSIDriverApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1beta1.CSIDriver, err error) { - in.Kind = ptr.String("CSIDriver") - - in.APIVersion = ptr.String("storage.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIDriverImpl) ApplyStatus(ctx context.Context, in *storagev1beta1.CSIDriverApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1beta1.CSIDriver, err error) { - in.Kind = ptr.String("CSIDriver") - - in.APIVersion = ptr.String("storage.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIDriverImpl) Create(ctx context.Context, in *apistoragev1beta1.CSIDriver, opts metav1.CreateOptions) (*apistoragev1beta1.CSIDriver, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "CSIDriver", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIDriverImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapStorageV1beta1CSIDriverImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapStorageV1beta1CSIDriverImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apistoragev1beta1.CSIDriver, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIDriverImpl) List(ctx context.Context, opts metav1.ListOptions) (*apistoragev1beta1.CSIDriverList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIDriverList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIDriverImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apistoragev1beta1.CSIDriver, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIDriverImpl) Update(ctx context.Context, in *apistoragev1beta1.CSIDriver, opts metav1.UpdateOptions) (*apistoragev1beta1.CSIDriver, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "CSIDriver", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIDriverImpl) UpdateStatus(ctx context.Context, in *apistoragev1beta1.CSIDriver, opts metav1.UpdateOptions) (*apistoragev1beta1.CSIDriver, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "CSIDriver", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIDriver{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIDriverImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapStorageV1beta1) CSINodes() typedstoragev1beta1.CSINodeInterface { - return &wrapStorageV1beta1CSINodeImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "storage.k8s.io", - Version: "v1beta1", - Resource: "csinodes", - }), - } -} - -type wrapStorageV1beta1CSINodeImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedstoragev1beta1.CSINodeInterface = (*wrapStorageV1beta1CSINodeImpl)(nil) - -func (w *wrapStorageV1beta1CSINodeImpl) Apply(ctx context.Context, in *storagev1beta1.CSINodeApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1beta1.CSINode, err error) { - in.Kind = ptr.String("CSINode") - - in.APIVersion = ptr.String("storage.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSINodeImpl) ApplyStatus(ctx context.Context, in *storagev1beta1.CSINodeApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1beta1.CSINode, err error) { - in.Kind = ptr.String("CSINode") - - in.APIVersion = ptr.String("storage.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSINodeImpl) Create(ctx context.Context, in *apistoragev1beta1.CSINode, opts metav1.CreateOptions) (*apistoragev1beta1.CSINode, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "CSINode", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSINodeImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapStorageV1beta1CSINodeImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapStorageV1beta1CSINodeImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apistoragev1beta1.CSINode, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSINodeImpl) List(ctx context.Context, opts metav1.ListOptions) (*apistoragev1beta1.CSINodeList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSINodeList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSINodeImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apistoragev1beta1.CSINode, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSINodeImpl) Update(ctx context.Context, in *apistoragev1beta1.CSINode, opts metav1.UpdateOptions) (*apistoragev1beta1.CSINode, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "CSINode", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSINodeImpl) UpdateStatus(ctx context.Context, in *apistoragev1beta1.CSINode, opts metav1.UpdateOptions) (*apistoragev1beta1.CSINode, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "CSINode", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSINode{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSINodeImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapStorageV1beta1) CSIStorageCapacities(namespace string) typedstoragev1beta1.CSIStorageCapacityInterface { - return &wrapStorageV1beta1CSIStorageCapacityImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "storage.k8s.io", - Version: "v1beta1", - Resource: "csistoragecapacities", - }), - - namespace: namespace, - } -} - -type wrapStorageV1beta1CSIStorageCapacityImpl struct { - dyn dynamic.NamespaceableResourceInterface - - namespace string -} - -var _ typedstoragev1beta1.CSIStorageCapacityInterface = (*wrapStorageV1beta1CSIStorageCapacityImpl)(nil) - -func (w *wrapStorageV1beta1CSIStorageCapacityImpl) Apply(ctx context.Context, in *storagev1beta1.CSIStorageCapacityApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1beta1.CSIStorageCapacity, err error) { - in.Kind = ptr.String("CSIStorageCapacity") - - in.APIVersion = ptr.String("storage.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIStorageCapacityImpl) ApplyStatus(ctx context.Context, in *storagev1beta1.CSIStorageCapacityApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1beta1.CSIStorageCapacity, err error) { - in.Kind = ptr.String("CSIStorageCapacity") - - in.APIVersion = ptr.String("storage.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Namespace(w.namespace).ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIStorageCapacityImpl) Create(ctx context.Context, in *apistoragev1beta1.CSIStorageCapacity, opts metav1.CreateOptions) (*apistoragev1beta1.CSIStorageCapacity, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "CSIStorageCapacity", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIStorageCapacityImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Namespace(w.namespace).Delete(ctx, name, opts) -} - -func (w *wrapStorageV1beta1CSIStorageCapacityImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.Namespace(w.namespace).DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapStorageV1beta1CSIStorageCapacityImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apistoragev1beta1.CSIStorageCapacity, error) { - uo, err := w.dyn.Namespace(w.namespace).Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIStorageCapacityImpl) List(ctx context.Context, opts metav1.ListOptions) (*apistoragev1beta1.CSIStorageCapacityList, error) { - uo, err := w.dyn.Namespace(w.namespace).List(ctx, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIStorageCapacityList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIStorageCapacityImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apistoragev1beta1.CSIStorageCapacity, err error) { - uo, err := w.dyn.Namespace(w.namespace).Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIStorageCapacityImpl) Update(ctx context.Context, in *apistoragev1beta1.CSIStorageCapacity, opts metav1.UpdateOptions) (*apistoragev1beta1.CSIStorageCapacity, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "CSIStorageCapacity", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIStorageCapacityImpl) UpdateStatus(ctx context.Context, in *apistoragev1beta1.CSIStorageCapacity, opts metav1.UpdateOptions) (*apistoragev1beta1.CSIStorageCapacity, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "CSIStorageCapacity", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Namespace(w.namespace).UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.CSIStorageCapacity{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1CSIStorageCapacityImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapStorageV1beta1) StorageClasses() typedstoragev1beta1.StorageClassInterface { - return &wrapStorageV1beta1StorageClassImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "storage.k8s.io", - Version: "v1beta1", - Resource: "storageclasses", - }), - } -} - -type wrapStorageV1beta1StorageClassImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedstoragev1beta1.StorageClassInterface = (*wrapStorageV1beta1StorageClassImpl)(nil) - -func (w *wrapStorageV1beta1StorageClassImpl) Apply(ctx context.Context, in *storagev1beta1.StorageClassApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1beta1.StorageClass, err error) { - in.Kind = ptr.String("StorageClass") - - in.APIVersion = ptr.String("storage.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1StorageClassImpl) ApplyStatus(ctx context.Context, in *storagev1beta1.StorageClassApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1beta1.StorageClass, err error) { - in.Kind = ptr.String("StorageClass") - - in.APIVersion = ptr.String("storage.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1StorageClassImpl) Create(ctx context.Context, in *apistoragev1beta1.StorageClass, opts metav1.CreateOptions) (*apistoragev1beta1.StorageClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "StorageClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1StorageClassImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapStorageV1beta1StorageClassImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapStorageV1beta1StorageClassImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apistoragev1beta1.StorageClass, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1StorageClassImpl) List(ctx context.Context, opts metav1.ListOptions) (*apistoragev1beta1.StorageClassList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.StorageClassList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1StorageClassImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apistoragev1beta1.StorageClass, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1StorageClassImpl) Update(ctx context.Context, in *apistoragev1beta1.StorageClass, opts metav1.UpdateOptions) (*apistoragev1beta1.StorageClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "StorageClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1StorageClassImpl) UpdateStatus(ctx context.Context, in *apistoragev1beta1.StorageClass, opts metav1.UpdateOptions) (*apistoragev1beta1.StorageClass, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "StorageClass", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.StorageClass{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1StorageClassImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} - -func (w *wrapStorageV1beta1) VolumeAttachments() typedstoragev1beta1.VolumeAttachmentInterface { - return &wrapStorageV1beta1VolumeAttachmentImpl{ - dyn: w.dyn.Resource(schema.GroupVersionResource{ - Group: "storage.k8s.io", - Version: "v1beta1", - Resource: "volumeattachments", - }), - } -} - -type wrapStorageV1beta1VolumeAttachmentImpl struct { - dyn dynamic.NamespaceableResourceInterface -} - -var _ typedstoragev1beta1.VolumeAttachmentInterface = (*wrapStorageV1beta1VolumeAttachmentImpl)(nil) - -func (w *wrapStorageV1beta1VolumeAttachmentImpl) Apply(ctx context.Context, in *storagev1beta1.VolumeAttachmentApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1beta1.VolumeAttachment, err error) { - in.Kind = ptr.String("VolumeAttachment") - - in.APIVersion = ptr.String("storage.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1VolumeAttachmentImpl) ApplyStatus(ctx context.Context, in *storagev1beta1.VolumeAttachmentApplyConfiguration, opts metav1.ApplyOptions) (result *apistoragev1beta1.VolumeAttachment, err error) { - in.Kind = ptr.String("VolumeAttachment") - - in.APIVersion = ptr.String("storage.k8s.io/v1beta1") - - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1VolumeAttachmentImpl) Create(ctx context.Context, in *apistoragev1beta1.VolumeAttachment, opts metav1.CreateOptions) (*apistoragev1beta1.VolumeAttachment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "VolumeAttachment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1VolumeAttachmentImpl) Delete(ctx context.Context, name string, opts metav1.DeleteOptions) error { - return w.dyn.Delete(ctx, name, opts) -} - -func (w *wrapStorageV1beta1VolumeAttachmentImpl) DeleteCollection(ctx context.Context, opts metav1.DeleteOptions, listOpts metav1.ListOptions) error { - return w.dyn.DeleteCollection(ctx, opts, listOpts) -} - -func (w *wrapStorageV1beta1VolumeAttachmentImpl) Get(ctx context.Context, name string, opts metav1.GetOptions) (*apistoragev1beta1.VolumeAttachment, error) { - uo, err := w.dyn.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1VolumeAttachmentImpl) List(ctx context.Context, opts metav1.ListOptions) (*apistoragev1beta1.VolumeAttachmentList, error) { - uo, err := w.dyn.List(ctx, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.VolumeAttachmentList{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1VolumeAttachmentImpl) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts metav1.PatchOptions, subresources ...string) (result *apistoragev1beta1.VolumeAttachment, err error) { - uo, err := w.dyn.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1VolumeAttachmentImpl) Update(ctx context.Context, in *apistoragev1beta1.VolumeAttachment, opts metav1.UpdateOptions) (*apistoragev1beta1.VolumeAttachment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "VolumeAttachment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1VolumeAttachmentImpl) UpdateStatus(ctx context.Context, in *apistoragev1beta1.VolumeAttachment, opts metav1.UpdateOptions) (*apistoragev1beta1.VolumeAttachment, error) { - in.SetGroupVersionKind(schema.GroupVersionKind{ - Group: "storage.k8s.io", - Version: "v1beta1", - Kind: "VolumeAttachment", - }) - uo := &unstructured.Unstructured{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &apistoragev1beta1.VolumeAttachment{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} - -func (w *wrapStorageV1beta1VolumeAttachmentImpl) Watch(ctx context.Context, opts metav1.ListOptions) (watch.Interface, error) { - return nil, errors.New("NYI: Watch") -} diff --git a/vendor/knative.dev/pkg/client/injection/kube/client/client_expansion.go b/vendor/knative.dev/pkg/client/injection/kube/client/client_expansion.go deleted file mode 100644 index 56329f3965..0000000000 --- a/vendor/knative.dev/pkg/client/injection/kube/client/client_expansion.go +++ /dev/null @@ -1,160 +0,0 @@ -/* -Copyright 2021 The Knative Authors - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package client - -import ( - context "context" - fmt "fmt" - - certificatesv1beta1 "k8s.io/api/certificates/v1beta1" - corev1 "k8s.io/api/core/v1" - eventsv1beta1 "k8s.io/api/events/v1beta1" - extensionsv1beta1 "k8s.io/api/extensions/v1beta1" - policyv1 "k8s.io/api/policy/v1" - policyv1beta1 "k8s.io/api/policy/v1beta1" - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - "k8s.io/apimachinery/pkg/fields" - "k8s.io/apimachinery/pkg/runtime" - "k8s.io/apimachinery/pkg/types" - restclient "k8s.io/client-go/rest" -) - -func (*wrapCoreV1NamespaceImpl) Finalize(context.Context, *corev1.Namespace, metav1.UpdateOptions) (*corev1.Namespace, error) { - panic("NYI") -} - -func (*wrapCoreV1ServiceImpl) ProxyGet(string, string, string, string, map[string]string) restclient.ResponseWrapper { - panic("NYI") -} - -func (e *wrapEventsV1beta1EventImpl) CreateWithEventNamespace(event *eventsv1beta1.Event) (*eventsv1beta1.Event, error) { - if e.namespace != "" && event.Namespace != e.namespace { - return nil, fmt.Errorf("can't create an event with namespace '%v' in namespace '%v'", event.Namespace, e.namespace) - } - ne := &wrapEventsV1beta1EventImpl{ - dyn: e.dyn, - namespace: event.Namespace, - } - return ne.Create(context.TODO(), event, metav1.CreateOptions{}) -} - -func (e *wrapEventsV1beta1EventImpl) UpdateWithEventNamespace(event *eventsv1beta1.Event) (*eventsv1beta1.Event, error) { - if e.namespace != "" && event.Namespace != e.namespace { - return nil, fmt.Errorf("can't update an event with namespace '%v' in namespace '%v'", event.Namespace, e.namespace) - } - ne := &wrapEventsV1beta1EventImpl{ - dyn: e.dyn, - namespace: event.Namespace, - } - return ne.Update(context.TODO(), event, metav1.UpdateOptions{}) -} - -func (e *wrapEventsV1beta1EventImpl) PatchWithEventNamespace(event *eventsv1beta1.Event, bytes []byte) (*eventsv1beta1.Event, error) { - if e.namespace != "" && event.Namespace != e.namespace { - return nil, fmt.Errorf("can't patch an event with namespace '%v' in namespace '%v'", event.Namespace, e.namespace) - } - ne := &wrapEventsV1beta1EventImpl{ - dyn: e.dyn, - namespace: event.Namespace, - } - return ne.Patch(context.TODO(), event.Name, types.StrategicMergePatchType, bytes, metav1.PatchOptions{}) -} - -func (e *wrapCoreV1EventImpl) CreateWithEventNamespace(event *corev1.Event) (*corev1.Event, error) { - if e.namespace != "" && event.Namespace != e.namespace { - return nil, fmt.Errorf("can't create an event with namespace '%v' in namespace '%v'", event.Namespace, e.namespace) - } - ne := &wrapCoreV1EventImpl{ - dyn: e.dyn, - namespace: event.Namespace, - } - return ne.Create(context.TODO(), event, metav1.CreateOptions{}) -} - -func (e *wrapCoreV1EventImpl) UpdateWithEventNamespace(event *corev1.Event) (*corev1.Event, error) { - if e.namespace != "" && event.Namespace != e.namespace { - return nil, fmt.Errorf("can't update an event with namespace '%v' in namespace '%v'", event.Namespace, e.namespace) - } - ne := &wrapCoreV1EventImpl{ - dyn: e.dyn, - namespace: event.Namespace, - } - return ne.Update(context.TODO(), event, metav1.UpdateOptions{}) -} - -func (e *wrapCoreV1EventImpl) PatchWithEventNamespace(event *corev1.Event, bytes []byte) (*corev1.Event, error) { - if e.namespace != "" && event.Namespace != e.namespace { - return nil, fmt.Errorf("can't patch an event with namespace '%v' in namespace '%v'", event.Namespace, e.namespace) - } - ne := &wrapCoreV1EventImpl{ - dyn: e.dyn, - namespace: event.Namespace, - } - return ne.Patch(context.TODO(), event.Name, types.StrategicMergePatchType, bytes, metav1.PatchOptions{}) -} - -func (*wrapCoreV1EventImpl) Search(*runtime.Scheme, runtime.Object) (*corev1.EventList, error) { - panic("NYI") -} - -func (*wrapCoreV1EventImpl) GetFieldSelector(*string, *string, *string, *string) fields.Selector { - panic("NYI") -} - -func (*wrapCoreV1NodeImpl) PatchStatus(context.Context, string, []byte) (*corev1.Node, error) { - panic("NYI") -} - -func (*wrapCoreV1PodImpl) Bind(context.Context, *corev1.Binding, metav1.CreateOptions) error { - panic("NYI") -} - -func (*wrapCoreV1PodImpl) Evict(context.Context, *policyv1beta1.Eviction) error { - panic("NYI") -} - -func (*wrapCoreV1PodImpl) EvictV1(context.Context, *policyv1.Eviction) error { - panic("NYI") -} - -func (*wrapCoreV1PodImpl) EvictV1beta1(context.Context, *policyv1beta1.Eviction) error { - panic("NYI") -} - -func (c *wrapPolicyV1EvictionImpl) Evict(ctx context.Context, eviction *policyv1.Eviction) error { - panic("NYI") -} - -func (*wrapCoreV1PodImpl) GetLogs(string, *corev1.PodLogOptions) *restclient.Request { - panic("NYI") -} - -func (*wrapCoreV1PodImpl) ProxyGet(string, string, string, string, map[string]string) restclient.ResponseWrapper { - panic("NYI") -} - -func (*wrapExtensionsV1beta1DeploymentImpl) Rollback(context.Context, *extensionsv1beta1.DeploymentRollback, metav1.CreateOptions) error { - panic("NYI") -} - -func (*wrapPolicyV1beta1EvictionImpl) Evict(context.Context, *policyv1beta1.Eviction) error { - panic("NYI") -} - -func (*wrapCertificatesV1beta1CertificateSigningRequestImpl) UpdateApproval(context.Context, *certificatesv1beta1.CertificateSigningRequest, metav1.UpdateOptions) (*certificatesv1beta1.CertificateSigningRequest, error) { - panic("NYI") -} diff --git a/vendor/knative.dev/pkg/client/injection/kube/informers/admissionregistration/v1/mutatingwebhookconfiguration/mutatingwebhookconfiguration.go b/vendor/knative.dev/pkg/client/injection/kube/informers/admissionregistration/v1/mutatingwebhookconfiguration/mutatingwebhookconfiguration.go index 9c395d26e4..5efacd2979 100644 --- a/vendor/knative.dev/pkg/client/injection/kube/informers/admissionregistration/v1/mutatingwebhookconfiguration/mutatingwebhookconfiguration.go +++ b/vendor/knative.dev/pkg/client/injection/kube/informers/admissionregistration/v1/mutatingwebhookconfiguration/mutatingwebhookconfiguration.go @@ -21,14 +21,7 @@ package mutatingwebhookconfiguration import ( context "context" - apiadmissionregistrationv1 "k8s.io/api/admissionregistration/v1" - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" v1 "k8s.io/client-go/informers/admissionregistration/v1" - kubernetes "k8s.io/client-go/kubernetes" - admissionregistrationv1 "k8s.io/client-go/listers/admissionregistration/v1" - cache "k8s.io/client-go/tools/cache" - client "knative.dev/pkg/client/injection/kube/client" factory "knative.dev/pkg/client/injection/kube/informers/factory" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1.MutatingWebhookConfigurationInformer { untyped := ctx.Value(Key{}) @@ -63,48 +50,3 @@ func Get(ctx context.Context) v1.MutatingWebhookConfigurationInformer { } return untyped.(v1.MutatingWebhookConfigurationInformer) } - -type wrapper struct { - client kubernetes.Interface - - resourceVersion string -} - -var _ v1.MutatingWebhookConfigurationInformer = (*wrapper)(nil) -var _ admissionregistrationv1.MutatingWebhookConfigurationLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apiadmissionregistrationv1.MutatingWebhookConfiguration{}, 0, nil) -} - -func (w *wrapper) Lister() admissionregistrationv1.MutatingWebhookConfigurationLister { - return w -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apiadmissionregistrationv1.MutatingWebhookConfiguration, err error) { - lo, err := w.client.AdmissionregistrationV1().MutatingWebhookConfigurations().List(context.TODO(), metav1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, &lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apiadmissionregistrationv1.MutatingWebhookConfiguration, error) { - return w.client.AdmissionregistrationV1().MutatingWebhookConfigurations().Get(context.TODO(), name, metav1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/vendor/knative.dev/pkg/client/injection/kube/informers/admissionregistration/v1/validatingwebhookconfiguration/validatingwebhookconfiguration.go b/vendor/knative.dev/pkg/client/injection/kube/informers/admissionregistration/v1/validatingwebhookconfiguration/validatingwebhookconfiguration.go index f4fee2dfd5..e8a23f7174 100644 --- a/vendor/knative.dev/pkg/client/injection/kube/informers/admissionregistration/v1/validatingwebhookconfiguration/validatingwebhookconfiguration.go +++ b/vendor/knative.dev/pkg/client/injection/kube/informers/admissionregistration/v1/validatingwebhookconfiguration/validatingwebhookconfiguration.go @@ -21,14 +21,7 @@ package validatingwebhookconfiguration import ( context "context" - apiadmissionregistrationv1 "k8s.io/api/admissionregistration/v1" - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" v1 "k8s.io/client-go/informers/admissionregistration/v1" - kubernetes "k8s.io/client-go/kubernetes" - admissionregistrationv1 "k8s.io/client-go/listers/admissionregistration/v1" - cache "k8s.io/client-go/tools/cache" - client "knative.dev/pkg/client/injection/kube/client" factory "knative.dev/pkg/client/injection/kube/informers/factory" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1.ValidatingWebhookConfigurationInformer { untyped := ctx.Value(Key{}) @@ -63,48 +50,3 @@ func Get(ctx context.Context) v1.ValidatingWebhookConfigurationInformer { } return untyped.(v1.ValidatingWebhookConfigurationInformer) } - -type wrapper struct { - client kubernetes.Interface - - resourceVersion string -} - -var _ v1.ValidatingWebhookConfigurationInformer = (*wrapper)(nil) -var _ admissionregistrationv1.ValidatingWebhookConfigurationLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apiadmissionregistrationv1.ValidatingWebhookConfiguration{}, 0, nil) -} - -func (w *wrapper) Lister() admissionregistrationv1.ValidatingWebhookConfigurationLister { - return w -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apiadmissionregistrationv1.ValidatingWebhookConfiguration, err error) { - lo, err := w.client.AdmissionregistrationV1().ValidatingWebhookConfigurations().List(context.TODO(), metav1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, &lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apiadmissionregistrationv1.ValidatingWebhookConfiguration, error) { - return w.client.AdmissionregistrationV1().ValidatingWebhookConfigurations().Get(context.TODO(), name, metav1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/endpoints/endpoints.go b/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/endpoints/endpoints.go index a1008a3360..7c2b716d75 100644 --- a/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/endpoints/endpoints.go +++ b/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/endpoints/endpoints.go @@ -21,14 +21,7 @@ package endpoints import ( context "context" - apicorev1 "k8s.io/api/core/v1" - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" v1 "k8s.io/client-go/informers/core/v1" - kubernetes "k8s.io/client-go/kubernetes" - corev1 "k8s.io/client-go/listers/core/v1" - cache "k8s.io/client-go/tools/cache" - client "knative.dev/pkg/client/injection/kube/client" factory "knative.dev/pkg/client/injection/kube/informers/factory" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1.EndpointsInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1.EndpointsInformer { } return untyped.(v1.EndpointsInformer) } - -type wrapper struct { - client kubernetes.Interface - - namespace string - - resourceVersion string -} - -var _ v1.EndpointsInformer = (*wrapper)(nil) -var _ corev1.EndpointsLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apicorev1.Endpoints{}, 0, nil) -} - -func (w *wrapper) Lister() corev1.EndpointsLister { - return w -} - -func (w *wrapper) Endpoints(namespace string) corev1.EndpointsNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apicorev1.Endpoints, err error) { - lo, err := w.client.CoreV1().Endpoints(w.namespace).List(context.TODO(), metav1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, &lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apicorev1.Endpoints, error) { - return w.client.CoreV1().Endpoints(w.namespace).Get(context.TODO(), name, metav1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/pod/pod.go b/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/pod/pod.go index bfdb12f816..d547fef8f9 100644 --- a/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/pod/pod.go +++ b/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/pod/pod.go @@ -21,14 +21,7 @@ package pod import ( context "context" - apicorev1 "k8s.io/api/core/v1" - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" v1 "k8s.io/client-go/informers/core/v1" - kubernetes "k8s.io/client-go/kubernetes" - corev1 "k8s.io/client-go/listers/core/v1" - cache "k8s.io/client-go/tools/cache" - client "knative.dev/pkg/client/injection/kube/client" factory "knative.dev/pkg/client/injection/kube/informers/factory" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1.PodInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1.PodInformer { } return untyped.(v1.PodInformer) } - -type wrapper struct { - client kubernetes.Interface - - namespace string - - resourceVersion string -} - -var _ v1.PodInformer = (*wrapper)(nil) -var _ corev1.PodLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apicorev1.Pod{}, 0, nil) -} - -func (w *wrapper) Lister() corev1.PodLister { - return w -} - -func (w *wrapper) Pods(namespace string) corev1.PodNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apicorev1.Pod, err error) { - lo, err := w.client.CoreV1().Pods(w.namespace).List(context.TODO(), metav1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, &lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apicorev1.Pod, error) { - return w.client.CoreV1().Pods(w.namespace).Get(context.TODO(), name, metav1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/secret/filtered/secret.go b/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/secret/filtered/secret.go index fa9eab64f4..80d46c400c 100644 --- a/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/secret/filtered/secret.go +++ b/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/secret/filtered/secret.go @@ -21,14 +21,7 @@ package filtered import ( context "context" - apicorev1 "k8s.io/api/core/v1" - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" v1 "k8s.io/client-go/informers/core/v1" - kubernetes "k8s.io/client-go/kubernetes" - corev1 "k8s.io/client-go/listers/core/v1" - cache "k8s.io/client-go/tools/cache" - client "knative.dev/pkg/client/injection/kube/client" filtered "knative.dev/pkg/client/injection/kube/informers/factory/filtered" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterFilteredInformers(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -62,20 +54,6 @@ func withInformer(ctx context.Context) (context.Context, []controller.Informer) return ctx, infs } -func withDynamicInformer(ctx context.Context) context.Context { - untyped := ctx.Value(filtered.LabelKey{}) - if untyped == nil { - logging.FromContext(ctx).Panic( - "Unable to fetch labelkey from context.") - } - labelSelectors := untyped.([]string) - for _, selector := range labelSelectors { - inf := &wrapper{client: client.Get(ctx), selector: selector} - ctx = context.WithValue(ctx, Key{Selector: selector}, inf) - } - return ctx -} - // Get extracts the typed informer from the context. func Get(ctx context.Context, selector string) v1.SecretInformer { untyped := ctx.Value(Key{Selector: selector}) @@ -85,52 +63,3 @@ func Get(ctx context.Context, selector string) v1.SecretInformer { } return untyped.(v1.SecretInformer) } - -type wrapper struct { - client kubernetes.Interface - - namespace string - - selector string -} - -var _ v1.SecretInformer = (*wrapper)(nil) -var _ corev1.SecretLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apicorev1.Secret{}, 0, nil) -} - -func (w *wrapper) Lister() corev1.SecretLister { - return w -} - -func (w *wrapper) Secrets(namespace string) corev1.SecretNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, selector: w.selector} -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apicorev1.Secret, err error) { - reqs, err := labels.ParseToRequirements(w.selector) - if err != nil { - return nil, err - } - selector = selector.Add(reqs...) - lo, err := w.client.CoreV1().Secrets(w.namespace).List(context.TODO(), metav1.ListOptions{ - LabelSelector: selector.String(), - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, &lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apicorev1.Secret, error) { - // TODO(mattmoor): Check that the fetched object matches the selector. - return w.client.CoreV1().Secrets(w.namespace).Get(context.TODO(), name, metav1.GetOptions{ - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) -} diff --git a/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/secret/secret.go b/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/secret/secret.go index 27d22b702f..22ddeb5642 100644 --- a/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/secret/secret.go +++ b/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/secret/secret.go @@ -21,14 +21,7 @@ package secret import ( context "context" - apicorev1 "k8s.io/api/core/v1" - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" v1 "k8s.io/client-go/informers/core/v1" - kubernetes "k8s.io/client-go/kubernetes" - corev1 "k8s.io/client-go/listers/core/v1" - cache "k8s.io/client-go/tools/cache" - client "knative.dev/pkg/client/injection/kube/client" factory "knative.dev/pkg/client/injection/kube/informers/factory" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1.SecretInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1.SecretInformer { } return untyped.(v1.SecretInformer) } - -type wrapper struct { - client kubernetes.Interface - - namespace string - - resourceVersion string -} - -var _ v1.SecretInformer = (*wrapper)(nil) -var _ corev1.SecretLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apicorev1.Secret{}, 0, nil) -} - -func (w *wrapper) Lister() corev1.SecretLister { - return w -} - -func (w *wrapper) Secrets(namespace string) corev1.SecretNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apicorev1.Secret, err error) { - lo, err := w.client.CoreV1().Secrets(w.namespace).List(context.TODO(), metav1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, &lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apicorev1.Secret, error) { - return w.client.CoreV1().Secrets(w.namespace).Get(context.TODO(), name, metav1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/service/service.go b/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/service/service.go index cc379dade8..6e9d355053 100644 --- a/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/service/service.go +++ b/vendor/knative.dev/pkg/client/injection/kube/informers/core/v1/service/service.go @@ -21,14 +21,7 @@ package service import ( context "context" - apicorev1 "k8s.io/api/core/v1" - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" v1 "k8s.io/client-go/informers/core/v1" - kubernetes "k8s.io/client-go/kubernetes" - corev1 "k8s.io/client-go/listers/core/v1" - cache "k8s.io/client-go/tools/cache" - client "knative.dev/pkg/client/injection/kube/client" factory "knative.dev/pkg/client/injection/kube/informers/factory" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" @@ -37,7 +30,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -49,11 +41,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx), resourceVersion: injection.GetResourceVersion(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1.ServiceInformer { untyped := ctx.Value(Key{}) @@ -63,54 +50,3 @@ func Get(ctx context.Context) v1.ServiceInformer { } return untyped.(v1.ServiceInformer) } - -type wrapper struct { - client kubernetes.Interface - - namespace string - - resourceVersion string -} - -var _ v1.ServiceInformer = (*wrapper)(nil) -var _ corev1.ServiceLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apicorev1.Service{}, 0, nil) -} - -func (w *wrapper) Lister() corev1.ServiceLister { - return w -} - -func (w *wrapper) Services(namespace string) corev1.ServiceNamespaceLister { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apicorev1.Service, err error) { - lo, err := w.client.CoreV1().Services(w.namespace).List(context.TODO(), metav1.ListOptions{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, &lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apicorev1.Service, error) { - return w.client.CoreV1().Services(w.namespace).Get(context.TODO(), name, metav1.GetOptions{ - ResourceVersion: w.resourceVersion, - }) -} diff --git a/vendor/knative.dev/pkg/codegen/cmd/injection-gen/args/args.go b/vendor/knative.dev/pkg/codegen/cmd/injection-gen/args/args.go index b505968466..7cd8122d52 100644 --- a/vendor/knative.dev/pkg/codegen/cmd/injection-gen/args/args.go +++ b/vendor/knative.dev/pkg/codegen/cmd/injection-gen/args/args.go @@ -46,7 +46,9 @@ func (ca *CustomArgs) AddFlags(fs *pflag.FlagSet) { fs.StringVar(&ca.ExternalVersionsInformersPackage, "external-versions-informers-package", ca.ExternalVersionsInformersPackage, "the full package name for the external versions injection informer to use") fs.StringVar(&ca.ListersPackage, "listers-package", ca.ListersPackage, "the full package name for client listers to use") fs.StringVar(&ca.ForceKinds, "force-genreconciler-kinds", ca.ForceKinds, `force kinds will override the genreconciler tag setting for the given set of kinds, comma separated: "Foo,Bar,Baz"`) - fs.BoolVar(&ca.ListerHasPointerElem, "lister-has-pointer-elem", ca.ListerHasPointerElem, "set to true if the List types have an Item array of pointer element types") + + fs.BoolVar(&ca.ListerHasPointerElem, "lister-has-pointer-elem", false, "") + fs.MarkDeprecated("lister-has-pointer-elem", "this flag has no effect") } // Validate checks the given arguments. diff --git a/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/client.go b/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/client.go index 8338ed647c..646339a136 100644 --- a/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/client.go +++ b/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/client.go @@ -17,17 +17,8 @@ limitations under the License. package generators import ( - "fmt" "io" - "path/filepath" - "sort" - "strings" - "golang.org/x/text/cases" - "golang.org/x/text/language" - "k8s.io/apimachinery/pkg/util/sets" - "k8s.io/code-generator/cmd/client-gen/generators/util" - clientgentypes "k8s.io/code-generator/cmd/client-gen/types" "k8s.io/gengo/generator" "k8s.io/gengo/namer" "k8s.io/gengo/types" @@ -39,10 +30,6 @@ import ( type clientGenerator struct { generator.DefaultGen - groupVersions map[string]clientgentypes.GroupVersions - groupGoNames map[string]string - groupVersionTypes map[string]map[clientgentypes.Version][]*types.Type - outputPackage string imports namer.ImportTracker clientSetPackage string @@ -60,37 +47,14 @@ func (g *clientGenerator) Filter(c *generator.Context, t *types.Type) bool { return false } -var publicPluralNamer = &ExceptionNamer{ - Exceptions: map[string]string{ - // these exceptions are used to deconflict the generated code - // you can put your fully qualified package like - // to generate a name that doesn't conflict with your group. - // "k8s.io/apis/events/v1beta1.Event": "EventResource" - }, - KeyFunc: func(t *types.Type) string { - return t.Name.Package + "." + t.Name.Name - }, - Delegate: namer.NewPublicPluralNamer(map[string]string{ - "Endpoints": "Endpoints", - }), -} - func (g *clientGenerator) Namers(c *generator.Context) namer.NameSystems { return namer.NameSystems{ - "raw": namer.NewRawNamer(g.outputPackage, g.imports), - "publicPlural": publicPluralNamer, + "raw": namer.NewRawNamer(g.outputPackage, g.imports), } } func (g *clientGenerator) Imports(c *generator.Context) (imports []string) { imports = append(imports, g.imports.ImportLines()...) - for gpn, group := range g.groupVersions { - for _, version := range group.Versions { - typedClientPath := filepath.Join(g.clientSetPackage, "typed", strings.ToLower(group.PackageName), strings.ToLower(version.NonEmpty())) - imports = append(imports, fmt.Sprintf("%s \"%s\"", strings.ToLower("typed"+g.groupGoNames[gpn]+version.NonEmpty()), typedClientPath)) - } - } - imports = sets.NewString(imports...).List() return } @@ -100,10 +64,9 @@ func (g *clientGenerator) GenerateType(c *generator.Context, t *types.Type, w io klog.V(5).Info("processing type ", t) m := map[string]interface{}{ - "clientSetNewForConfigOrDie": c.Universe.Function(types.Name{Package: g.clientSetPackage, Name: "NewForConfigOrDie"}), - "clientSetInterface": c.Universe.Type(types.Name{Package: g.clientSetPackage, Name: "Interface"}), - "injectionRegisterClient": c.Universe.Function(types.Name{Package: "knative.dev/pkg/injection", Name: "Default.RegisterClient"}), - "injectionRegisterDynamicClient": c.Universe.Function(types.Name{Package: "knative.dev/pkg/injection", Name: "Dynamic.RegisterDynamicClient"}), + "clientSetNewForConfigOrDie": c.Universe.Function(types.Name{Package: g.clientSetPackage, Name: "NewForConfigOrDie"}), + "clientSetInterface": c.Universe.Type(types.Name{Package: g.clientSetPackage, Name: "Interface"}), + "injectionRegisterClient": c.Universe.Function(types.Name{Package: "knative.dev/pkg/injection", Name: "Default.RegisterClient"}), "injectionRegisterClientFetcher": c.Universe.Function(types.Name{ Package: "knative.dev/pkg/injection", Name: "Default.RegisterClientFetcher", @@ -117,234 +80,10 @@ func (g *clientGenerator) GenerateType(c *generator.Context, t *types.Type, w io Package: "context", Name: "Context", }), - "dynamicInterface": c.Universe.Type(types.Name{ - Package: "k8s.io/client-go/dynamic", - Name: "Interface", - }), - "dynamicclientGet": c.Universe.Function(types.Name{ - Package: "knative.dev/pkg/injection/clients/dynamicclient", - Name: "Get", - }), - "discoveryInterface": c.Universe.Type(types.Name{ - Package: "k8s.io/client-go/discovery", - Name: "DiscoveryInterface", - }), - "runtimeObject": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/runtime", - Name: "Object", - }), - "jsonMarshal": c.Universe.Function(types.Name{ - Package: "encoding/json", - Name: "Marshal", - }), - "jsonUnmarshal": c.Universe.Function(types.Name{ - Package: "encoding/json", - Name: "Unmarshal", - }), - "fmtErrorf": c.Universe.Function(types.Name{ - Package: "fmt", - Name: "Errorf", - }), } sw.Do(injectionClient, m) - gpns := make(sets.String, len(g.groupGoNames)) - for gpn := range g.groupGoNames { - gpns.Insert(gpn) - } - - for _, gpn := range gpns.List() { - ggn := g.groupGoNames[gpn] - gv := g.groupVersions[gpn] - verTypes := g.groupVersionTypes[gpn] - for _, version := range gv.Versions { - vts := verTypes[version.Version] - if len(vts) == 0 { - // Skip things with zero types. - continue - } - sw.Do(clientsetInterfaceImplTemplate, map[string]interface{}{ - "dynamicInterface": c.Universe.Type(types.Name{ - Package: "k8s.io/client-go/dynamic", - Name: "Interface", - }), - "restInterface": c.Universe.Type(types.Name{ - Package: "k8s.io/client-go/rest", - Name: "Interface", - }), - "GroupGoName": ggn, - "Version": namer.IC(version.String()), - "PackageAlias": strings.ToLower("typed" + g.groupGoNames[gpn] + version.NonEmpty()), - }) - sort.Slice(vts, func(i, j int) bool { - lhs, rhs := vts[i], vts[j] - return lhs.String() < rhs.String() - }) - for _, t := range vts { - tags, err := util.ParseClientGenTags(append(t.SecondClosestCommentLines, t.CommentLines...)) - if err != nil { - return err - } - - // Don't use the literal group "core", these should be left blank. - group := gv.Group - if group == "core" { - group = "" - } - - sw.Do(typeImplTemplate, map[string]interface{}{ - "dynamicNamespaceableResourceInterface": c.Universe.Type(types.Name{ - Package: "k8s.io/client-go/dynamic", - Name: "NamespaceableResourceInterface", - }), - "schemaGroupVersionResource": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/runtime/schema", - Name: "GroupVersionResource", - }), - "contextContext": c.Universe.Type(types.Name{ - Package: "context", - Name: "Context", - }), - "GroupGoName": ggn, - "Version": namer.IC(version.String()), - "PackageAlias": strings.ToLower("typed" + g.groupGoNames[gpn] + version.NonEmpty()), - "Type": t, - "Namespaced": !tags.NonNamespaced, - "Group": group, - "VersionLower": version, - "Resource": strings.ToLower(publicPluralNamer.Name(t)), - }) - opts := map[string]interface{}{ - "contextContext": c.Universe.Type(types.Name{ - Package: "context", - Name: "Context", - }), - "unstructuredUnstructured": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/apis/meta/v1/unstructured", - Name: "Unstructured", - }), - "metav1CreateOptions": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/apis/meta/v1", - Name: "CreateOptions", - }), - "metav1UpdateOptions": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/apis/meta/v1", - Name: "UpdateOptions", - }), - "metav1GetOptions": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/apis/meta/v1", - Name: "GetOptions", - }), - "metav1ListOptions": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/apis/meta/v1", - Name: "ListOptions", - }), - "metav1DeleteOptions": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/apis/meta/v1", - Name: "DeleteOptions", - }), - "metav1PatchOptions": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/apis/meta/v1", - Name: "PatchOptions", - }), - "metav1ApplyOptions": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/apis/meta/v1", - Name: "ApplyOptions", - }), - "typesPatchType": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/types", - Name: "PatchType", - }), - "watchInterface": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/watch", - Name: "Interface", - }), - "errorsNew": c.Universe.Function(types.Name{ - Package: "errors", - Name: "New", - }), - "GroupGoName": ggn, - "Version": namer.IC(version.String()), - "Type": t, - "InputType": t, - "ResultType": t, - - // TODO: Total hacks to get this to run at all. - "ApplyType": c.Universe.Type(types.Name{ - Package: "k8s.io/client-go/applyconfigurations/" + strings.ReplaceAll(t.Name.Package, "k8s.io/api/", ""), - Name: t.Name.Name + "ApplyConfiguration", - }), - "generateApply": strings.HasPrefix(t.Name.Package, "k8s.io/api/"), - - "Namespaced": !tags.NonNamespaced, - "Subresource": "", - "schemaGroupVersionKind": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/runtime/schema", - Name: "GroupVersionKind", - }), - "Group": group, - "VersionLower": version, - "Kind": t.Name.Name, - - "ptrString": c.Universe.Function(types.Name{ - Package: "knative.dev/pkg/ptr", - Name: "String", - }), - } - - for _, v := range verbs.List() { - tmpl := verbMap[v] - if tags.NoVerbs || !tags.HasVerb(v) { - continue - } - sw.Do(tmpl, opts) - } - for _, e := range tags.Extensions { - for _, v := range extensionVerbs.List() { - tmpl := extensionVerbMap[v] - if !e.HasVerb(v) { - continue - } - inputType := *t - resultType := *t - if len(e.InputTypeOverride) > 0 { - if name, pkg := e.Input(); len(pkg) > 0 { - // _, inputGVString = util.ParsePathGroupVersion(pkg) - newType := c.Universe.Type(types.Name{Package: pkg, Name: name}) - inputType = *newType - } else { - inputType.Name.Name = e.InputTypeOverride - } - } - if len(e.ResultTypeOverride) > 0 { - if name, pkg := e.Result(); len(pkg) > 0 { - newType := c.Universe.Type(types.Name{Package: pkg, Name: name}) - resultType = *newType - } else { - resultType.Name.Name = e.ResultTypeOverride - } - } - // TODO: Total hacks to get this to run at all. - if v == "apply" { - inputType = *(c.Universe.Type(types.Name{ - Package: "k8s.io/client-go/applyconfigurations/" + strings.ReplaceAll(inputType.Name.Package, "k8s.io/api/", ""), - Name: inputType.Name.Name + "ApplyConfiguration", - })) - } - opts["InputType"] = &inputType - opts["ResultType"] = &resultType - if e.IsSubresource() { - opts["Subresource"] = e.SubResourcePath - } - caser := cases.Title(language.English) - sw.Do(strings.Replace(tmpl, " "+caser.String(e.VerbType), " "+e.VerbName, -1), opts) - } - } - } - } - } - return sw.Error() } @@ -354,7 +93,6 @@ func init() { {{.injectionRegisterClientFetcher|raw}}(func(ctx context.Context) interface{} { return Get(ctx) }) - {{.injectionRegisterDynamicClient|raw}}(withClientFromDynamic) } // Key is used as the key for associating information with a context.Context. @@ -364,10 +102,6 @@ func withClientFromConfig(ctx {{.contextContext|raw}}, cfg *{{.restConfig|raw}}) return context.WithValue(ctx, Key{}, {{.clientSetNewForConfigOrDie|raw}}(cfg)) } -func withClientFromDynamic(ctx {{.contextContext|raw}}) context.Context { - return context.WithValue(ctx, Key{}, &wrapClient{dyn: {{.dynamicclientGet|raw}}(ctx)}) -} - // Get extracts the {{.clientSetInterface|raw}} client from the context. func Get(ctx {{.contextContext|raw}}) {{.clientSetInterface|raw}} { untyped := ctx.Value(Key{}) @@ -382,313 +116,4 @@ func Get(ctx {{.contextContext|raw}}) {{.clientSetInterface|raw}} { } return untyped.({{.clientSetInterface|raw}}) } - -type wrapClient struct { - dyn {{.dynamicInterface|raw}} -} - -var _ {{.clientSetInterface|raw}} = (*wrapClient)(nil) - -func (w *wrapClient) Discovery() {{.discoveryInterface|raw}} { - panic("Discovery called on dynamic client!") -} - - -func convert(from interface{}, to {{ .runtimeObject|raw }}) error { - bs, err := {{ .jsonMarshal|raw }}(from) - if err != nil { - return {{ .fmtErrorf|raw }}("Marshal() = %w", err) - } - if err := {{ .jsonUnmarshal|raw }}(bs, to); err != nil { - return {{ .fmtErrorf|raw }}("Unmarshal() = %w", err) - } - return nil -} - ` - -var clientsetInterfaceImplTemplate = ` -// {{.GroupGoName}}{{.Version}} retrieves the {{.GroupGoName}}{{.Version}}Client -func (w *wrapClient) {{.GroupGoName}}{{.Version}}() {{.PackageAlias}}.{{.GroupGoName}}{{.Version}}Interface { - return &wrap{{.GroupGoName}}{{.Version}}{ - dyn: w.dyn, - } -} - -type wrap{{.GroupGoName}}{{.Version}} struct { - dyn {{.dynamicInterface|raw}} -} - -func (w *wrap{{.GroupGoName}}{{.Version}}) RESTClient() {{.restInterface|raw}} { - panic("RESTClient called on dynamic client!") -} - -` - -var typeImplTemplate = ` -func (w *wrap{{ .GroupGoName }}{{ .Version }}) {{ .Type|publicPlural }}({{if .Namespaced}}namespace string{{end}}) {{ .PackageAlias }}.{{ .Type.Name.Name }}Interface { - return &wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl{ - dyn: w.dyn.Resource({{ .schemaGroupVersionResource|raw }}{ - Group: "{{ .Group }}", - Version: "{{ .VersionLower }}", - Resource: "{{ .Resource }}", - }), -{{if .Namespaced}} - namespace: namespace, -{{end}} - } -} - -type wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl struct { - dyn {{.dynamicNamespaceableResourceInterface|raw}} -{{if .Namespaced}} - namespace string -{{end}}} - -var _ {{ .PackageAlias }}.{{ .Type.Name.Name }}Interface = (*wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl)(nil) - -` - -var verbs = sets.NewString( /* Populated from verbMap during init */ ) -var verbMap = map[string]string{ - "create": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Create(ctx {{ .contextContext|raw }}, {{ if .Subresource }}_ string, {{ end }}in *{{ .InputType|raw }}, opts {{ .metav1CreateOptions|raw }}) (*{{ .ResultType|raw }}, error) { - in.SetGroupVersionKind({{ .schemaGroupVersionKind|raw }}{ - Group: "{{ .Group }}", - Version: "{{ .VersionLower }}", - Kind: "{{ .Kind }}", - }) - uo := &{{ .unstructuredUnstructured|raw }}{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn{{if .Namespaced}}{{if .Namespaced}}.Namespace(w.namespace){{end}}{{end}}.Create(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &{{ .ResultType|raw }}{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} -`, - - "update": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Update(ctx {{ .contextContext|raw }}, {{ if .Subresource }}_ string, {{ end }}in *{{ .InputType|raw }}, opts {{ .metav1UpdateOptions|raw }}) (*{{ .ResultType|raw }}, error) { - in.SetGroupVersionKind({{ .schemaGroupVersionKind|raw }}{ - Group: "{{ .Group }}", - Version: "{{ .VersionLower }}", - Kind: "{{ .Kind }}", - }) - uo := &{{ .unstructuredUnstructured|raw }}{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn{{if .Namespaced}}.Namespace(w.namespace){{end}}.Update(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &{{ .ResultType|raw }}{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} -`, - - "updateStatus": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) UpdateStatus(ctx {{ .contextContext|raw }}, in *{{ .InputType|raw }}, opts {{ .metav1UpdateOptions|raw }}) (*{{ .ResultType|raw }}, error) { - in.SetGroupVersionKind({{ .schemaGroupVersionKind|raw }}{ - Group: "{{ .Group }}", - Version: "{{ .VersionLower }}", - Kind: "{{ .Kind }}", - }) - uo := &{{ .unstructuredUnstructured|raw }}{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err := w.dyn{{if .Namespaced}}.Namespace(w.namespace){{end}}.UpdateStatus(ctx, uo, opts) - if err != nil { - return nil, err - } - out := &{{ .ResultType|raw }}{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} -`, - - "delete": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Delete(ctx {{ .contextContext|raw }}, name string, opts {{ .metav1DeleteOptions|raw }}) error { - return w.dyn{{if .Namespaced}}.Namespace(w.namespace){{end}}.Delete(ctx, name, opts) -} -`, - - "deleteCollection": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) DeleteCollection(ctx {{ .contextContext|raw }}, opts {{ .metav1DeleteOptions|raw }}, listOpts {{ .metav1ListOptions|raw }}) error { - return w.dyn{{if .Namespaced}}.Namespace(w.namespace){{end}}.DeleteCollection(ctx, opts, listOpts) -} -`, - - "get": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Get(ctx {{ .contextContext|raw }}, name string, opts {{ .metav1GetOptions|raw }}) (*{{ .ResultType|raw }}, error) { - uo, err := w.dyn{{if .Namespaced}}.Namespace(w.namespace){{end}}.Get(ctx, name, opts) - if err != nil { - return nil, err - } - out := &{{ .ResultType|raw }}{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} -`, - - "list": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) List(ctx {{ .contextContext|raw }}, opts {{ .metav1ListOptions|raw }}) (*{{ .ResultType|raw }}List, error) { - uo, err := w.dyn{{if .Namespaced}}.Namespace(w.namespace){{end}}.List(ctx, opts) - if err != nil { - return nil, err - } - out := &{{ .ResultType|raw }}List{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} -`, - - "watch": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Watch(ctx {{ .contextContext|raw }}, opts {{ .metav1ListOptions|raw }}) ({{ .watchInterface|raw }}, error) { - return nil, {{ .errorsNew|raw }}("NYI: Watch") -} -`, - "patch": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Patch(ctx {{ .contextContext|raw }}, name string, pt {{ .typesPatchType|raw }}, data []byte, opts {{ .metav1PatchOptions|raw }}, subresources ...string) (result *{{ .ResultType|raw }}, err error) { - uo, err := w.dyn{{if .Namespaced}}.Namespace(w.namespace){{end}}.Patch(ctx, name, pt, data, opts) - if err != nil { - return nil, err - } - out := &{{ .ResultType|raw }}{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} -`, - "apply": `{{if .generateApply}} -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Apply(ctx {{ .contextContext|raw }}, in *{{ .ApplyType|raw }}, opts {{ .metav1ApplyOptions|raw }}) (result *{{ .ResultType|raw }}, err error) { - in.Kind = {{ .ptrString|raw }}("{{ .Kind }}") - {{ if .Group }} - in.APIVersion = {{ .ptrString|raw }}("{{ .Group }}/{{ .VersionLower }}") - {{ else }} - in.APIVersion = {{ .ptrString|raw }}("{{ .VersionLower }}") - {{ end }} - - uo := &{{ .unstructuredUnstructured|raw }}{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn{{if .Namespaced}}.Namespace(w.namespace){{end}}.Apply(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &{{ .ResultType|raw }}{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} -{{end}} -`, - "applyStatus": `{{if .generateApply}} -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) ApplyStatus(ctx {{ .contextContext|raw }}, in *{{ .ApplyType|raw }}, opts {{ .metav1ApplyOptions|raw }}) (result *{{ .ResultType|raw }}, err error) { - in.Kind = {{ .ptrString|raw }}("{{ .Kind }}") - {{ if .Group }} - in.APIVersion = {{ .ptrString|raw }}("{{ .Group }}/{{ .VersionLower }}") - {{ else }} - in.APIVersion = {{ .ptrString|raw }}("{{ .VersionLower }}") - {{ end }} - - uo := &{{ .unstructuredUnstructured|raw }}{} - if err := convert(in, uo); err != nil { - return nil, err - } - uo, err = w.dyn{{if .Namespaced}}.Namespace(w.namespace){{end}}.ApplyStatus(ctx, uo.GetName(), uo, opts) - if err != nil { - return nil, err - } - out := &{{ .ResultType|raw }}{} - if err := convert(uo, out); err != nil { - return nil, err - } - return out, nil -} -{{end}} -`, -} - -var extensionVerbs = sets.NewString( /* Populated from extensionVerbMap during init */ ) -var extensionVerbMap = map[string]string{ - "apply": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Apply(ctx {{ .contextContext|raw }}, name string, in *{{ .InputType|raw }}, opts {{ .metav1ApplyOptions|raw }}) (*{{ .ResultType|raw }}, error) { - panic("NYI") -} -`, - "create": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Create(ctx {{ .contextContext|raw }}, {{ if .Subresource }}_ string, {{ end }}in *{{ .InputType|raw }}, opts {{ .metav1CreateOptions|raw }}) (*{{ .ResultType|raw }}, error) { - panic("NYI") -} -`, - "update": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Update(ctx {{ .contextContext|raw }}, {{ if .Subresource }}_ string, {{ end }}in *{{ .InputType|raw }}, opts {{ .metav1UpdateOptions|raw }}) (*{{ .ResultType|raw }}, error) { - panic("NYI") -} -`, - "updateStatus": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) UpdateStatus(ctx {{ .contextContext|raw }}, in *{{ .InputType|raw }}, opts {{ .metav1UpdateOptions|raw }}) (*{{ .ResultType|raw }}, error) { - panic("NYI") -} -`, - "delete": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Delete(ctx {{ .contextContext|raw }}, name string, opts {{ .metav1DeleteOptions|raw }}) error { - panic("NYI") -} -`, - "deleteCollection": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) DeleteCollection(ctx {{ .contextContext|raw }}, opts {{ .metav1DeleteOptions|raw }}, listOpts {{ .metav1ListOptions|raw }}) error { - panic("NYI") -} -`, - "get": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Get(ctx {{ .contextContext|raw }}, name string, opts {{ .metav1GetOptions|raw }}) (*{{ .ResultType|raw }}, error) { - panic("NYI") -} -`, - "list": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) List(ctx {{ .contextContext|raw }}, opts {{ .metav1ListOptions|raw }}) (*{{ .ResultType|raw }}List, error) { - panic("NYI") -} -`, - "watch": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Watch(ctx {{ .contextContext|raw }}, opts {{ .metav1ListOptions|raw }}) ({{ .watchInterface|raw }}, error) { - panic("NYI") -} -`, - "patch": ` -func (w *wrap{{.GroupGoName}}{{.Version}}{{ .Type.Name.Name }}Impl) Patch(ctx {{ .contextContext|raw }}, name string, pt {{ .typesPatchType|raw }}, data []byte, opts {{ .metav1PatchOptions|raw }}, subresources ...string) (result *{{ .ResultType|raw }}, err error) { - panic("NYI") -} -`, -} - -func init() { - for v := range verbMap { - verbs.Insert(v) - } - for ev := range extensionVerbMap { - extensionVerbs.Insert(ev) - } -} diff --git a/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/filtered_informer.go b/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/filtered_informer.go index b9c5c4ae2f..3cee6bc423 100644 --- a/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/filtered_informer.go +++ b/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/filtered_informer.go @@ -19,7 +19,6 @@ package generators import ( "io" - "k8s.io/code-generator/cmd/client-gen/generators/util" clientgentypes "k8s.io/code-generator/cmd/client-gen/types" "k8s.io/gengo/generator" "k8s.io/gengo/namer" @@ -38,10 +37,6 @@ type filteredInjectionGenerator struct { imports namer.ImportTracker typedInformerPackage string groupInformerFactoryPackage string - injectionClientSetPackage string - clientSetPackage string - listerPkg string - listerHasPointerElem bool } var _ generator.Generator = (*filteredInjectionGenerator)(nil) @@ -83,24 +78,11 @@ func (g *filteredInjectionGenerator) GenerateType(c *generator.Context, t *types klog.V(5).Info("processing type ", t) - tags, err := util.ParseClientGenTags(append(g.typeToGenerate.SecondClosestCommentLines, g.typeToGenerate.CommentLines...)) - if err != nil { - return err - } - m := map[string]interface{}{ - "clientGet": c.Universe.Type(types.Name{Package: g.injectionClientSetPackage, Name: "Get"}), - "clientSetInterface": c.Universe.Type(types.Name{Package: g.clientSetPackage, Name: "Interface"}), - "resourceLister": c.Universe.Type(types.Name{Name: g.typeToGenerate.Name.Name + "Lister", Package: g.listerPkg}), - "resourceNamespaceLister": c.Universe.Type(types.Name{Name: g.typeToGenerate.Name.Name + "NamespaceLister", Package: g.listerPkg}), - "listerHasPointerElem": g.listerHasPointerElem, - "groupGoName": namer.IC(g.groupGoName), - "versionGoName": namer.IC(g.groupVersion.Version.String()), "group": namer.IC(g.groupGoName), "type": t, "version": namer.IC(g.groupVersion.Version.String()), "injectionRegisterFilteredInformers": c.Universe.Type(types.Name{Package: "knative.dev/pkg/injection", Name: "Default.RegisterFilteredInformers"}), - "injectionRegisterDynamicInformer": c.Universe.Type(types.Name{Package: "knative.dev/pkg/injection", Name: "Dynamic.RegisterDynamicInformer"}), "controllerInformer": c.Universe.Type(types.Name{Package: "knative.dev/pkg/controller", Name: "Informer"}), "informersTypedInformer": c.Universe.Type(types.Name{Package: g.typedInformerPackage, Name: t.Name.Name + "Informer"}), "factoryLabelKey": c.Universe.Type(types.Name{Package: g.groupInformerFactoryPackage, Name: "LabelKey"}), @@ -117,39 +99,6 @@ func (g *filteredInjectionGenerator) GenerateType(c *generator.Context, t *types Package: "context", Name: "WithValue", }), - "schemaGVR": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/runtime/schema", - Name: "GroupVersionResource", - }), - "labelsSelector": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/labels", - Name: "Selector", - }), - "labelsParseToRequirements": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/labels", - Name: "ParseToRequirements", - }), - "contextTODO": c.Universe.Function(types.Name{ - Package: "context", - Name: "TODO", - }), - "metav1GetOptions": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/apis/meta/v1", - Name: "GetOptions", - }), - "metav1ListOptions": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/apis/meta/v1", - Name: "ListOptions", - }), - "cacheSharedIndexInformer": c.Universe.Type(types.Name{ - Package: "k8s.io/client-go/tools/cache", - Name: "SharedIndexInformer", - }), - "cacheNewSharedIndexInformer": c.Universe.Function(types.Name{ - Package: "k8s.io/client-go/tools/cache", - Name: "NewSharedIndexInformer", - }), - "Namespaced": !tags.NonNamespaced, } sw.Do(filteredInjectionInformer, m) @@ -160,7 +109,6 @@ func (g *filteredInjectionGenerator) GenerateType(c *generator.Context, t *types var filteredInjectionInformer = ` func init() { {{.injectionRegisterFilteredInformers|raw}}(withInformer) - {{.injectionRegisterDynamicInformer|raw}}(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -185,20 +133,6 @@ func withInformer(ctx {{.contextContext|raw}}) ({{.contextContext|raw}}, []{{.co return ctx, infs } -func withDynamicInformer(ctx {{.contextContext|raw}}) {{.contextContext|raw}} { - untyped := ctx.Value({{.factoryLabelKey|raw}}{}) - if untyped == nil { - {{.loggingFromContext|raw}}(ctx).Panic( - "Unable to fetch labelkey from context.") - } - labelSelectors := untyped.([]string) - for _, selector := range labelSelectors { - inf := &wrapper{client: {{ .clientGet|raw }}(ctx), selector: selector} - ctx = {{ .contextWithValue|raw }}(ctx, Key{Selector: selector}, inf) - } - return ctx -} - // Get extracts the typed informer from the context. func Get(ctx {{.contextContext|raw}}, selector string) {{.informersTypedInformer|raw}} { untyped := ctx.Value(Key{Selector: selector}) @@ -208,55 +142,4 @@ func Get(ctx {{.contextContext|raw}}, selector string) {{.informersTypedInformer } return untyped.({{.informersTypedInformer|raw}}) } - -type wrapper struct { - client {{.clientSetInterface|raw}} -{{ if .Namespaced }} - namespace string -{{ end }} - selector string -} - -var _ {{.informersTypedInformer|raw}} = (*wrapper)(nil) -var _ {{.resourceLister|raw}} = (*wrapper)(nil) - -func (w *wrapper) Informer() {{ .cacheSharedIndexInformer|raw }} { - return {{ .cacheNewSharedIndexInformer|raw }}(nil, &{{ .type|raw }}{}, 0, nil) -} - -func (w *wrapper) Lister() {{ .resourceLister|raw }} { - return w -} - -{{if .Namespaced}} -func (w *wrapper) {{ .type|publicPlural }}(namespace string) {{ .resourceNamespaceLister|raw }} { - return &wrapper{client: w.client, namespace: namespace, selector: w.selector} -} -{{end}} - -func (w *wrapper) List(selector {{ .labelsSelector|raw }}) (ret []*{{ .type|raw }}, err error) { - reqs, err := {{ .labelsParseToRequirements|raw }}(w.selector) - if err != nil { - return nil, err - } - selector = selector.Add(reqs...) - lo, err := w.client.{{.groupGoName}}{{.versionGoName}}().{{.type|publicPlural}}({{if .Namespaced}}w.namespace{{end}}).List({{ .contextTODO|raw }}(), {{ .metav1ListOptions|raw }}{ - LabelSelector: selector.String(), - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, {{if not .listerHasPointerElem}}&{{end}}lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*{{ .type|raw }}, error) { - // TODO(mattmoor): Check that the fetched object matches the selector. - return w.client.{{.groupGoName}}{{.versionGoName}}().{{.type|publicPlural}}({{if .Namespaced}}w.namespace{{end}}).Get({{ .contextTODO|raw }}(), name, {{ .metav1GetOptions|raw }}{ - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) -} ` diff --git a/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/informer.go b/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/informer.go index 305ec2476e..c4fb215f1d 100644 --- a/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/informer.go +++ b/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/informer.go @@ -19,7 +19,6 @@ package generators import ( "io" - "k8s.io/code-generator/cmd/client-gen/generators/util" clientgentypes "k8s.io/code-generator/cmd/client-gen/types" "k8s.io/gengo/generator" "k8s.io/gengo/namer" @@ -38,10 +37,6 @@ type injectionGenerator struct { imports namer.ImportTracker typedInformerPackage string groupInformerFactoryPackage string - injectionClientSetPackage string - clientSetPackage string - listerPkg string - listerHasPointerElem bool } var _ generator.Generator = (*injectionGenerator)(nil) @@ -83,27 +78,14 @@ func (g *injectionGenerator) GenerateType(c *generator.Context, t *types.Type, w klog.V(5).Info("processing type ", t) - tags, err := util.ParseClientGenTags(append(g.typeToGenerate.SecondClosestCommentLines, g.typeToGenerate.CommentLines...)) - if err != nil { - return err - } - m := map[string]interface{}{ - "clientGet": c.Universe.Type(types.Name{Package: g.injectionClientSetPackage, Name: "Get"}), - "clientSetInterface": c.Universe.Type(types.Name{Package: g.clientSetPackage, Name: "Interface"}), - "resourceLister": c.Universe.Type(types.Name{Name: g.typeToGenerate.Name.Name + "Lister", Package: g.listerPkg}), - "resourceNamespaceLister": c.Universe.Type(types.Name{Name: g.typeToGenerate.Name.Name + "NamespaceLister", Package: g.listerPkg}), - "listerHasPointerElem": g.listerHasPointerElem, - "groupGoName": namer.IC(g.groupGoName), - "versionGoName": namer.IC(g.groupVersion.Version.String()), - "group": g.groupVersion.Group.String(), - "version": g.groupVersion.Version.String(), - "type": t, - "injectionRegisterInformer": c.Universe.Type(types.Name{Package: "knative.dev/pkg/injection", Name: "Default.RegisterInformer"}), - "injectionRegisterDynamicInformer": c.Universe.Type(types.Name{Package: "knative.dev/pkg/injection", Name: "Dynamic.RegisterDynamicInformer"}), - "controllerInformer": c.Universe.Type(types.Name{Package: "knative.dev/pkg/controller", Name: "Informer"}), - "informersTypedInformer": c.Universe.Type(types.Name{Package: g.typedInformerPackage, Name: t.Name.Name + "Informer"}), - "factoryGet": c.Universe.Type(types.Name{Package: g.groupInformerFactoryPackage, Name: "Get"}), + "groupGoName": namer.IC(g.groupGoName), + "versionGoName": namer.IC(g.groupVersion.Version.String()), + "type": t, + "injectionRegisterInformer": c.Universe.Type(types.Name{Package: "knative.dev/pkg/injection", Name: "Default.RegisterInformer"}), + "controllerInformer": c.Universe.Type(types.Name{Package: "knative.dev/pkg/controller", Name: "Informer"}), + "informersTypedInformer": c.Universe.Type(types.Name{Package: g.typedInformerPackage, Name: t.Name.Name + "Informer"}), + "factoryGet": c.Universe.Type(types.Name{Package: g.groupInformerFactoryPackage, Name: "Get"}), "loggingFromContext": c.Universe.Function(types.Name{ Package: "knative.dev/pkg/logging", Name: "FromContext", @@ -116,39 +98,6 @@ func (g *injectionGenerator) GenerateType(c *generator.Context, t *types.Type, w Package: "context", Name: "WithValue", }), - "schemaGVR": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/runtime/schema", - Name: "GroupVersionResource", - }), - "labelsSelector": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/labels", - Name: "Selector", - }), - "contextTODO": c.Universe.Function(types.Name{ - Package: "context", - Name: "TODO", - }), - "metav1GetOptions": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/apis/meta/v1", - Name: "GetOptions", - }), - "metav1ListOptions": c.Universe.Type(types.Name{ - Package: "k8s.io/apimachinery/pkg/apis/meta/v1", - Name: "ListOptions", - }), - "cacheSharedIndexInformer": c.Universe.Type(types.Name{ - Package: "k8s.io/client-go/tools/cache", - Name: "SharedIndexInformer", - }), - "cacheNewSharedIndexInformer": c.Universe.Function(types.Name{ - Package: "k8s.io/client-go/tools/cache", - Name: "NewSharedIndexInformer", - }), - "Namespaced": !tags.NonNamespaced, - "injectionGetResourceVersion": c.Universe.Function(types.Name{ - Package: "knative.dev/pkg/injection", - Name: "GetResourceVersion", - }), } sw.Do(injectionInformer, m) @@ -159,7 +108,6 @@ func (g *injectionGenerator) GenerateType(c *generator.Context, t *types.Type, w var injectionInformer = ` func init() { {{.injectionRegisterInformer|raw}}(withInformer) - {{.injectionRegisterDynamicInformer|raw}}(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -171,11 +119,6 @@ func withInformer(ctx {{.contextContext|raw}}) ({{.contextContext|raw}}, {{.cont return {{ .contextWithValue|raw }}(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx {{.contextContext|raw}}) {{.contextContext|raw}} { - inf := &wrapper{client: {{ .clientGet|raw }}(ctx), resourceVersion: {{ .injectionGetResourceVersion|raw }}(ctx)} - return {{ .contextWithValue|raw }}(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx {{.contextContext|raw}}) {{.informersTypedInformer|raw}} { untyped := ctx.Value(Key{}) @@ -185,58 +128,4 @@ func Get(ctx {{.contextContext|raw}}) {{.informersTypedInformer|raw}} { } return untyped.({{.informersTypedInformer|raw}}) } - -type wrapper struct { - client {{.clientSetInterface|raw}} -{{ if .Namespaced }} - namespace string -{{ end }} - resourceVersion string -} - -var _ {{.informersTypedInformer|raw}} = (*wrapper)(nil) -var _ {{.resourceLister|raw}} = (*wrapper)(nil) - -func (w *wrapper) Informer() {{ .cacheSharedIndexInformer|raw }} { - return {{ .cacheNewSharedIndexInformer|raw }}(nil, &{{ .type|raw }}{}, 0, nil) -} - -func (w *wrapper) Lister() {{ .resourceLister|raw }} { - return w -} - -{{if .Namespaced}} -func (w *wrapper) {{ .type|publicPlural }}(namespace string) {{ .resourceNamespaceLister|raw }} { - return &wrapper{client: w.client, namespace: namespace, resourceVersion: w.resourceVersion} -} -{{end}} - -// SetResourceVersion allows consumers to adjust the minimum resourceVersion -// used by the underlying client. It is not accessible via the standard -// lister interface, but can be accessed through a user-defined interface and -// an implementation check e.g. rvs, ok := foo.(ResourceVersionSetter) -func (w *wrapper) SetResourceVersion(resourceVersion string) { - w.resourceVersion = resourceVersion -} - -func (w *wrapper) List(selector {{ .labelsSelector|raw }}) (ret []*{{ .type|raw }}, err error) { - lo, err := w.client.{{.groupGoName}}{{.versionGoName}}().{{.type|publicPlural}}({{if .Namespaced}}w.namespace{{end}}).List({{ .contextTODO|raw }}(), {{ .metav1ListOptions|raw }}{ - LabelSelector: selector.String(), - ResourceVersion: w.resourceVersion, - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, {{if not .listerHasPointerElem}}&{{end}}lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*{{ .type|raw }}, error) { - return w.client.{{.groupGoName}}{{.versionGoName}}().{{.type|publicPlural}}({{if .Namespaced}}w.namespace{{end}}).Get({{ .contextTODO|raw }}(), name, {{ .metav1GetOptions|raw }}{ - ResourceVersion: w.resourceVersion, - }) -} - ` diff --git a/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/packages.go b/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/packages.go index 8c3fe5240e..43768927a5 100644 --- a/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/packages.go +++ b/vendor/knative.dev/pkg/codegen/cmd/injection-gen/generators/packages.go @@ -17,7 +17,6 @@ limitations under the License. package generators import ( - "path" "path/filepath" "strings" @@ -48,22 +47,17 @@ func Packages(context *generator.Context, arguments *args.GeneratorArgs) generat var packageList generator.Packages - groupVersions := make(map[string]clientgentypes.GroupVersions) groupGoNames := make(map[string]string) - groupVersionTypes := make(map[string]map[clientgentypes.Version][]*types.Type) for _, inputDir := range arguments.InputDirs { p := context.Universe.Package(vendorless(inputDir)) var gv clientgentypes.GroupVersion - var targetGroupVersions map[string]clientgentypes.GroupVersions parts := strings.Split(p.Path, "/") gv.Group = clientgentypes.Group(parts[len(parts)-2]) gv.Version = clientgentypes.Version(parts[len(parts)-1]) - targetGroupVersions = groupVersions groupPackageName := gv.Group.NonEmpty() - gvPackage := path.Clean(p.Path) // If there's a comment of the form "// +groupName=somegroup" or // "// +groupName=somegroup.foo.bar.io", use the first field (somegroup) as the name of the @@ -82,7 +76,6 @@ func Packages(context *generator.Context, arguments *args.GeneratorArgs) generat var typesWithInformers []*types.Type var duckTypes []*types.Type var reconcilerTypes []*types.Type - var clientTypes []*types.Type for _, t := range p.Types { tags := MustParseClientGenTags(append(t.SecondClosestCommentLines, t.CommentLines...)) if tags.NeedsInformerInjection() { @@ -94,26 +87,7 @@ func Packages(context *generator.Context, arguments *args.GeneratorArgs) generat if tags.NeedsReconciler(t, customArgs) { reconcilerTypes = append(reconcilerTypes, t) } - if tags.GenerateClient { - clientTypes = append(clientTypes, t) - } - } - - groupVersionsEntry, ok := targetGroupVersions[groupPackageName] - if !ok { - groupVersionsEntry = clientgentypes.GroupVersions{ - PackageName: groupPackageName, - Group: gv.Group, - } - } - groupVersionsEntry.Versions = append(groupVersionsEntry.Versions, clientgentypes.PackageVersion{Version: gv.Version, Package: gvPackage}) - targetGroupVersions[groupPackageName] = groupVersionsEntry - verTypes, ok := groupVersionTypes[groupPackageName] - if !ok { - verTypes = make(map[clientgentypes.Version][]*types.Type) } - verTypes[gv.Version] = clientTypes - groupVersionTypes[groupPackageName] = verTypes if len(typesWithInformers) != 0 { orderer := namer.Orderer{Namer: namer.NewPrivateNamer(0)} @@ -141,7 +115,7 @@ func Packages(context *generator.Context, arguments *args.GeneratorArgs) generat } // Generate the client and fake. - packageList = append(packageList, versionClientsPackages(versionPackagePath, boilerplate, customArgs, groupVersions, groupGoNames, groupVersionTypes)...) + packageList = append(packageList, versionClientsPackages(versionPackagePath, boilerplate, customArgs)...) // Generate the informer factory and fake. packageList = append(packageList, versionFactoryPackages(versionPackagePath, boilerplate, customArgs)...) @@ -251,7 +225,7 @@ func typedInformerPackage(groupPkgName string, gv clientgentypes.GroupVersion, e return filepath.Join(externalVersionsInformersPackage, groupPkgName, gv.Version.String()) } -func versionClientsPackages(basePackage string, boilerplate []byte, customArgs *informergenargs.CustomArgs, groupVersions map[string]clientgentypes.GroupVersions, groupGoNames map[string]string, groupVersionTypes map[string]map[clientgentypes.Version][]*types.Type) []generator.Package { +func versionClientsPackages(basePackage string, boilerplate []byte, customArgs *informergenargs.CustomArgs) []generator.Package { packagePath := filepath.Join(basePackage, "client") return []generator.Package{ @@ -267,10 +241,6 @@ func versionClientsPackages(basePackage string, boilerplate []byte, customArgs * OptionalName: "client", }, - groupVersions: groupVersions, - groupGoNames: groupGoNames, - groupVersionTypes: groupVersionTypes, - outputPackage: packagePath, imports: generator.NewImportTracker(), clientSetPackage: customArgs.VersionedClientSetPackage, @@ -415,7 +385,6 @@ func versionInformerPackages(basePackage string, groupPkgName string, gv clientg filteredFactoryPackagePath := filepath.Join(basePackage, "informers", "factory", "filtered") packagePath := filepath.Join(basePackage, "informers", groupPkgName, strings.ToLower(gv.Version.NonEmpty())) - listerPackagePath := filepath.Join(customArgs.ListersPackage, groupPkgName, strings.ToLower(gv.Version.NonEmpty())) vers := make([]generator.Package, 0, 2*len(typesToGenerate)) @@ -443,10 +412,6 @@ func versionInformerPackages(basePackage string, groupPkgName string, gv clientg imports: generator.NewImportTracker(), typedInformerPackage: typedInformerPackage, groupInformerFactoryPackage: factoryPackagePath, - clientSetPackage: customArgs.VersionedClientSetPackage, - injectionClientSetPackage: filepath.Join(basePackage, "client"), - listerPkg: listerPackagePath, - listerHasPointerElem: customArgs.ListerHasPointerElem, }) return generators }, @@ -500,10 +465,6 @@ func versionInformerPackages(basePackage string, groupPkgName string, gv clientg imports: generator.NewImportTracker(), typedInformerPackage: typedInformerPackage, groupInformerFactoryPackage: filteredFactoryPackagePath, - clientSetPackage: customArgs.VersionedClientSetPackage, - injectionClientSetPackage: filepath.Join(basePackage, "client"), - listerPkg: listerPackagePath, - listerHasPointerElem: customArgs.ListerHasPointerElem, }) return generators }, diff --git a/vendor/knative.dev/pkg/injection/clients/dynamicclient/dynamicclient.go b/vendor/knative.dev/pkg/injection/clients/dynamicclient/dynamicclient.go deleted file mode 100644 index 2eece5c555..0000000000 --- a/vendor/knative.dev/pkg/injection/clients/dynamicclient/dynamicclient.go +++ /dev/null @@ -1,49 +0,0 @@ -/* -Copyright 2019 The Knative Authors - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package dynamicclient - -import ( - "context" - - "k8s.io/client-go/dynamic" - "k8s.io/client-go/rest" - - "knative.dev/pkg/injection" - "knative.dev/pkg/logging" -) - -func init() { - injection.Default.RegisterClient(withClient) -} - -// Key is used as the key for associating information -// with a context.Context. -type Key struct{} - -func withClient(ctx context.Context, cfg *rest.Config) context.Context { - return context.WithValue(ctx, Key{}, dynamic.NewForConfigOrDie(cfg)) -} - -// Get extracts the Dynamic client from the context. -func Get(ctx context.Context) dynamic.Interface { - untyped := ctx.Value(Key{}) - if untyped == nil { - logging.FromContext(ctx).Panic( - "Unable to fetch k8s.io/client-go/dynamic.Interface from context.") - } - return untyped.(dynamic.Interface) -} diff --git a/vendor/knative.dev/pkg/injection/clients/namespacedkube/informers/core/v1/secret/secret.go b/vendor/knative.dev/pkg/injection/clients/namespacedkube/informers/core/v1/secret/secret.go index e5193c8655..90d70627f4 100644 --- a/vendor/knative.dev/pkg/injection/clients/namespacedkube/informers/core/v1/secret/secret.go +++ b/vendor/knative.dev/pkg/injection/clients/namespacedkube/informers/core/v1/secret/secret.go @@ -19,14 +19,7 @@ package secret import ( context "context" - apicorev1 "k8s.io/api/core/v1" - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - labels "k8s.io/apimachinery/pkg/labels" v1 "k8s.io/client-go/informers/core/v1" - kubernetes "k8s.io/client-go/kubernetes" - corev1 "k8s.io/client-go/listers/core/v1" - cache "k8s.io/client-go/tools/cache" - client "knative.dev/pkg/client/injection/kube/client" controller "knative.dev/pkg/controller" injection "knative.dev/pkg/injection" factory "knative.dev/pkg/injection/clients/namespacedkube/informers/factory" @@ -35,7 +28,6 @@ import ( func init() { injection.Default.RegisterInformer(withInformer) - injection.Dynamic.RegisterDynamicInformer(withDynamicInformer) } // Key is used for associating the Informer inside the context.Context. @@ -47,11 +39,6 @@ func withInformer(ctx context.Context) (context.Context, controller.Informer) { return context.WithValue(ctx, Key{}, inf), inf.Informer() } -func withDynamicInformer(ctx context.Context) context.Context { - inf := &wrapper{client: client.Get(ctx)} - return context.WithValue(ctx, Key{}, inf) -} - // Get extracts the typed informer from the context. func Get(ctx context.Context) v1.SecretInformer { untyped := ctx.Value(Key{}) @@ -61,44 +48,3 @@ func Get(ctx context.Context) v1.SecretInformer { } return untyped.(v1.SecretInformer) } - -type wrapper struct { - client kubernetes.Interface - - namespace string -} - -var _ v1.SecretInformer = (*wrapper)(nil) -var _ corev1.SecretLister = (*wrapper)(nil) - -func (w *wrapper) Informer() cache.SharedIndexInformer { - return cache.NewSharedIndexInformer(nil, &apicorev1.Secret{}, 0, nil) -} - -func (w *wrapper) Lister() corev1.SecretLister { - return w -} - -func (w *wrapper) Secrets(namespace string) corev1.SecretNamespaceLister { - return &wrapper{client: w.client, namespace: namespace} -} - -func (w *wrapper) List(selector labels.Selector) (ret []*apicorev1.Secret, err error) { - lo, err := w.client.CoreV1().Secrets(w.namespace).List(context.TODO(), metav1.ListOptions{ - LabelSelector: selector.String(), - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) - if err != nil { - return nil, err - } - for idx := range lo.Items { - ret = append(ret, &lo.Items[idx]) - } - return ret, nil -} - -func (w *wrapper) Get(name string) (*apicorev1.Secret, error) { - return w.client.CoreV1().Secrets(w.namespace).Get(context.TODO(), name, metav1.GetOptions{ - // TODO(mattmoor): Incorporate resourceVersion bounds based on staleness criteria. - }) -} diff --git a/vendor/modules.txt b/vendor/modules.txt index f020e79e00..997c821502 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -267,12 +267,6 @@ golang.org/x/sys/windows golang.org/x/term # golang.org/x/text v0.7.0 ## explicit; go 1.17 -golang.org/x/text/cases -golang.org/x/text/internal -golang.org/x/text/internal/language -golang.org/x/text/internal/language/compact -golang.org/x/text/internal/tag -golang.org/x/text/language golang.org/x/text/secure/bidirule golang.org/x/text/transform golang.org/x/text/unicode/bidi @@ -906,7 +900,7 @@ k8s.io/utils/trace # knative.dev/hack v0.0.0-20230501013555-7d81248b4638 ## explicit; go 1.18 knative.dev/hack -# knative.dev/networking v0.0.0-20230504184058-77975a12b2ee +# knative.dev/networking v0.0.0-20230519194114-a44b093b6809 ## explicit; go 1.18 knative.dev/networking/config knative.dev/networking/pkg @@ -956,7 +950,7 @@ knative.dev/networking/test/test_images/runtime/handlers knative.dev/networking/test/test_images/timeout knative.dev/networking/test/test_images/wsserver knative.dev/networking/test/types -# knative.dev/pkg v0.0.0-20230502134655-db8a35330281 +# knative.dev/pkg v0.0.0-20230519200515-52ff2acf870d ## explicit; go 1.18 knative.dev/pkg/apis knative.dev/pkg/apis/duck @@ -992,7 +986,6 @@ knative.dev/pkg/environment knative.dev/pkg/hack knative.dev/pkg/hash knative.dev/pkg/injection -knative.dev/pkg/injection/clients/dynamicclient knative.dev/pkg/injection/clients/namespacedkube/informers/core/v1/secret knative.dev/pkg/injection/clients/namespacedkube/informers/factory knative.dev/pkg/injection/sharedmain