From 0ea0df822f954a18c2da37b2424381a9db6d53e7 Mon Sep 17 00:00:00 2001 From: Moses Narrow <36607567+0pcom@users.noreply.github.com> Date: Tue, 17 Dec 2024 19:24:57 -0600 Subject: [PATCH] update deps (#1914) --- go.mod | 43 +- go.sum | 82 +- vendor/github.com/go-chi/chi/.gitignore | 3 - vendor/github.com/go-chi/chi/.travis.yml | 20 - vendor/github.com/go-chi/chi/CHANGELOG.md | 190 ---- vendor/github.com/go-chi/chi/CONTRIBUTING.md | 31 - vendor/github.com/go-chi/chi/LICENSE | 20 - vendor/github.com/go-chi/chi/README.md | 441 --------- vendor/github.com/go-chi/chi/chain.go | 49 - vendor/github.com/go-chi/chi/chi.go | 134 --- vendor/github.com/go-chi/chi/context.go | 172 ---- .../go-chi/chi/middleware/basic_auth.go | 32 - .../go-chi/chi/middleware/compress.go | 399 -------- .../go-chi/chi/middleware/content_charset.go | 51 -- .../go-chi/chi/middleware/content_encoding.go | 34 - .../go-chi/chi/middleware/content_type.go | 51 -- .../go-chi/chi/middleware/get_head.go | 39 - .../go-chi/chi/middleware/heartbeat.go | 26 - .../go-chi/chi/middleware/logger.go | 155 ---- .../go-chi/chi/middleware/middleware.go | 23 - .../go-chi/chi/middleware/nocache.go | 58 -- .../go-chi/chi/middleware/profiler.go | 55 -- .../go-chi/chi/middleware/realip.go | 54 -- .../go-chi/chi/middleware/recoverer.go | 192 ---- .../go-chi/chi/middleware/request_id.go | 96 -- .../go-chi/chi/middleware/route_headers.go | 160 ---- .../github.com/go-chi/chi/middleware/strip.go | 56 -- .../go-chi/chi/middleware/terminal.go | 63 -- .../go-chi/chi/middleware/throttle.go | 132 --- .../go-chi/chi/middleware/timeout.go | 49 - .../go-chi/chi/middleware/url_format.go | 72 -- .../github.com/go-chi/chi/middleware/value.go | 17 - .../go-chi/chi/middleware/wrap_writer.go | 180 ---- vendor/github.com/go-chi/chi/mux.go | 466 ---------- vendor/github.com/go-chi/chi/tree.go | 865 ------------------ vendor/github.com/go-chi/chi/v5/README.md | 5 +- vendor/github.com/go-chi/chi/v5/chi.go | 6 +- vendor/github.com/go-chi/chi/v5/context.go | 5 +- .../go-chi/chi/v5/middleware/content_type.go | 22 +- .../go-chi/chi/v5/middleware/strip.go | 8 + .../go-chi/chi/v5/middleware/throttle.go | 20 +- .../go-chi/chi/v5/middleware/wrap_writer.go | 6 +- vendor/github.com/go-chi/chi/v5/mux.go | 31 +- .../github.com/klauspost/cpuid/v2/README.md | 1 + vendor/github.com/klauspost/cpuid/v2/cpuid.go | 84 +- .../klauspost/cpuid/v2/cpuid_arm64.s | 10 + .../klauspost/cpuid/v2/detect_arm64.go | 3 +- .../klauspost/cpuid/v2/detect_ref.go | 2 + .../klauspost/cpuid/v2/detect_x86.go | 3 + .../klauspost/cpuid/v2/featureid_string.go | 440 ++++----- .../onsi/ginkgo/v2/formatter/formatter.go | 4 + .../github.com/onsi/ginkgo/v2/types/config.go | 2 +- .../github.com/onsi/ginkgo/v2/types/types.go | 10 +- .../onsi/ginkgo/v2/types/version.go | 2 +- .../github.com/quic-go/quic-go/closed_conn.go | 9 +- .../github.com/quic-go/quic-go/connection.go | 2 +- .../quic-go/quic-go/sys_conn_df_linux.go | 4 +- .../pkg/service-discovery/api/api.go | 4 +- .../testify/assert/assertion_compare.go | 35 +- .../testify/assert/assertion_format.go | 34 +- .../testify/assert/assertion_forward.go | 68 +- .../testify/assert/assertion_order.go | 10 +- .../stretchr/testify/assert/assertions.go | 157 +++- .../testify/assert/yaml/yaml_custom.go | 25 + .../testify/assert/yaml/yaml_default.go | 37 + .../stretchr/testify/assert/yaml/yaml_fail.go | 18 + .../github.com/stretchr/testify/mock/mock.go | 155 ++-- .../stretchr/testify/require/require.go | 432 +++++---- .../stretchr/testify/require/require.go.tmpl | 2 +- .../testify/require/require_forward.go | 68 +- .../stretchr/testify/require/requirements.go | 2 +- .../x/crypto/chacha20/chacha_noasm.go | 2 +- .../{chacha_ppc64le.go => chacha_ppc64x.go} | 2 +- .../{chacha_ppc64le.s => chacha_ppc64x.s} | 114 ++- .../x/crypto/internal/poly1305/mac_noasm.go | 2 +- .../{sum_ppc64le.go => sum_ppc64x.go} | 2 +- .../poly1305/{sum_ppc64le.s => sum_ppc64x.s} | 30 +- vendor/golang.org/x/crypto/sha3/doc.go | 4 + vendor/golang.org/x/crypto/sha3/hashes.go | 31 +- vendor/golang.org/x/crypto/sha3/sha3.go | 187 ++-- vendor/golang.org/x/crypto/sha3/shake.go | 85 +- vendor/golang.org/x/crypto/sha3/xor.go | 40 - .../x/exp/constraints/constraints.go | 50 - vendor/golang.org/x/exp/slices/cmp.go | 44 - vendor/golang.org/x/exp/slices/slices.go | 416 +-------- vendor/golang.org/x/exp/slices/sort.go | 143 +-- .../golang.org/x/exp/slices/zsortanyfunc.go | 479 ---------- .../golang.org/x/exp/slices/zsortordered.go | 481 ---------- vendor/golang.org/x/net/html/doc.go | 7 +- vendor/golang.org/x/net/html/iter.go | 56 ++ vendor/golang.org/x/net/html/node.go | 4 + .../x/net/http2/client_conn_pool.go | 8 +- vendor/golang.org/x/net/http2/frame.go | 4 +- vendor/golang.org/x/net/http2/http2.go | 42 +- vendor/golang.org/x/net/http2/server.go | 69 +- vendor/golang.org/x/net/http2/transport.go | 373 ++++++-- vendor/golang.org/x/net/http2/unencrypted.go | 32 + .../net/internal/socket/zsys_openbsd_ppc64.go | 28 +- .../internal/socket/zsys_openbsd_riscv64.go | 28 +- .../golang.org/x/sys/cpu/asm_darwin_x86_gc.s | 17 + vendor/golang.org/x/sys/cpu/cpu_darwin_x86.go | 61 ++ vendor/golang.org/x/sys/cpu/cpu_gc_x86.go | 4 +- .../x/sys/cpu/{cpu_x86.s => cpu_gc_x86.s} | 2 +- vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go | 6 - .../golang.org/x/sys/cpu/cpu_linux_arm64.go | 1 - .../cpu/cpu_other_x86.go} | 11 +- vendor/golang.org/x/sys/cpu/cpu_x86.go | 6 +- .../x/sys/cpu/syscall_darwin_x86_gc.go | 98 ++ vendor/golang.org/x/sys/unix/ioctl_linux.go | 96 ++ vendor/golang.org/x/sys/unix/mkerrors.sh | 12 + vendor/golang.org/x/sys/unix/syscall_linux.go | 1 + .../x/sys/unix/syscall_zos_s390x.go | 104 ++- vendor/golang.org/x/sys/unix/zerrors_linux.go | 31 + .../x/sys/unix/zerrors_linux_386.go | 20 + .../x/sys/unix/zerrors_linux_amd64.go | 20 + .../x/sys/unix/zerrors_linux_arm.go | 20 + .../x/sys/unix/zerrors_linux_arm64.go | 21 + .../x/sys/unix/zerrors_linux_loong64.go | 20 + .../x/sys/unix/zerrors_linux_mips.go | 20 + .../x/sys/unix/zerrors_linux_mips64.go | 20 + .../x/sys/unix/zerrors_linux_mips64le.go | 20 + .../x/sys/unix/zerrors_linux_mipsle.go | 20 + .../x/sys/unix/zerrors_linux_ppc.go | 20 + .../x/sys/unix/zerrors_linux_ppc64.go | 20 + .../x/sys/unix/zerrors_linux_ppc64le.go | 20 + .../x/sys/unix/zerrors_linux_riscv64.go | 20 + .../x/sys/unix/zerrors_linux_s390x.go | 20 + .../x/sys/unix/zerrors_linux_sparc64.go | 20 + .../golang.org/x/sys/unix/zsyscall_linux.go | 10 + .../x/sys/unix/ztypes_darwin_amd64.go | 60 ++ .../x/sys/unix/ztypes_darwin_arm64.go | 60 ++ vendor/golang.org/x/sys/unix/ztypes_linux.go | 138 ++- .../golang.org/x/sys/unix/ztypes_zos_s390x.go | 6 + .../x/sys/windows/syscall_windows.go | 36 +- .../golang.org/x/sys/windows/types_windows.go | 127 +++ .../x/sys/windows/zsyscall_windows.go | 71 ++ vendor/golang.org/x/term/README.md | 11 +- .../x/tools/go/ast/astutil/imports.go | 5 + .../x/tools/go/ast/inspector/inspector.go | 4 +- .../x/tools/go/gcexportdata/gcexportdata.go | 119 ++- .../x/tools/go/packages/external.go | 13 +- .../golang.org/x/tools/go/packages/golist.go | 43 +- .../x/tools/go/packages/loadmode_string.go | 1 + .../x/tools/go/packages/packages.go | 373 ++++---- .../x/tools/go/types/objectpath/objectpath.go | 99 +- .../x/tools/internal/gcimporter/exportdata.go | 71 +- .../x/tools/internal/gcimporter/gcimporter.go | 80 +- .../x/tools/internal/gcimporter/iexport.go | 24 +- .../x/tools/internal/gcimporter/iimport.go | 12 + .../internal/gcimporter/iimport_go122.go | 53 ++ .../x/tools/internal/imports/fix.go | 233 ++--- .../x/tools/internal/imports/imports.go | 31 +- .../x/tools/internal/imports/source.go | 63 ++ .../x/tools/internal/imports/source_env.go | 129 +++ .../tools/internal/imports/source_modindex.go | 103 +++ .../x/tools/internal/modindex/directories.go | 135 +++ .../x/tools/internal/modindex/index.go | 262 ++++++ .../x/tools/internal/modindex/lookup.go | 145 +++ .../x/tools/internal/modindex/modindex.go | 164 ++++ .../x/tools/internal/modindex/symbols.go | 189 ++++ .../x/tools/internal/modindex/types.go | 25 + .../internal/packagesinternal/packages.go | 2 - .../x/tools/internal/typeparams/free.go | 17 +- .../x/tools/internal/typesinternal/types.go | 56 ++ .../tools/internal/typesinternal/zerovalue.go | 282 ++++++ .../x/tools/internal/versions/constraint.go | 13 - .../x/tools/internal/versions/types.go | 5 - vendor/gorm.io/driver/postgres/migrator.go | 12 +- vendor/modules.txt | 49 +- 169 files changed, 5542 insertions(+), 7539 deletions(-) delete mode 100644 vendor/github.com/go-chi/chi/.gitignore delete mode 100644 vendor/github.com/go-chi/chi/.travis.yml delete mode 100644 vendor/github.com/go-chi/chi/CHANGELOG.md delete mode 100644 vendor/github.com/go-chi/chi/CONTRIBUTING.md delete mode 100644 vendor/github.com/go-chi/chi/LICENSE delete mode 100644 vendor/github.com/go-chi/chi/README.md delete mode 100644 vendor/github.com/go-chi/chi/chain.go delete mode 100644 vendor/github.com/go-chi/chi/chi.go delete mode 100644 vendor/github.com/go-chi/chi/context.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/basic_auth.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/compress.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/content_charset.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/content_encoding.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/content_type.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/get_head.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/heartbeat.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/logger.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/middleware.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/nocache.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/profiler.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/realip.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/recoverer.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/request_id.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/route_headers.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/strip.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/terminal.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/throttle.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/timeout.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/url_format.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/value.go delete mode 100644 vendor/github.com/go-chi/chi/middleware/wrap_writer.go delete mode 100644 vendor/github.com/go-chi/chi/mux.go delete mode 100644 vendor/github.com/go-chi/chi/tree.go create mode 100644 vendor/github.com/stretchr/testify/assert/yaml/yaml_custom.go create mode 100644 vendor/github.com/stretchr/testify/assert/yaml/yaml_default.go create mode 100644 vendor/github.com/stretchr/testify/assert/yaml/yaml_fail.go rename vendor/golang.org/x/crypto/chacha20/{chacha_ppc64le.go => chacha_ppc64x.go} (89%) rename vendor/golang.org/x/crypto/chacha20/{chacha_ppc64le.s => chacha_ppc64x.s} (76%) rename vendor/golang.org/x/crypto/internal/poly1305/{sum_ppc64le.go => sum_ppc64x.go} (95%) rename vendor/golang.org/x/crypto/internal/poly1305/{sum_ppc64le.s => sum_ppc64x.s} (89%) delete mode 100644 vendor/golang.org/x/crypto/sha3/xor.go delete mode 100644 vendor/golang.org/x/exp/constraints/constraints.go delete mode 100644 vendor/golang.org/x/exp/slices/cmp.go delete mode 100644 vendor/golang.org/x/exp/slices/zsortanyfunc.go delete mode 100644 vendor/golang.org/x/exp/slices/zsortordered.go create mode 100644 vendor/golang.org/x/net/html/iter.go create mode 100644 vendor/golang.org/x/net/http2/unencrypted.go create mode 100644 vendor/golang.org/x/sys/cpu/asm_darwin_x86_gc.s create mode 100644 vendor/golang.org/x/sys/cpu/cpu_darwin_x86.go rename vendor/golang.org/x/sys/cpu/{cpu_x86.s => cpu_gc_x86.s} (94%) rename vendor/golang.org/x/{tools/internal/versions/constraint_go121.go => sys/cpu/cpu_other_x86.go} (50%) create mode 100644 vendor/golang.org/x/sys/cpu/syscall_darwin_x86_gc.go create mode 100644 vendor/golang.org/x/tools/internal/gcimporter/iimport_go122.go create mode 100644 vendor/golang.org/x/tools/internal/imports/source.go create mode 100644 vendor/golang.org/x/tools/internal/imports/source_env.go create mode 100644 vendor/golang.org/x/tools/internal/imports/source_modindex.go create mode 100644 vendor/golang.org/x/tools/internal/modindex/directories.go create mode 100644 vendor/golang.org/x/tools/internal/modindex/index.go create mode 100644 vendor/golang.org/x/tools/internal/modindex/lookup.go create mode 100644 vendor/golang.org/x/tools/internal/modindex/modindex.go create mode 100644 vendor/golang.org/x/tools/internal/modindex/symbols.go create mode 100644 vendor/golang.org/x/tools/internal/modindex/types.go create mode 100644 vendor/golang.org/x/tools/internal/typesinternal/zerovalue.go delete mode 100644 vendor/golang.org/x/tools/internal/versions/constraint.go diff --git a/go.mod b/go.mod index d510e205a4..c9a2eff69a 100644 --- a/go.mod +++ b/go.mod @@ -16,7 +16,7 @@ require ( github.com/fatih/color v1.18.0 github.com/gen2brain/dlgs v0.0.0-20220603100644-40c77870fa8d github.com/gin-gonic/gin v1.10.0 - github.com/go-chi/chi/v5 v5.1.0 + github.com/go-chi/chi/v5 v5.2.0 github.com/go-redis/redis/v8 v8.11.5 github.com/gocarina/gocsv v0.0.0-20240520201108-78e41c74b4b1 github.com/google/uuid v1.6.0 @@ -34,15 +34,15 @@ require ( github.com/pterm/pterm v0.12.79 github.com/robert-nix/ansihtml v1.0.1 github.com/sirupsen/logrus v1.9.3 - github.com/skycoin/dmsg v1.3.29-0.20241217193208-d32ec623e670 + github.com/skycoin/dmsg v1.3.29-0.20241218010226-56d92f2ef624 github.com/skycoin/skycoin v0.28.1-0.20241105130348-39b49a2d0a7f - github.com/skycoin/skycoin-service-discovery v1.3.29-0.20241217194518-634b05d94b2e - github.com/skycoin/skywire-services v1.3.29-0.20241217194941-6269f3c618c3 + github.com/skycoin/skycoin-service-discovery v1.3.29-0.20241218011239-6f6be8edf287 + github.com/skycoin/skywire-services v1.3.29-0.20241218011810-0e3f3a797af4 github.com/skycoin/systray v1.10.0 github.com/songgao/water v0.0.0-20200317203138-2b4b6d7c09d8 github.com/spf13/cobra v1.8.1 github.com/spf13/pflag v1.0.5 - github.com/stretchr/testify v1.9.0 + github.com/stretchr/testify v1.10.0 github.com/syndtr/gocapability v0.0.0-20200815063812-42c35b437635 github.com/tidwall/pretty v1.2.1 github.com/toqueteos/webbrowser v1.2.0 @@ -50,10 +50,10 @@ require ( github.com/yuin/goldmark v1.4.13 github.com/zcalusic/sysinfo v1.1.2 go.etcd.io/bbolt v1.3.11 - golang.org/x/net v0.30.0 - golang.org/x/sync v0.8.0 - golang.org/x/sys v0.26.0 - golang.org/x/term v0.25.0 + golang.org/x/net v0.32.0 + golang.org/x/sync v0.10.0 + golang.org/x/sys v0.28.0 + golang.org/x/term v0.27.0 golang.zx2c4.com/wireguard v0.0.0-20231211153847-12269c276173 gopkg.in/telebot.v3 v3.3.8 ) @@ -89,7 +89,6 @@ require ( github.com/fsnotify/fsnotify v1.8.0 // indirect github.com/gabriel-vasile/mimetype v1.4.6 // indirect github.com/gin-contrib/sse v0.1.0 // indirect - github.com/go-chi/chi v4.1.2+incompatible // indirect github.com/go-chi/cors v1.2.1 // indirect github.com/go-chi/httprate v0.14.1 // indirect github.com/go-echarts/go-echarts/v2 v2.4.3 // indirect @@ -101,7 +100,7 @@ require ( github.com/goccy/go-json v0.10.3 // indirect github.com/godbus/dbus/v5 v5.1.0 // indirect github.com/gomarkdown/markdown v0.0.0-20240930133441-72d49d9543d8 // indirect - github.com/google/pprof v0.0.0-20241017200806-017d972448fc // indirect + github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad // indirect github.com/gookit/color v1.5.4 // indirect github.com/gopherjs/gopherjs v1.17.2 // indirect github.com/hashicorp/hcl v1.0.0 // indirect @@ -115,7 +114,7 @@ require ( github.com/jaypipes/pcidb v1.0.1 // indirect github.com/jinzhu/inflection v1.0.0 // indirect github.com/jinzhu/now v1.1.5 // indirect - github.com/klauspost/cpuid/v2 v2.2.8 // indirect + github.com/klauspost/cpuid/v2 v2.2.9 // indirect github.com/klauspost/reedsolomon v1.12.4 // indirect github.com/kyokomi/emoji/v2 v2.2.13 // indirect github.com/leodido/go-urn v1.4.0 // indirect @@ -129,11 +128,11 @@ require ( github.com/mitchellh/mapstructure v1.5.0 // indirect github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect github.com/modern-go/reflect2 v1.0.2 // indirect - github.com/onsi/ginkgo/v2 v2.20.2 // indirect + github.com/onsi/ginkgo/v2 v2.22.0 // indirect github.com/pelletier/go-toml/v2 v2.2.3 // indirect github.com/pkg/errors v0.9.1 // indirect github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 // indirect - github.com/quic-go/quic-go v0.48.0 // indirect + github.com/quic-go/quic-go v0.48.2 // indirect github.com/rivo/uniseg v0.4.7 // indirect github.com/rs/cors v1.11.1 // indirect github.com/sagikazarmark/locafero v0.6.0 // indirect @@ -158,18 +157,18 @@ require ( go.uber.org/mock v0.5.0 // indirect go.uber.org/multierr v1.11.0 // indirect golang.org/x/arch v0.11.0 // indirect - golang.org/x/crypto v0.28.0 // indirect - golang.org/x/exp v0.0.0-20241009180824-f66d83c29e7c // indirect + golang.org/x/crypto v0.31.0 // indirect + golang.org/x/exp v0.0.0-20241217172543-b2144cdd0a67 // indirect golang.org/x/image v0.21.0 // indirect - golang.org/x/mod v0.21.0 // indirect - golang.org/x/text v0.19.0 // indirect - golang.org/x/tools v0.26.0 // indirect + golang.org/x/mod v0.22.0 // indirect + golang.org/x/text v0.21.0 // indirect + golang.org/x/tools v0.28.0 // indirect golang.zx2c4.com/wintun v0.0.0-20230126152724-0fa3db229ce2 // indirect google.golang.org/protobuf v1.35.1 // indirect gopkg.in/ini.v1 v1.67.0 // indirect gopkg.in/natefinch/lumberjack.v2 v2.2.1 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect - gorm.io/driver/postgres v1.5.9 // indirect + gorm.io/driver/postgres v1.5.11 // indirect gorm.io/gorm v1.25.12 // indirect howett.net/plist v1.0.1 // indirect mvdan.cc/sh/v3 v3.9.0 // indirect @@ -198,5 +197,5 @@ require ( // Below should reflect the current versions of the following deps // replace github.com/skycoin/skycoin => github.com/skycoin/skycoin v0.28.1-0.20241105130348-39b49a2d0a7f // replace github.com/skycoin/dmsg => github.com/skycoin/dmsg v1.3.29-0.20241217193208-d32ec623e670 -// replace github.com/skycoin/skywire-services => github.com/skycoin/skywire-services v1.3.29-0.20241217194941-6269f3c618c3 -// replace github.com/skycoin/skycoin-service-discovery => github.com/skycoin/skycoin-service-discovery v1.3.29-0.20241217194518-634b05d94b2e +//replace github.com/skycoin/skywire-services => github.com/skycoin/skywire-services v1.3.29-0.20241218011810-0e3f3a797af4 +//replace github.com/skycoin/skycoin-service-discovery => github.com/skycoin/skycoin-service-discovery v1.3.29-0.20241218011239-6f6be8edf287 diff --git a/go.sum b/go.sum index aa5ff8da58..8075169680 100644 --- a/go.sum +++ b/go.sum @@ -226,10 +226,8 @@ github.com/gin-contrib/sse v0.1.0 h1:Y/yl/+YNO8GZSjAhjMsSuLt29uWRFHdHYUb5lYOV9qE github.com/gin-contrib/sse v0.1.0/go.mod h1:RHrZQHXnP2xjPF+u1gW/2HnVO7nvIa9PG3Gm+fLHvGI= github.com/gin-gonic/gin v1.10.0 h1:nTuyha1TYqgedzytsKYqna+DfLos46nTv2ygFy86HFU= github.com/gin-gonic/gin v1.10.0/go.mod h1:4PMNQiOhvDRa013RKVbsiNwoyezlm2rm0uX/T7kzp5Y= -github.com/go-chi/chi v4.1.2+incompatible h1:fGFk2Gmi/YKXk0OmGfBh0WgmN3XB8lVnEyNz34tQRec= -github.com/go-chi/chi v4.1.2+incompatible/go.mod h1:eB3wogJHnLi3x/kFX2A+IbTBlXxmMeXJVKy9tTv1XzQ= -github.com/go-chi/chi/v5 v5.1.0 h1:acVI1TYaD+hhedDJ3r54HyA6sExp3HfXq7QWEEY/xMw= -github.com/go-chi/chi/v5 v5.1.0/go.mod h1:DslCQbL2OYiznFReuXYUmQ2hGd1aDpCnlMNITLSKoi8= +github.com/go-chi/chi/v5 v5.2.0 h1:Aj1EtB0qR2Rdo2dG4O94RIU35w2lvQSj6BRA4+qwFL0= +github.com/go-chi/chi/v5 v5.2.0/go.mod h1:DslCQbL2OYiznFReuXYUmQ2hGd1aDpCnlMNITLSKoi8= github.com/go-chi/cors v1.2.1 h1:xEC8UT3Rlp2QuWNEr4Fs/c2EAGVKBwy/1vHx3bppil4= github.com/go-chi/cors v1.2.1/go.mod h1:sSbTewc+6wYHBBCW7ytsFSn836hqM7JxpglAy2Vzc58= github.com/go-chi/httprate v0.14.1 h1:EKZHYEZ58Cg6hWcYzoZILsv7ppb46Wt4uQ738IRtpZs= @@ -358,8 +356,8 @@ github.com/google/pprof v0.0.0-20210226084205-cbba55b83ad5/go.mod h1:kpwsk12EmLe github.com/google/pprof v0.0.0-20210601050228-01bbb1931b22/go.mod h1:kpwsk12EmLew5upagYY7GY0pfYCcupk39gWOCRROcvE= github.com/google/pprof v0.0.0-20210609004039-a478d1d731e9/go.mod h1:kpwsk12EmLew5upagYY7GY0pfYCcupk39gWOCRROcvE= github.com/google/pprof v0.0.0-20210720184732-4bb14d4b1be1/go.mod h1:kpwsk12EmLew5upagYY7GY0pfYCcupk39gWOCRROcvE= -github.com/google/pprof v0.0.0-20241017200806-017d972448fc h1:NGyrhhFhwvRAZg02jnYVg3GBQy0qGBKmFQJwaPmpmxs= -github.com/google/pprof v0.0.0-20241017200806-017d972448fc/go.mod h1:vavhavw2zAxS5dIdcRluK6cSGGPlZynqzFM8NdvU144= +github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad h1:a6HEuzUHeKH6hwfN/ZoQgRgVIWFJljSWa/zetS2WTvg= +github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad/go.mod h1:vavhavw2zAxS5dIdcRluK6cSGGPlZynqzFM8NdvU144= github.com/google/renameio v0.1.0/go.mod h1:KWCgfxg9yswjAJkECMjeO8J8rahYeXnNhOm40UhjYkI= github.com/google/uuid v1.1.2/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/google/uuid v1.6.0 h1:NIvaJDMOsjHA8n1jAhLSgzrAzy1Hgr+hNrb57e+94F0= @@ -461,8 +459,8 @@ github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+o github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= github.com/klauspost/cpuid/v2 v2.0.10/go.mod h1:g2LTdtYhdyuGPqyWyv7qRAmj1WBqxuObKfj5c0PQa7c= github.com/klauspost/cpuid/v2 v2.0.12/go.mod h1:g2LTdtYhdyuGPqyWyv7qRAmj1WBqxuObKfj5c0PQa7c= -github.com/klauspost/cpuid/v2 v2.2.8 h1:+StwCXwm9PdpiEkPyzBXIy+M9KUb4ODm0Zarf1kS5BM= -github.com/klauspost/cpuid/v2 v2.2.8/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= +github.com/klauspost/cpuid/v2 v2.2.9 h1:66ze0taIn2H33fBvCkXuv9BmCwDfafmiIVpKV9kKGuY= +github.com/klauspost/cpuid/v2 v2.2.9/go.mod h1:rqkxqrZ1EhYM9G+hXH7YdowN5R5RGN6NK4QwQ3WMXF8= github.com/klauspost/reedsolomon v1.12.4 h1:5aDr3ZGoJbgu/8+j45KtUJxzYm8k08JGtB9Wx1VQ4OA= github.com/klauspost/reedsolomon v1.12.4/go.mod h1:d3CzOMOt0JXGIFZm1StgkyF14EYr3xneR2rNWo7NcMU= github.com/knz/go-libedit v1.10.1/go.mod h1:MZTVkCWyz0oBc7JOWP3wNAzd002ZbM/5hgShxwh4x8M= @@ -544,10 +542,10 @@ github.com/nxadm/tail v1.4.8 h1:nPr65rt6Y5JFSKQO7qToXr7pePgD6Gwiw05lkbyAQTE= github.com/nxadm/tail v1.4.8/go.mod h1:+ncqLTQzXmGhMZNUePPaPqPvBxHAIsmXswZKocGu+AU= github.com/onsi/ginkgo v1.16.5 h1:8xi0RTUf59SOSfEtZMvwTvXYMzG4gV23XVHOZiXNtnE= github.com/onsi/ginkgo v1.16.5/go.mod h1:+E8gABHa3K6zRBolWtd+ROzc/U5bkGt0FwiG042wbpU= -github.com/onsi/ginkgo/v2 v2.20.2 h1:7NVCeyIWROIAheY21RLS+3j2bb52W0W82tkberYytp4= -github.com/onsi/ginkgo/v2 v2.20.2/go.mod h1:K9gyxPIlb+aIvnZ8bd9Ak+YP18w3APlR+5coaZoE2ag= -github.com/onsi/gomega v1.34.1 h1:EUMJIKUjM8sKjYbtxQI9A4z2o+rruxnzNvpknOXie6k= -github.com/onsi/gomega v1.34.1/go.mod h1:kU1QgUvBDLXBJq618Xvm2LUX6rSAfRaFRTcdOeDLwwY= +github.com/onsi/ginkgo/v2 v2.22.0 h1:Yed107/8DjTr0lKCNt7Dn8yQ6ybuDRQoMGrNFKzMfHg= +github.com/onsi/ginkgo/v2 v2.22.0/go.mod h1:7Du3c42kxCUegi0IImZ1wUQzMBVecgIHjR1C+NkhLQo= +github.com/onsi/gomega v1.34.2 h1:pNCwDkzrsv7MS9kpaQvVb1aVLahQXyJ/Tv5oAZMI3i8= +github.com/onsi/gomega v1.34.2/go.mod h1:v1xfxRgk0KIsG+QOdm7p8UosrOzPYRo60fd3B/1Dukc= github.com/orandin/lumberjackrus v1.0.1 h1:7ysDQ0MHD79zIFN9/EiDHjUcgopNi5ehtxFDy8rUkWo= github.com/orandin/lumberjackrus v1.0.1/go.mod h1:xYLt6H8W93pKnQgUQaxsApS0Eb4BwHLOkxk5DVzf5H0= github.com/pascaldekloe/goe v0.0.0-20180627143212-57f6aae5913c/go.mod h1:lzWF7FIEvWOWxwDKqyGYQf6ZUaNfKdP144TG7ZOy1lc= @@ -595,8 +593,8 @@ github.com/pterm/pterm v0.12.36/go.mod h1:NjiL09hFhT/vWjQHSj1athJpx6H8cjpHXNAK5b github.com/pterm/pterm v0.12.40/go.mod h1:ffwPLwlbXxP+rxT0GsgDTzS3y3rmpAO1NMjUkGTYf8s= github.com/pterm/pterm v0.12.79 h1:lH3yrYMhdpeqX9y5Ep1u7DejyHy7NSQg9qrBjF9dFT4= github.com/pterm/pterm v0.12.79/go.mod h1:1v/gzOF1N0FsjbgTHZ1wVycRkKiatFvJSJC4IGaQAAo= -github.com/quic-go/quic-go v0.48.0 h1:2TCyvBrMu1Z25rvIAlnp2dPT4lgh/uTqLqiXVpp5AeU= -github.com/quic-go/quic-go v0.48.0/go.mod h1:yBgs3rWBOADpga7F+jJsb6Ybg1LSYiQvwWlLX+/6HMs= +github.com/quic-go/quic-go v0.48.2 h1:wsKXZPeGWpMpCGSWqOcqpW2wZYic/8T3aqiOID0/KWE= +github.com/quic-go/quic-go v0.48.2/go.mod h1:yBgs3rWBOADpga7F+jJsb6Ybg1LSYiQvwWlLX+/6HMs= github.com/rivo/uniseg v0.1.0/go.mod h1:J6wj4VEh+S6ZtnVlnTBMWIodfgj8LQOQFoIToxlJtxc= github.com/rivo/uniseg v0.2.0/go.mod h1:J6wj4VEh+S6ZtnVlnTBMWIodfgj8LQOQFoIToxlJtxc= github.com/rivo/uniseg v0.4.7 h1:WUdvkW8uEhrYfLC4ZzdpI2ztxP1I582+49Oc5Mq64VQ= @@ -629,18 +627,18 @@ github.com/sirupsen/logrus v1.6.0/go.mod h1:7uNnSEd1DgxDLC74fIahvMZmmYsHGZGEOFrf github.com/sirupsen/logrus v1.9.0/go.mod h1:naHLuLoDiP4jHNo9R0sCBMtWGeIprob74mVsIT4qYEQ= github.com/sirupsen/logrus v1.9.3 h1:dueUQJ1C2q9oE3F7wvmSGAaVtTmUizReu6fjN8uqzbQ= github.com/sirupsen/logrus v1.9.3/go.mod h1:naHLuLoDiP4jHNo9R0sCBMtWGeIprob74mVsIT4qYEQ= -github.com/skycoin/dmsg v1.3.29-0.20241217193208-d32ec623e670 h1:4RUr5DtDwsvpT6NIgRsWy6zffiljW42aP3PsEBBazhc= -github.com/skycoin/dmsg v1.3.29-0.20241217193208-d32ec623e670/go.mod h1:BU69yZysa088J/wV+9Z2Kbwq4Auup2tcvFiAlEle74M= +github.com/skycoin/dmsg v1.3.29-0.20241218010226-56d92f2ef624 h1:QGQBG2XnVdCUa/n2G9Yw5HHASkoEShSirHNsGCnr+Is= +github.com/skycoin/dmsg v1.3.29-0.20241218010226-56d92f2ef624/go.mod h1:SkVfpDNf4O1D2QcOJ4uG/0AQ8Cs1M5dUD49Xndi5Jig= github.com/skycoin/encodertest v0.0.0-20190217072920-14c2e31898b9 h1:DElGw1Fhj4amuW1KM5q8Xowosb3RiOQce0lDJw0Qv0Y= github.com/skycoin/encodertest v0.0.0-20190217072920-14c2e31898b9/go.mod h1:OQz8NXVJUWEw7PWYASZ/1BIw5GXgVMTGvrCGDlZa9+k= github.com/skycoin/noise v0.0.0-20180327030543-2492fe189ae6 h1:1Nc5EBY6pjfw1kwW0duwyG+7WliWz5u9kgk1h5MnLuA= github.com/skycoin/noise v0.0.0-20180327030543-2492fe189ae6/go.mod h1:UXghlricA7J3aRD/k7p/zBObQfmBawwCxIVPVjz2Q3o= github.com/skycoin/skycoin v0.28.1-0.20241105130348-39b49a2d0a7f h1:isCGulVHahQfFoS37B7JT3rb8n4Ih2o9oMg2p25D7o8= github.com/skycoin/skycoin v0.28.1-0.20241105130348-39b49a2d0a7f/go.mod h1:1iZLomiHUOEvmJaBNrzE+Tllf09uhrCZ5JLL3cHdKKQ= -github.com/skycoin/skycoin-service-discovery v1.3.29-0.20241217194518-634b05d94b2e h1:0IknW9LPP0Ct7aIzG3K9mR90txhe4KkNLrO6AaIgkU4= -github.com/skycoin/skycoin-service-discovery v1.3.29-0.20241217194518-634b05d94b2e/go.mod h1:nRAM1h+k3TPe22Ga5wwKqM2ZLzoYuobD9K+f5GT6aEM= -github.com/skycoin/skywire-services v1.3.29-0.20241217194941-6269f3c618c3 h1:p+0xzdepWJw0yzsj0XHGpuQV1ooscGUjDm5wRuC3Q6o= -github.com/skycoin/skywire-services v1.3.29-0.20241217194941-6269f3c618c3/go.mod h1:AxxX+4dxIU/NGNFFzi5z4dXGEADlVEb0FXJdLKEp5QY= +github.com/skycoin/skycoin-service-discovery v1.3.29-0.20241218011239-6f6be8edf287 h1:kHeaZh8XW6hTO13kLEf0fDa+NMfdttwem4To57+qSZM= +github.com/skycoin/skycoin-service-discovery v1.3.29-0.20241218011239-6f6be8edf287/go.mod h1:yGXTOKxQrdGcGt7nRSqHhMVgZBvJ2gXhdMNgbw93OtY= +github.com/skycoin/skywire-services v1.3.29-0.20241218011810-0e3f3a797af4 h1:d2V0uXLNUJXuNxG604rjm8lvjpzvX/5Qi8axoeg5U0I= +github.com/skycoin/skywire-services v1.3.29-0.20241218011810-0e3f3a797af4/go.mod h1:u3Pq6EClErGL260fkj67sezx6b8e0Efdl7FZPiuqYrE= github.com/skycoin/systray v1.10.0 h1:fQZJHMylpVvfmOOTLvUssfyHVDoC8Idx6Ba2BlLEuGg= github.com/skycoin/systray v1.10.0/go.mod h1:/i17Eni5GxFiboIZceeamY5LktDSFFRCvd3fBMerQ+4= github.com/songgao/water v0.0.0-20200317203138-2b4b6d7c09d8 h1:TG/diQgUe0pntT/2D9tmUCz4VNwm9MfrtPr0SU2qSX8= @@ -679,8 +677,8 @@ github.com/stretchr/testify v1.7.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/ github.com/stretchr/testify v1.7.5/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU= github.com/stretchr/testify v1.8.0/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU= github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= -github.com/stretchr/testify v1.9.0 h1:HtqpIVDClZ4nwg75+f6Lvsy/wHu+3BoSGCbBAcpTsTg= -github.com/stretchr/testify v1.9.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY= +github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA= +github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY= github.com/subosito/gotenv v1.4.1/go.mod h1:ayKnFf/c6rvx/2iiLrJUk1e6plDbT3edrFNGqEflhK0= github.com/subosito/gotenv v1.6.0 h1:9NlTDc1FTs4qu0DDq7AEtTPNw6SVm7uBMsUCUjABIf8= github.com/subosito/gotenv v1.6.0/go.mod h1:Dk4QP5c2W3ibzajGcXpNraDfq2IrhjMIvMSWPKKo0FU= @@ -757,8 +755,8 @@ golang.org/x/crypto v0.0.0-20210421170649-83a5a9bb288b/go.mod h1:T9bdIzuCu7OtxOm golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.0.0-20211108221036-ceb1ce70b4fa/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.0.0-20220411220226-7b82a4e95df4/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4= -golang.org/x/crypto v0.28.0 h1:GBDwsMXVQi34v5CCYUm2jkJvu4cbtru2U4TN2PSyQnw= -golang.org/x/crypto v0.28.0/go.mod h1:rmgy+3RHxRZMyY0jjAJShp2zgEdOqj2AO7U0pYmeQ7U= +golang.org/x/crypto v0.31.0 h1:ihbySMvVjLAeSH1IbfcRTkD/iNscyz8rGzjF/E5hV6U= +golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk= golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190306152737-a1d7652674e8/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190510132918-efd6b22b2522/go.mod h1:ZjyILWgesfNpC6sMxTJOJm9Kp84zZh5NQWvqDGG3Qr8= @@ -769,8 +767,8 @@ golang.org/x/exp v0.0.0-20191227195350-da58074b4299/go.mod h1:2RIsYlXP63K8oxa1u0 golang.org/x/exp v0.0.0-20200119233911-0405dc783f0a/go.mod h1:2RIsYlXP63K8oxa1u096TMicItID8zy7Y6sNkU49FU4= golang.org/x/exp v0.0.0-20200207192155-f17229e696bd/go.mod h1:J/WKrq2StrnmMY6+EHIKF9dgMWnmCNThgcyBT1FY9mM= golang.org/x/exp v0.0.0-20200224162631-6cc2880d07d6/go.mod h1:3jZMyOhIsHpP37uCMkUooju7aAi5cS1Q23tOzKc+0MU= -golang.org/x/exp v0.0.0-20241009180824-f66d83c29e7c h1:7dEasQXItcW1xKJ2+gg5VOiBnqWrJc+rq0DPKyvvdbY= -golang.org/x/exp v0.0.0-20241009180824-f66d83c29e7c/go.mod h1:NQtJDoLvd6faHhE7m4T/1IY708gDefGGjR/iUW8yQQ8= +golang.org/x/exp v0.0.0-20241217172543-b2144cdd0a67 h1:1UoZQm6f0P/ZO0w1Ri+f+ifG/gXhegadRdwBIXEFWDo= +golang.org/x/exp v0.0.0-20241217172543-b2144cdd0a67/go.mod h1:qj5a5QZpwLU2NLQudwIN5koi3beDhSAlJwa67PuM98c= golang.org/x/image v0.0.0-20190227222117-0694c2d4d067/go.mod h1:kZ7UVZpmo3dzQBMxlp+ypCbDeSB+sBbTgSJuh5dn5js= golang.org/x/image v0.0.0-20190802002840-cff245a6509b/go.mod h1:FeLwcggjj3mMvU+oOTbSwawSJRM1uh48EjtB4UJZlP0= golang.org/x/image v0.0.0-20191009234506-e7c1f5e7dbb8/go.mod h1:FeLwcggjj3mMvU+oOTbSwawSJRM1uh48EjtB4UJZlP0= @@ -803,8 +801,8 @@ golang.org/x/mod v0.4.2/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4= golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= golang.org/x/mod v0.10.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= -golang.org/x/mod v0.21.0 h1:vvrHzRwRfVKSiLrG+d4FMl/Qi4ukBCE6kZlTUkDYRT0= -golang.org/x/mod v0.21.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY= +golang.org/x/mod v0.22.0 h1:D4nJWe9zXqHOmWqj4VMOJhvzj7bEZg4wEYa759z1pH4= +golang.org/x/mod v0.22.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY= golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20180826012351-8a410e7b638d/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20181114220301-adae6a3d119a/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= @@ -857,8 +855,8 @@ golang.org/x/net v0.0.0-20220520000938-2e3eb7b945c2/go.mod h1:CfG3xpIq0wQ8r1q4Su golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c= golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs= golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg= -golang.org/x/net v0.30.0 h1:AcW1SDZMkb8IpzCdQUaIq2sP4sZ4zw+55h6ynffypl4= -golang.org/x/net v0.30.0/go.mod h1:2wGyMJ5iFasEhkwi13ChkO/t1ECNC4X4eBKkVFyYFlU= +golang.org/x/net v0.32.0 h1:ZqPmj8Kzc+Y6e0+skZsuACbx+wzMgo5MQsJh9Qd6aYI= +golang.org/x/net v0.32.0/go.mod h1:CwU0IoeOlnQQWJ6ioyFrfRuomB8GKF6KbYXZVyeXNfs= golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= @@ -894,8 +892,8 @@ golang.org/x/sync v0.0.0-20220513210516-0976fa681c29/go.mod h1:RxMgew5VJxzue5/jJ golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.2.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= -golang.org/x/sync v0.8.0 h1:3NFvSEYkUoMifnESzZl15y791HH1qU2xm6eCJU5ZPXQ= -golang.org/x/sync v0.8.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk= +golang.org/x/sync v0.10.0 h1:3NQrjDixjgGwUOCaF8w2+VYHv0Ve/vGYSbdkTa98gmQ= +golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk= golang.org/x/sys v0.0.0-20180823144017-11551d06cbcc/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20180830151530-49385e6e1522/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20180905080454-ebe1bf3edb33/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= @@ -986,16 +984,16 @@ golang.org/x/sys v0.1.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.26.0 h1:KHjCJyddX0LoSTb3J+vWpupP9p0oznkqVk/IfjymZbo= -golang.org/x/sys v0.26.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= +golang.org/x/sys v0.28.0 h1:Fksou7UEQUWlKvIdsqzJmUmCX3cZuD2+P3XyyzwMhlA= +golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210220032956-6a3ed077a48d/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210615171337-6886f2dfbf5b/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k= golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo= -golang.org/x/term v0.25.0 h1:WtHI/ltw4NvSUig5KARz9h521QvRC8RmF/cuYqifU24= -golang.org/x/term v0.25.0/go.mod h1:RPyXicDX+6vLxogjjRxjgD2TKtmAO6NZBsBRfrOLu7M= +golang.org/x/term v0.27.0 h1:WP60Sv1nlK1T6SupCHbXzSaN0b9wUmsPoRS9b61A23Q= +golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM= golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= @@ -1007,8 +1005,8 @@ golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= -golang.org/x/text v0.19.0 h1:kTxAhCbGbxhK0IwgSKiMO5awPoDQ0RpfiVYBfK860YM= -golang.org/x/text v0.19.0/go.mod h1:BuEKDfySbSR4drPmRPG/7iBdf8hvFMuRexcpahXilzY= +golang.org/x/text v0.21.0 h1:zyQAAkrwaneQ066sspRyJaG9VNi/YJ1NfzcGB3hZ/qo= +golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ= golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20191024005414-555d28b269f0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= @@ -1072,8 +1070,8 @@ golang.org/x/tools v0.1.5/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk= golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc= golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU= golang.org/x/tools v0.9.1/go.mod h1:owI94Op576fPu3cIGQeHs3joujW/2Oc6MtlxbF5dfNc= -golang.org/x/tools v0.26.0 h1:v/60pFQmzmT9ExmjDv2gGIfi3OqfKoEP6I5+umXlbnQ= -golang.org/x/tools v0.26.0/go.mod h1:TPVVj70c7JJ3WCazhD8OdXcZg/og+b9+tH/KxylGwH0= +golang.org/x/tools v0.28.0 h1:WuB6qZ4RPCQo5aP3WdKZS7i595EdWqWR8vqJTlwTVK8= +golang.org/x/tools v0.28.0/go.mod h1:dcIOrVd3mfQKTgrDVQHqCPMWy6lnhfhtX3hLXYVLfRw= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= @@ -1283,8 +1281,8 @@ gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= -gorm.io/driver/postgres v1.5.9 h1:DkegyItji119OlcaLjqN11kHoUgZ/j13E0jkJZgD6A8= -gorm.io/driver/postgres v1.5.9/go.mod h1:DX3GReXH+3FPWGrrgffdvCk3DQ1dwDPdmbenSkweRGI= +gorm.io/driver/postgres v1.5.11 h1:ubBVAfbKEUld/twyKZ0IYn9rSQh448EdelLYk9Mv314= +gorm.io/driver/postgres v1.5.11/go.mod h1:DX3GReXH+3FPWGrrgffdvCk3DQ1dwDPdmbenSkweRGI= gorm.io/gorm v1.25.12 h1:I0u8i2hWQItBq1WfE0o2+WuL9+8L21K9e2HHSTE/0f8= gorm.io/gorm v1.25.12/go.mod h1:xh7N7RHfYlNc5EmcI/El95gXusucDrQnHXe0+CgWcLQ= gvisor.dev/gvisor v0.0.0-20230927004350-cbd86285d259 h1:TbRPT0HtzFP3Cno1zZo7yPzEEnfu8EjLfl6IU9VfqkQ= diff --git a/vendor/github.com/go-chi/chi/.gitignore b/vendor/github.com/go-chi/chi/.gitignore deleted file mode 100644 index ba22c99a99..0000000000 --- a/vendor/github.com/go-chi/chi/.gitignore +++ /dev/null @@ -1,3 +0,0 @@ -.idea -*.sw? -.vscode diff --git a/vendor/github.com/go-chi/chi/.travis.yml b/vendor/github.com/go-chi/chi/.travis.yml deleted file mode 100644 index 7b8e26bcee..0000000000 --- a/vendor/github.com/go-chi/chi/.travis.yml +++ /dev/null @@ -1,20 +0,0 @@ -language: go - -go: - - 1.10.x - - 1.11.x - - 1.12.x - - 1.13.x - - 1.14.x - -script: - - go get -d -t ./... - - go vet ./... - - go test ./... - - > - go_version=$(go version); - if [ ${go_version:13:4} = "1.12" ]; then - go get -u golang.org/x/tools/cmd/goimports; - goimports -d -e ./ | grep '.*' && { echo; echo "Aborting due to non-empty goimports output."; exit 1; } || :; - fi - diff --git a/vendor/github.com/go-chi/chi/CHANGELOG.md b/vendor/github.com/go-chi/chi/CHANGELOG.md deleted file mode 100644 index 9a64a72eec..0000000000 --- a/vendor/github.com/go-chi/chi/CHANGELOG.md +++ /dev/null @@ -1,190 +0,0 @@ -# Changelog - -## v4.1.2 (2020-06-02) - -- fix that handles MethodNotAllowed with path variables, thank you @caseyhadden for your contribution -- fix to replace nested wildcards correctly in RoutePattern, thank you @@unmultimedio for your contribution -- History of changes: see https://github.com/go-chi/chi/compare/v4.1.1...v4.1.2 - - -## v4.1.1 (2020-04-16) - -- fix for issue https://github.com/go-chi/chi/issues/411 which allows for overlapping regexp - route to the correct handler through a recursive tree search, thanks to @Jahaja for the PR/fix! -- new middleware.RouteHeaders as a simple router for request headers with wildcard support -- History of changes: see https://github.com/go-chi/chi/compare/v4.1.0...v4.1.1 - - -## v4.1.0 (2020-04-1) - -- middleware.LogEntry: Write method on interface now passes the response header - and an extra interface type useful for custom logger implementations. -- middleware.WrapResponseWriter: minor fix -- middleware.Recoverer: a bit prettier -- History of changes: see https://github.com/go-chi/chi/compare/v4.0.4...v4.1.0 - - -## v4.0.4 (2020-03-24) - -- middleware.Recoverer: new pretty stack trace printing (https://github.com/go-chi/chi/pull/496) -- a few minor improvements and fixes -- History of changes: see https://github.com/go-chi/chi/compare/v4.0.3...v4.0.4 - - -## v4.0.3 (2020-01-09) - -- core: fix regexp routing to include default value when param is not matched -- middleware: rewrite of middleware.Compress -- middleware: suppress http.ErrAbortHandler in middleware.Recoverer -- History of changes: see https://github.com/go-chi/chi/compare/v4.0.2...v4.0.3 - - -## v4.0.2 (2019-02-26) - -- Minor fixes -- History of changes: see https://github.com/go-chi/chi/compare/v4.0.1...v4.0.2 - - -## v4.0.1 (2019-01-21) - -- Fixes issue with compress middleware: #382 #385 -- History of changes: see https://github.com/go-chi/chi/compare/v4.0.0...v4.0.1 - - -## v4.0.0 (2019-01-10) - -- chi v4 requires Go 1.10.3+ (or Go 1.9.7+) - we have deprecated support for Go 1.7 and 1.8 -- router: respond with 404 on router with no routes (#362) -- router: additional check to ensure wildcard is at the end of a url pattern (#333) -- middleware: deprecate use of http.CloseNotifier (#347) -- middleware: fix RedirectSlashes to include query params on redirect (#334) -- History of changes: see https://github.com/go-chi/chi/compare/v3.3.4...v4.0.0 - - -## v3.3.4 (2019-01-07) - -- Minor middleware improvements. No changes to core library/router. Moving v3 into its -- own branch as a version of chi for Go 1.7, 1.8, 1.9, 1.10, 1.11 -- History of changes: see https://github.com/go-chi/chi/compare/v3.3.3...v3.3.4 - - -## v3.3.3 (2018-08-27) - -- Minor release -- See https://github.com/go-chi/chi/compare/v3.3.2...v3.3.3 - - -## v3.3.2 (2017-12-22) - -- Support to route trailing slashes on mounted sub-routers (#281) -- middleware: new `ContentCharset` to check matching charsets. Thank you - @csucu for your community contribution! - - -## v3.3.1 (2017-11-20) - -- middleware: new `AllowContentType` handler for explicit whitelist of accepted request Content-Types -- middleware: new `SetHeader` handler for short-hand middleware to set a response header key/value -- Minor bug fixes - - -## v3.3.0 (2017-10-10) - -- New chi.RegisterMethod(method) to add support for custom HTTP methods, see _examples/custom-method for usage -- Deprecated LINK and UNLINK methods from the default list, please use `chi.RegisterMethod("LINK")` and `chi.RegisterMethod("UNLINK")` in an `init()` function - - -## v3.2.1 (2017-08-31) - -- Add new `Match(rctx *Context, method, path string) bool` method to `Routes` interface - and `Mux`. Match searches the mux's routing tree for a handler that matches the method/path -- Add new `RouteMethod` to `*Context` -- Add new `Routes` pointer to `*Context` -- Add new `middleware.GetHead` to route missing HEAD requests to GET handler -- Updated benchmarks (see README) - - -## v3.1.5 (2017-08-02) - -- Setup golint and go vet for the project -- As per golint, we've redefined `func ServerBaseContext(h http.Handler, baseCtx context.Context) http.Handler` - to `func ServerBaseContext(baseCtx context.Context, h http.Handler) http.Handler` - - -## v3.1.0 (2017-07-10) - -- Fix a few minor issues after v3 release -- Move `docgen` sub-pkg to https://github.com/go-chi/docgen -- Move `render` sub-pkg to https://github.com/go-chi/render -- Add new `URLFormat` handler to chi/middleware sub-pkg to make working with url mime - suffixes easier, ie. parsing `/articles/1.json` and `/articles/1.xml`. See comments in - https://github.com/go-chi/chi/blob/master/middleware/url_format.go for example usage. - - -## v3.0.0 (2017-06-21) - -- Major update to chi library with many exciting updates, but also some *breaking changes* -- URL parameter syntax changed from `/:id` to `/{id}` for even more flexible routing, such as - `/articles/{month}-{day}-{year}-{slug}`, `/articles/{id}`, and `/articles/{id}.{ext}` on the - same router -- Support for regexp for routing patterns, in the form of `/{paramKey:regExp}` for example: - `r.Get("/articles/{name:[a-z]+}", h)` and `chi.URLParam(r, "name")` -- Add `Method` and `MethodFunc` to `chi.Router` to allow routing definitions such as - `r.Method("GET", "/", h)` which provides a cleaner interface for custom handlers like - in `_examples/custom-handler` -- Deprecating `mux#FileServer` helper function. Instead, we encourage users to create their - own using file handler with the stdlib, see `_examples/fileserver` for an example -- Add support for LINK/UNLINK http methods via `r.Method()` and `r.MethodFunc()` -- Moved the chi project to its own organization, to allow chi-related community packages to - be easily discovered and supported, at: https://github.com/go-chi -- *NOTE:* please update your import paths to `"github.com/go-chi/chi"` -- *NOTE:* chi v2 is still available at https://github.com/go-chi/chi/tree/v2 - - -## v2.1.0 (2017-03-30) - -- Minor improvements and update to the chi core library -- Introduced a brand new `chi/render` sub-package to complete the story of building - APIs to offer a pattern for managing well-defined request / response payloads. Please - check out the updated `_examples/rest` example for how it works. -- Added `MethodNotAllowed(h http.HandlerFunc)` to chi.Router interface - - -## v2.0.0 (2017-01-06) - -- After many months of v2 being in an RC state with many companies and users running it in - production, the inclusion of some improvements to the middlewares, we are very pleased to - announce v2.0.0 of chi. - - -## v2.0.0-rc1 (2016-07-26) - -- Huge update! chi v2 is a large refactor targetting Go 1.7+. As of Go 1.7, the popular - community `"net/context"` package has been included in the standard library as `"context"` and - utilized by `"net/http"` and `http.Request` to managing deadlines, cancelation signals and other - request-scoped values. We're very excited about the new context addition and are proud to - introduce chi v2, a minimal and powerful routing package for building large HTTP services, - with zero external dependencies. Chi focuses on idiomatic design and encourages the use of - stdlib HTTP handlers and middlwares. -- chi v2 deprecates its `chi.Handler` interface and requires `http.Handler` or `http.HandlerFunc` -- chi v2 stores URL routing parameters and patterns in the standard request context: `r.Context()` -- chi v2 lower-level routing context is accessible by `chi.RouteContext(r.Context()) *chi.Context`, - which provides direct access to URL routing parameters, the routing path and the matching - routing patterns. -- Users upgrading from chi v1 to v2, need to: - 1. Update the old chi.Handler signature, `func(ctx context.Context, w http.ResponseWriter, r *http.Request)` to - the standard http.Handler: `func(w http.ResponseWriter, r *http.Request)` - 2. Use `chi.URLParam(r *http.Request, paramKey string) string` - or `URLParamFromCtx(ctx context.Context, paramKey string) string` to access a url parameter value - - -## v1.0.0 (2016-07-01) - -- Released chi v1 stable https://github.com/go-chi/chi/tree/v1.0.0 for Go 1.6 and older. - - -## v0.9.0 (2016-03-31) - -- Reuse context objects via sync.Pool for zero-allocation routing [#33](https://github.com/go-chi/chi/pull/33) -- BREAKING NOTE: due to subtle API changes, previously `chi.URLParams(ctx)["id"]` used to access url parameters - has changed to: `chi.URLParam(ctx, "id")` diff --git a/vendor/github.com/go-chi/chi/CONTRIBUTING.md b/vendor/github.com/go-chi/chi/CONTRIBUTING.md deleted file mode 100644 index c0ac2dfe85..0000000000 --- a/vendor/github.com/go-chi/chi/CONTRIBUTING.md +++ /dev/null @@ -1,31 +0,0 @@ -# Contributing - -## Prerequisites - -1. [Install Go][go-install]. -2. Download the sources and switch the working directory: - - ```bash - go get -u -d github.com/go-chi/chi - cd $GOPATH/src/github.com/go-chi/chi - ``` - -## Submitting a Pull Request - -A typical workflow is: - -1. [Fork the repository.][fork] [This tip maybe also helpful.][go-fork-tip] -2. [Create a topic branch.][branch] -3. Add tests for your change. -4. Run `go test`. If your tests pass, return to the step 3. -5. Implement the change and ensure the steps from the previous step pass. -6. Run `goimports -w .`, to ensure the new code conforms to Go formatting guideline. -7. [Add, commit and push your changes.][git-help] -8. [Submit a pull request.][pull-req] - -[go-install]: https://golang.org/doc/install -[go-fork-tip]: http://blog.campoy.cat/2014/03/github-and-go-forking-pull-requests-and.html -[fork]: https://help.github.com/articles/fork-a-repo -[branch]: http://learn.github.com/p/branching.html -[git-help]: https://guides.github.com -[pull-req]: https://help.github.com/articles/using-pull-requests diff --git a/vendor/github.com/go-chi/chi/LICENSE b/vendor/github.com/go-chi/chi/LICENSE deleted file mode 100644 index d99f02ffac..0000000000 --- a/vendor/github.com/go-chi/chi/LICENSE +++ /dev/null @@ -1,20 +0,0 @@ -Copyright (c) 2015-present Peter Kieltyka (https://github.com/pkieltyka), Google Inc. - -MIT License - -Permission is hereby granted, free of charge, to any person obtaining a copy of -this software and associated documentation files (the "Software"), to deal in -the Software without restriction, including without limitation the rights to -use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of -the Software, and to permit persons to whom the Software is furnished to do so, -subject to the following conditions: - -The above copyright notice and this permission notice shall be included in all -copies or substantial portions of the Software. - -THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS -FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR -COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER -IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN -CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. diff --git a/vendor/github.com/go-chi/chi/README.md b/vendor/github.com/go-chi/chi/README.md deleted file mode 100644 index 5a8fc9d096..0000000000 --- a/vendor/github.com/go-chi/chi/README.md +++ /dev/null @@ -1,441 +0,0 @@ -# chi - - -[![GoDoc Widget]][GoDoc] [![Travis Widget]][Travis] - -`chi` is a lightweight, idiomatic and composable router for building Go HTTP services. It's -especially good at helping you write large REST API services that are kept maintainable as your -project grows and changes. `chi` is built on the new `context` package introduced in Go 1.7 to -handle signaling, cancelation and request-scoped values across a handler chain. - -The focus of the project has been to seek out an elegant and comfortable design for writing -REST API servers, written during the development of the Pressly API service that powers our -public API service, which in turn powers all of our client-side applications. - -The key considerations of chi's design are: project structure, maintainability, standard http -handlers (stdlib-only), developer productivity, and deconstructing a large system into many small -parts. The core router `github.com/go-chi/chi` is quite small (less than 1000 LOC), but we've also -included some useful/optional subpackages: [middleware](/middleware), [render](https://github.com/go-chi/render) and [docgen](https://github.com/go-chi/docgen). We hope you enjoy it too! - -## Install - -`go get -u github.com/go-chi/chi` - - -## Features - -* **Lightweight** - cloc'd in ~1000 LOC for the chi router -* **Fast** - yes, see [benchmarks](#benchmarks) -* **100% compatible with net/http** - use any http or middleware pkg in the ecosystem that is also compatible with `net/http` -* **Designed for modular/composable APIs** - middlewares, inline middlewares, route groups and subrouter mounting -* **Context control** - built on new `context` package, providing value chaining, cancellations and timeouts -* **Robust** - in production at Pressly, CloudFlare, Heroku, 99Designs, and many others (see [discussion](https://github.com/go-chi/chi/issues/91)) -* **Doc generation** - `docgen` auto-generates routing documentation from your source to JSON or Markdown -* **No external dependencies** - plain ol' Go stdlib + net/http - - -## Examples - -See [_examples/](https://github.com/go-chi/chi/blob/master/_examples/) for a variety of examples. - - -**As easy as:** - -```go -package main - -import ( - "net/http" - - "github.com/go-chi/chi" - "github.com/go-chi/chi/middleware" -) - -func main() { - r := chi.NewRouter() - r.Use(middleware.Logger) - r.Get("/", func(w http.ResponseWriter, r *http.Request) { - w.Write([]byte("welcome")) - }) - http.ListenAndServe(":3000", r) -} -``` - -**REST Preview:** - -Here is a little preview of how routing looks like with chi. Also take a look at the generated routing docs -in JSON ([routes.json](https://github.com/go-chi/chi/blob/master/_examples/rest/routes.json)) and in -Markdown ([routes.md](https://github.com/go-chi/chi/blob/master/_examples/rest/routes.md)). - -I highly recommend reading the source of the [examples](https://github.com/go-chi/chi/blob/master/_examples/) listed -above, they will show you all the features of chi and serve as a good form of documentation. - -```go -import ( - //... - "context" - "github.com/go-chi/chi" - "github.com/go-chi/chi/middleware" -) - -func main() { - r := chi.NewRouter() - - // A good base middleware stack - r.Use(middleware.RequestID) - r.Use(middleware.RealIP) - r.Use(middleware.Logger) - r.Use(middleware.Recoverer) - - // Set a timeout value on the request context (ctx), that will signal - // through ctx.Done() that the request has timed out and further - // processing should be stopped. - r.Use(middleware.Timeout(60 * time.Second)) - - r.Get("/", func(w http.ResponseWriter, r *http.Request) { - w.Write([]byte("hi")) - }) - - // RESTy routes for "articles" resource - r.Route("/articles", func(r chi.Router) { - r.With(paginate).Get("/", listArticles) // GET /articles - r.With(paginate).Get("/{month}-{day}-{year}", listArticlesByDate) // GET /articles/01-16-2017 - - r.Post("/", createArticle) // POST /articles - r.Get("/search", searchArticles) // GET /articles/search - - // Regexp url parameters: - r.Get("/{articleSlug:[a-z-]+}", getArticleBySlug) // GET /articles/home-is-toronto - - // Subrouters: - r.Route("/{articleID}", func(r chi.Router) { - r.Use(ArticleCtx) - r.Get("/", getArticle) // GET /articles/123 - r.Put("/", updateArticle) // PUT /articles/123 - r.Delete("/", deleteArticle) // DELETE /articles/123 - }) - }) - - // Mount the admin sub-router - r.Mount("/admin", adminRouter()) - - http.ListenAndServe(":3333", r) -} - -func ArticleCtx(next http.Handler) http.Handler { - return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { - articleID := chi.URLParam(r, "articleID") - article, err := dbGetArticle(articleID) - if err != nil { - http.Error(w, http.StatusText(404), 404) - return - } - ctx := context.WithValue(r.Context(), "article", article) - next.ServeHTTP(w, r.WithContext(ctx)) - }) -} - -func getArticle(w http.ResponseWriter, r *http.Request) { - ctx := r.Context() - article, ok := ctx.Value("article").(*Article) - if !ok { - http.Error(w, http.StatusText(422), 422) - return - } - w.Write([]byte(fmt.Sprintf("title:%s", article.Title))) -} - -// A completely separate router for administrator routes -func adminRouter() http.Handler { - r := chi.NewRouter() - r.Use(AdminOnly) - r.Get("/", adminIndex) - r.Get("/accounts", adminListAccounts) - return r -} - -func AdminOnly(next http.Handler) http.Handler { - return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { - ctx := r.Context() - perm, ok := ctx.Value("acl.permission").(YourPermissionType) - if !ok || !perm.IsAdmin() { - http.Error(w, http.StatusText(403), 403) - return - } - next.ServeHTTP(w, r) - }) -} -``` - - -## Router design - -chi's router is based on a kind of [Patricia Radix trie](https://en.wikipedia.org/wiki/Radix_tree). -The router is fully compatible with `net/http`. - -Built on top of the tree is the `Router` interface: - -```go -// Router consisting of the core routing methods used by chi's Mux, -// using only the standard net/http. -type Router interface { - http.Handler - Routes - - // Use appends one or more middlewares onto the Router stack. - Use(middlewares ...func(http.Handler) http.Handler) - - // With adds inline middlewares for an endpoint handler. - With(middlewares ...func(http.Handler) http.Handler) Router - - // Group adds a new inline-Router along the current routing - // path, with a fresh middleware stack for the inline-Router. - Group(fn func(r Router)) Router - - // Route mounts a sub-Router along a `pattern`` string. - Route(pattern string, fn func(r Router)) Router - - // Mount attaches another http.Handler along ./pattern/* - Mount(pattern string, h http.Handler) - - // Handle and HandleFunc adds routes for `pattern` that matches - // all HTTP methods. - Handle(pattern string, h http.Handler) - HandleFunc(pattern string, h http.HandlerFunc) - - // Method and MethodFunc adds routes for `pattern` that matches - // the `method` HTTP method. - Method(method, pattern string, h http.Handler) - MethodFunc(method, pattern string, h http.HandlerFunc) - - // HTTP-method routing along `pattern` - Connect(pattern string, h http.HandlerFunc) - Delete(pattern string, h http.HandlerFunc) - Get(pattern string, h http.HandlerFunc) - Head(pattern string, h http.HandlerFunc) - Options(pattern string, h http.HandlerFunc) - Patch(pattern string, h http.HandlerFunc) - Post(pattern string, h http.HandlerFunc) - Put(pattern string, h http.HandlerFunc) - Trace(pattern string, h http.HandlerFunc) - - // NotFound defines a handler to respond whenever a route could - // not be found. - NotFound(h http.HandlerFunc) - - // MethodNotAllowed defines a handler to respond whenever a method is - // not allowed. - MethodNotAllowed(h http.HandlerFunc) -} - -// Routes interface adds two methods for router traversal, which is also -// used by the github.com/go-chi/docgen package to generate documentation for Routers. -type Routes interface { - // Routes returns the routing tree in an easily traversable structure. - Routes() []Route - - // Middlewares returns the list of middlewares in use by the router. - Middlewares() Middlewares - - // Match searches the routing tree for a handler that matches - // the method/path - similar to routing a http request, but without - // executing the handler thereafter. - Match(rctx *Context, method, path string) bool -} -``` - -Each routing method accepts a URL `pattern` and chain of `handlers`. The URL pattern -supports named params (ie. `/users/{userID}`) and wildcards (ie. `/admin/*`). URL parameters -can be fetched at runtime by calling `chi.URLParam(r, "userID")` for named parameters -and `chi.URLParam(r, "*")` for a wildcard parameter. - - -### Middleware handlers - -chi's middlewares are just stdlib net/http middleware handlers. There is nothing special -about them, which means the router and all the tooling is designed to be compatible and -friendly with any middleware in the community. This offers much better extensibility and reuse -of packages and is at the heart of chi's purpose. - -Here is an example of a standard net/http middleware handler using the new request context -available in Go. This middleware sets a hypothetical user identifier on the request -context and calls the next handler in the chain. - -```go -// HTTP middleware setting a value on the request context -func MyMiddleware(next http.Handler) http.Handler { - return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { - ctx := context.WithValue(r.Context(), "user", "123") - next.ServeHTTP(w, r.WithContext(ctx)) - }) -} -``` - - -### Request handlers - -chi uses standard net/http request handlers. This little snippet is an example of a http.Handler -func that reads a user identifier from the request context - hypothetically, identifying -the user sending an authenticated request, validated+set by a previous middleware handler. - -```go -// HTTP handler accessing data from the request context. -func MyRequestHandler(w http.ResponseWriter, r *http.Request) { - user := r.Context().Value("user").(string) - w.Write([]byte(fmt.Sprintf("hi %s", user))) -} -``` - - -### URL parameters - -chi's router parses and stores URL parameters right onto the request context. Here is -an example of how to access URL params in your net/http handlers. And of course, middlewares -are able to access the same information. - -```go -// HTTP handler accessing the url routing parameters. -func MyRequestHandler(w http.ResponseWriter, r *http.Request) { - userID := chi.URLParam(r, "userID") // from a route like /users/{userID} - - ctx := r.Context() - key := ctx.Value("key").(string) - - w.Write([]byte(fmt.Sprintf("hi %v, %v", userID, key))) -} -``` - - -## Middlewares - -chi comes equipped with an optional `middleware` package, providing a suite of standard -`net/http` middlewares. Please note, any middleware in the ecosystem that is also compatible -with `net/http` can be used with chi's mux. - -### Core middlewares - ------------------------------------------------------------------------------------------------------------ -| chi/middleware Handler | description | -|:----------------------|:--------------------------------------------------------------------------------- -| AllowContentType | Explicit whitelist of accepted request Content-Types | -| BasicAuth | Basic HTTP authentication | -| Compress | Gzip compression for clients that accept compressed responses | -| GetHead | Automatically route undefined HEAD requests to GET handlers | -| Heartbeat | Monitoring endpoint to check the servers pulse | -| Logger | Logs the start and end of each request with the elapsed processing time | -| NoCache | Sets response headers to prevent clients from caching | -| Profiler | Easily attach net/http/pprof to your routers | -| RealIP | Sets a http.Request's RemoteAddr to either X-Forwarded-For or X-Real-IP | -| Recoverer | Gracefully absorb panics and prints the stack trace | -| RequestID | Injects a request ID into the context of each request | -| RedirectSlashes | Redirect slashes on routing paths | -| SetHeader | Short-hand middleware to set a response header key/value | -| StripSlashes | Strip slashes on routing paths | -| Throttle | Puts a ceiling on the number of concurrent requests | -| Timeout | Signals to the request context when the timeout deadline is reached | -| URLFormat | Parse extension from url and put it on request context | -| WithValue | Short-hand middleware to set a key/value on the request context | ------------------------------------------------------------------------------------------------------------ - -### Extra middlewares & packages - -Please see https://github.com/go-chi for additional packages. - --------------------------------------------------------------------------------------------------------------------- -| package | description | -|:---------------------------------------------------|:------------------------------------------------------------- -| [cors](https://github.com/go-chi/cors) | Cross-origin resource sharing (CORS) | -| [docgen](https://github.com/go-chi/docgen) | Print chi.Router routes at runtime | -| [jwtauth](https://github.com/go-chi/jwtauth) | JWT authentication | -| [hostrouter](https://github.com/go-chi/hostrouter) | Domain/host based request routing | -| [httplog](https://github.com/go-chi/httplog) | Small but powerful structured HTTP request logging | -| [httprate](https://github.com/go-chi/httprate) | HTTP request rate limiter | -| [httptracer](https://github.com/go-chi/httptracer) | HTTP request performance tracing library | -| [httpvcr](https://github.com/go-chi/httpvcr) | Write deterministic tests for external sources | -| [stampede](https://github.com/go-chi/stampede) | HTTP request coalescer | --------------------------------------------------------------------------------------------------------------------- - -please [submit a PR](./CONTRIBUTING.md) if you'd like to include a link to a chi-compatible middleware - - -## context? - -`context` is a tiny pkg that provides simple interface to signal context across call stacks -and goroutines. It was originally written by [Sameer Ajmani](https://github.com/Sajmani) -and is available in stdlib since go1.7. - -Learn more at https://blog.golang.org/context - -and.. -* Docs: https://golang.org/pkg/context -* Source: https://github.com/golang/go/tree/master/src/context - - -## Benchmarks - -The benchmark suite: https://github.com/pkieltyka/go-http-routing-benchmark - -Results as of Jan 9, 2019 with Go 1.11.4 on Linux X1 Carbon laptop - -```shell -BenchmarkChi_Param 3000000 475 ns/op 432 B/op 3 allocs/op -BenchmarkChi_Param5 2000000 696 ns/op 432 B/op 3 allocs/op -BenchmarkChi_Param20 1000000 1275 ns/op 432 B/op 3 allocs/op -BenchmarkChi_ParamWrite 3000000 505 ns/op 432 B/op 3 allocs/op -BenchmarkChi_GithubStatic 3000000 508 ns/op 432 B/op 3 allocs/op -BenchmarkChi_GithubParam 2000000 669 ns/op 432 B/op 3 allocs/op -BenchmarkChi_GithubAll 10000 134627 ns/op 87699 B/op 609 allocs/op -BenchmarkChi_GPlusStatic 3000000 402 ns/op 432 B/op 3 allocs/op -BenchmarkChi_GPlusParam 3000000 500 ns/op 432 B/op 3 allocs/op -BenchmarkChi_GPlus2Params 3000000 586 ns/op 432 B/op 3 allocs/op -BenchmarkChi_GPlusAll 200000 7237 ns/op 5616 B/op 39 allocs/op -BenchmarkChi_ParseStatic 3000000 408 ns/op 432 B/op 3 allocs/op -BenchmarkChi_ParseParam 3000000 488 ns/op 432 B/op 3 allocs/op -BenchmarkChi_Parse2Params 3000000 551 ns/op 432 B/op 3 allocs/op -BenchmarkChi_ParseAll 100000 13508 ns/op 11232 B/op 78 allocs/op -BenchmarkChi_StaticAll 20000 81933 ns/op 67826 B/op 471 allocs/op -``` - -Comparison with other routers: https://gist.github.com/pkieltyka/123032f12052520aaccab752bd3e78cc - -NOTE: the allocs in the benchmark above are from the calls to http.Request's -`WithContext(context.Context)` method that clones the http.Request, sets the `Context()` -on the duplicated (alloc'd) request and returns it the new request object. This is just -how setting context on a request in Go works. - - -## Credits - -* Carl Jackson for https://github.com/zenazn/goji - * Parts of chi's thinking comes from goji, and chi's middleware package - sources from goji. -* Armon Dadgar for https://github.com/armon/go-radix -* Contributions: [@VojtechVitek](https://github.com/VojtechVitek) - -We'll be more than happy to see [your contributions](./CONTRIBUTING.md)! - - -## Beyond REST - -chi is just a http router that lets you decompose request handling into many smaller layers. -Many companies use chi to write REST services for their public APIs. But, REST is just a convention -for managing state via HTTP, and there's a lot of other pieces required to write a complete client-server -system or network of microservices. - -Looking beyond REST, I also recommend some newer works in the field: -* [webrpc](https://github.com/webrpc/webrpc) - Web-focused RPC client+server framework with code-gen -* [gRPC](https://github.com/grpc/grpc-go) - Google's RPC framework via protobufs -* [graphql](https://github.com/99designs/gqlgen) - Declarative query language -* [NATS](https://nats.io) - lightweight pub-sub - - -## License - -Copyright (c) 2015-present [Peter Kieltyka](https://github.com/pkieltyka) - -Licensed under [MIT License](./LICENSE) - -[GoDoc]: https://godoc.org/github.com/go-chi/chi -[GoDoc Widget]: https://godoc.org/github.com/go-chi/chi?status.svg -[Travis]: https://travis-ci.org/go-chi/chi -[Travis Widget]: https://travis-ci.org/go-chi/chi.svg?branch=master diff --git a/vendor/github.com/go-chi/chi/chain.go b/vendor/github.com/go-chi/chi/chain.go deleted file mode 100644 index 88e6846138..0000000000 --- a/vendor/github.com/go-chi/chi/chain.go +++ /dev/null @@ -1,49 +0,0 @@ -package chi - -import "net/http" - -// Chain returns a Middlewares type from a slice of middleware handlers. -func Chain(middlewares ...func(http.Handler) http.Handler) Middlewares { - return Middlewares(middlewares) -} - -// Handler builds and returns a http.Handler from the chain of middlewares, -// with `h http.Handler` as the final handler. -func (mws Middlewares) Handler(h http.Handler) http.Handler { - return &ChainHandler{mws, h, chain(mws, h)} -} - -// HandlerFunc builds and returns a http.Handler from the chain of middlewares, -// with `h http.Handler` as the final handler. -func (mws Middlewares) HandlerFunc(h http.HandlerFunc) http.Handler { - return &ChainHandler{mws, h, chain(mws, h)} -} - -// ChainHandler is a http.Handler with support for handler composition and -// execution. -type ChainHandler struct { - Middlewares Middlewares - Endpoint http.Handler - chain http.Handler -} - -func (c *ChainHandler) ServeHTTP(w http.ResponseWriter, r *http.Request) { - c.chain.ServeHTTP(w, r) -} - -// chain builds a http.Handler composed of an inline middleware stack and endpoint -// handler in the order they are passed. -func chain(middlewares []func(http.Handler) http.Handler, endpoint http.Handler) http.Handler { - // Return ahead of time if there aren't any middlewares for the chain - if len(middlewares) == 0 { - return endpoint - } - - // Wrap the end handler with the middleware chain - h := middlewares[len(middlewares)-1](endpoint) - for i := len(middlewares) - 2; i >= 0; i-- { - h = middlewares[i](h) - } - - return h -} diff --git a/vendor/github.com/go-chi/chi/chi.go b/vendor/github.com/go-chi/chi/chi.go deleted file mode 100644 index b7063dc297..0000000000 --- a/vendor/github.com/go-chi/chi/chi.go +++ /dev/null @@ -1,134 +0,0 @@ -// -// Package chi is a small, idiomatic and composable router for building HTTP services. -// -// chi requires Go 1.10 or newer. -// -// Example: -// package main -// -// import ( -// "net/http" -// -// "github.com/go-chi/chi" -// "github.com/go-chi/chi/middleware" -// ) -// -// func main() { -// r := chi.NewRouter() -// r.Use(middleware.Logger) -// r.Use(middleware.Recoverer) -// -// r.Get("/", func(w http.ResponseWriter, r *http.Request) { -// w.Write([]byte("root.")) -// }) -// -// http.ListenAndServe(":3333", r) -// } -// -// See github.com/go-chi/chi/_examples/ for more in-depth examples. -// -// URL patterns allow for easy matching of path components in HTTP -// requests. The matching components can then be accessed using -// chi.URLParam(). All patterns must begin with a slash. -// -// A simple named placeholder {name} matches any sequence of characters -// up to the next / or the end of the URL. Trailing slashes on paths must -// be handled explicitly. -// -// A placeholder with a name followed by a colon allows a regular -// expression match, for example {number:\\d+}. The regular expression -// syntax is Go's normal regexp RE2 syntax, except that regular expressions -// including { or } are not supported, and / will never be -// matched. An anonymous regexp pattern is allowed, using an empty string -// before the colon in the placeholder, such as {:\\d+} -// -// The special placeholder of asterisk matches the rest of the requested -// URL. Any trailing characters in the pattern are ignored. This is the only -// placeholder which will match / characters. -// -// Examples: -// "/user/{name}" matches "/user/jsmith" but not "/user/jsmith/info" or "/user/jsmith/" -// "/user/{name}/info" matches "/user/jsmith/info" -// "/page/*" matches "/page/intro/latest" -// "/page/*/index" also matches "/page/intro/latest" -// "/date/{yyyy:\\d\\d\\d\\d}/{mm:\\d\\d}/{dd:\\d\\d}" matches "/date/2017/04/01" -// -package chi - -import "net/http" - -// NewRouter returns a new Mux object that implements the Router interface. -func NewRouter() *Mux { - return NewMux() -} - -// Router consisting of the core routing methods used by chi's Mux, -// using only the standard net/http. -type Router interface { - http.Handler - Routes - - // Use appends one or more middlewares onto the Router stack. - Use(middlewares ...func(http.Handler) http.Handler) - - // With adds inline middlewares for an endpoint handler. - With(middlewares ...func(http.Handler) http.Handler) Router - - // Group adds a new inline-Router along the current routing - // path, with a fresh middleware stack for the inline-Router. - Group(fn func(r Router)) Router - - // Route mounts a sub-Router along a `pattern`` string. - Route(pattern string, fn func(r Router)) Router - - // Mount attaches another http.Handler along ./pattern/* - Mount(pattern string, h http.Handler) - - // Handle and HandleFunc adds routes for `pattern` that matches - // all HTTP methods. - Handle(pattern string, h http.Handler) - HandleFunc(pattern string, h http.HandlerFunc) - - // Method and MethodFunc adds routes for `pattern` that matches - // the `method` HTTP method. - Method(method, pattern string, h http.Handler) - MethodFunc(method, pattern string, h http.HandlerFunc) - - // HTTP-method routing along `pattern` - Connect(pattern string, h http.HandlerFunc) - Delete(pattern string, h http.HandlerFunc) - Get(pattern string, h http.HandlerFunc) - Head(pattern string, h http.HandlerFunc) - Options(pattern string, h http.HandlerFunc) - Patch(pattern string, h http.HandlerFunc) - Post(pattern string, h http.HandlerFunc) - Put(pattern string, h http.HandlerFunc) - Trace(pattern string, h http.HandlerFunc) - - // NotFound defines a handler to respond whenever a route could - // not be found. - NotFound(h http.HandlerFunc) - - // MethodNotAllowed defines a handler to respond whenever a method is - // not allowed. - MethodNotAllowed(h http.HandlerFunc) -} - -// Routes interface adds two methods for router traversal, which is also -// used by the `docgen` subpackage to generation documentation for Routers. -type Routes interface { - // Routes returns the routing tree in an easily traversable structure. - Routes() []Route - - // Middlewares returns the list of middlewares in use by the router. - Middlewares() Middlewares - - // Match searches the routing tree for a handler that matches - // the method/path - similar to routing a http request, but without - // executing the handler thereafter. - Match(rctx *Context, method, path string) bool -} - -// Middlewares type is a slice of standard middleware handlers with methods -// to compose middleware chains and http.Handler's. -type Middlewares []func(http.Handler) http.Handler diff --git a/vendor/github.com/go-chi/chi/context.go b/vendor/github.com/go-chi/chi/context.go deleted file mode 100644 index 26c609ea2c..0000000000 --- a/vendor/github.com/go-chi/chi/context.go +++ /dev/null @@ -1,172 +0,0 @@ -package chi - -import ( - "context" - "net" - "net/http" - "strings" -) - -// URLParam returns the url parameter from a http.Request object. -func URLParam(r *http.Request, key string) string { - if rctx := RouteContext(r.Context()); rctx != nil { - return rctx.URLParam(key) - } - return "" -} - -// URLParamFromCtx returns the url parameter from a http.Request Context. -func URLParamFromCtx(ctx context.Context, key string) string { - if rctx := RouteContext(ctx); rctx != nil { - return rctx.URLParam(key) - } - return "" -} - -// RouteContext returns chi's routing Context object from a -// http.Request Context. -func RouteContext(ctx context.Context) *Context { - val, _ := ctx.Value(RouteCtxKey).(*Context) - return val -} - -// ServerBaseContext wraps an http.Handler to set the request context to the -// `baseCtx`. -func ServerBaseContext(baseCtx context.Context, h http.Handler) http.Handler { - fn := http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { - ctx := r.Context() - baseCtx := baseCtx - - // Copy over default net/http server context keys - if v, ok := ctx.Value(http.ServerContextKey).(*http.Server); ok { - baseCtx = context.WithValue(baseCtx, http.ServerContextKey, v) - } - if v, ok := ctx.Value(http.LocalAddrContextKey).(net.Addr); ok { - baseCtx = context.WithValue(baseCtx, http.LocalAddrContextKey, v) - } - - h.ServeHTTP(w, r.WithContext(baseCtx)) - }) - return fn -} - -// NewRouteContext returns a new routing Context object. -func NewRouteContext() *Context { - return &Context{} -} - -var ( - // RouteCtxKey is the context.Context key to store the request context. - RouteCtxKey = &contextKey{"RouteContext"} -) - -// Context is the default routing context set on the root node of a -// request context to track route patterns, URL parameters and -// an optional routing path. -type Context struct { - Routes Routes - - // Routing path/method override used during the route search. - // See Mux#routeHTTP method. - RoutePath string - RouteMethod string - - // Routing pattern stack throughout the lifecycle of the request, - // across all connected routers. It is a record of all matching - // patterns across a stack of sub-routers. - RoutePatterns []string - - // URLParams are the stack of routeParams captured during the - // routing lifecycle across a stack of sub-routers. - URLParams RouteParams - - // The endpoint routing pattern that matched the request URI path - // or `RoutePath` of the current sub-router. This value will update - // during the lifecycle of a request passing through a stack of - // sub-routers. - routePattern string - - // Route parameters matched for the current sub-router. It is - // intentionally unexported so it cant be tampered. - routeParams RouteParams - - // methodNotAllowed hint - methodNotAllowed bool -} - -// Reset a routing context to its initial state. -func (x *Context) Reset() { - x.Routes = nil - x.RoutePath = "" - x.RouteMethod = "" - x.RoutePatterns = x.RoutePatterns[:0] - x.URLParams.Keys = x.URLParams.Keys[:0] - x.URLParams.Values = x.URLParams.Values[:0] - - x.routePattern = "" - x.routeParams.Keys = x.routeParams.Keys[:0] - x.routeParams.Values = x.routeParams.Values[:0] - x.methodNotAllowed = false -} - -// URLParam returns the corresponding URL parameter value from the request -// routing context. -func (x *Context) URLParam(key string) string { - for k := len(x.URLParams.Keys) - 1; k >= 0; k-- { - if x.URLParams.Keys[k] == key { - return x.URLParams.Values[k] - } - } - return "" -} - -// RoutePattern builds the routing pattern string for the particular -// request, at the particular point during routing. This means, the value -// will change throughout the execution of a request in a router. That is -// why its advised to only use this value after calling the next handler. -// -// For example, -// -// func Instrument(next http.Handler) http.Handler { -// return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { -// next.ServeHTTP(w, r) -// routePattern := chi.RouteContext(r.Context()).RoutePattern() -// measure(w, r, routePattern) -// }) -// } -func (x *Context) RoutePattern() string { - routePattern := strings.Join(x.RoutePatterns, "") - return replaceWildcards(routePattern) -} - -// replaceWildcards takes a route pattern and recursively replaces all -// occurrences of "/*/" to "/". -func replaceWildcards(p string) string { - if strings.Contains(p, "/*/") { - return replaceWildcards(strings.Replace(p, "/*/", "/", -1)) - } - - return p -} - -// RouteParams is a structure to track URL routing parameters efficiently. -type RouteParams struct { - Keys, Values []string -} - -// Add will append a URL parameter to the end of the route param -func (s *RouteParams) Add(key, value string) { - s.Keys = append(s.Keys, key) - s.Values = append(s.Values, value) -} - -// contextKey is a value for use with context.WithValue. It's used as -// a pointer so it fits in an interface{} without allocation. This technique -// for defining context keys was copied from Go 1.7's new use of context in net/http. -type contextKey struct { - name string -} - -func (k *contextKey) String() string { - return "chi context value " + k.name -} diff --git a/vendor/github.com/go-chi/chi/middleware/basic_auth.go b/vendor/github.com/go-chi/chi/middleware/basic_auth.go deleted file mode 100644 index 87b2641a6a..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/basic_auth.go +++ /dev/null @@ -1,32 +0,0 @@ -package middleware - -import ( - "fmt" - "net/http" -) - -// BasicAuth implements a simple middleware handler for adding basic http auth to a route. -func BasicAuth(realm string, creds map[string]string) func(next http.Handler) http.Handler { - return func(next http.Handler) http.Handler { - return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { - user, pass, ok := r.BasicAuth() - if !ok { - basicAuthFailed(w, realm) - return - } - - credPass, credUserOk := creds[user] - if !credUserOk || pass != credPass { - basicAuthFailed(w, realm) - return - } - - next.ServeHTTP(w, r) - }) - } -} - -func basicAuthFailed(w http.ResponseWriter, realm string) { - w.Header().Add("WWW-Authenticate", fmt.Sprintf(`Basic realm="%s"`, realm)) - w.WriteHeader(http.StatusUnauthorized) -} diff --git a/vendor/github.com/go-chi/chi/middleware/compress.go b/vendor/github.com/go-chi/chi/middleware/compress.go deleted file mode 100644 index 2f40cc15af..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/compress.go +++ /dev/null @@ -1,399 +0,0 @@ -package middleware - -import ( - "bufio" - "compress/flate" - "compress/gzip" - "errors" - "fmt" - "io" - "io/ioutil" - "net" - "net/http" - "strings" - "sync" -) - -var defaultCompressibleContentTypes = []string{ - "text/html", - "text/css", - "text/plain", - "text/javascript", - "application/javascript", - "application/x-javascript", - "application/json", - "application/atom+xml", - "application/rss+xml", - "image/svg+xml", -} - -// Compress is a middleware that compresses response -// body of a given content types to a data format based -// on Accept-Encoding request header. It uses a given -// compression level. -// -// NOTE: make sure to set the Content-Type header on your response -// otherwise this middleware will not compress the response body. For ex, in -// your handler you should set w.Header().Set("Content-Type", http.DetectContentType(yourBody)) -// or set it manually. -// -// Passing a compression level of 5 is sensible value -func Compress(level int, types ...string) func(next http.Handler) http.Handler { - compressor := NewCompressor(level, types...) - return compressor.Handler -} - -// Compressor represents a set of encoding configurations. -type Compressor struct { - level int // The compression level. - // The mapping of encoder names to encoder functions. - encoders map[string]EncoderFunc - // The mapping of pooled encoders to pools. - pooledEncoders map[string]*sync.Pool - // The set of content types allowed to be compressed. - allowedTypes map[string]struct{} - allowedWildcards map[string]struct{} - // The list of encoders in order of decreasing precedence. - encodingPrecedence []string -} - -// NewCompressor creates a new Compressor that will handle encoding responses. -// -// The level should be one of the ones defined in the flate package. -// The types are the content types that are allowed to be compressed. -func NewCompressor(level int, types ...string) *Compressor { - // If types are provided, set those as the allowed types. If none are - // provided, use the default list. - allowedTypes := make(map[string]struct{}) - allowedWildcards := make(map[string]struct{}) - if len(types) > 0 { - for _, t := range types { - if strings.Contains(strings.TrimSuffix(t, "/*"), "*") { - panic(fmt.Sprintf("middleware/compress: Unsupported content-type wildcard pattern '%s'. Only '/*' supported", t)) - } - if strings.HasSuffix(t, "/*") { - allowedWildcards[strings.TrimSuffix(t, "/*")] = struct{}{} - } else { - allowedTypes[t] = struct{}{} - } - } - } else { - for _, t := range defaultCompressibleContentTypes { - allowedTypes[t] = struct{}{} - } - } - - c := &Compressor{ - level: level, - encoders: make(map[string]EncoderFunc), - pooledEncoders: make(map[string]*sync.Pool), - allowedTypes: allowedTypes, - allowedWildcards: allowedWildcards, - } - - // Set the default encoders. The precedence order uses the reverse - // ordering that the encoders were added. This means adding new encoders - // will move them to the front of the order. - // - // TODO: - // lzma: Opera. - // sdch: Chrome, Android. Gzip output + dictionary header. - // br: Brotli, see https://github.com/go-chi/chi/pull/326 - - // HTTP 1.1 "deflate" (RFC 2616) stands for DEFLATE data (RFC 1951) - // wrapped with zlib (RFC 1950). The zlib wrapper uses Adler-32 - // checksum compared to CRC-32 used in "gzip" and thus is faster. - // - // But.. some old browsers (MSIE, Safari 5.1) incorrectly expect - // raw DEFLATE data only, without the mentioned zlib wrapper. - // Because of this major confusion, most modern browsers try it - // both ways, first looking for zlib headers. - // Quote by Mark Adler: http://stackoverflow.com/a/9186091/385548 - // - // The list of browsers having problems is quite big, see: - // http://zoompf.com/blog/2012/02/lose-the-wait-http-compression - // https://web.archive.org/web/20120321182910/http://www.vervestudios.co/projects/compression-tests/results - // - // That's why we prefer gzip over deflate. It's just more reliable - // and not significantly slower than gzip. - c.SetEncoder("deflate", encoderDeflate) - - // TODO: Exception for old MSIE browsers that can't handle non-HTML? - // https://zoompf.com/blog/2012/02/lose-the-wait-http-compression - c.SetEncoder("gzip", encoderGzip) - - // NOTE: Not implemented, intentionally: - // case "compress": // LZW. Deprecated. - // case "bzip2": // Too slow on-the-fly. - // case "zopfli": // Too slow on-the-fly. - // case "xz": // Too slow on-the-fly. - return c -} - -// SetEncoder can be used to set the implementation of a compression algorithm. -// -// The encoding should be a standardised identifier. See: -// https://developer.mozilla.org/en-US/docs/Web/HTTP/Headers/Accept-Encoding -// -// For example, add the Brotli algortithm: -// -// import brotli_enc "gopkg.in/kothar/brotli-go.v0/enc" -// -// compressor := middleware.NewCompressor(5, "text/html") -// compressor.SetEncoder("br", func(w http.ResponseWriter, level int) io.Writer { -// params := brotli_enc.NewBrotliParams() -// params.SetQuality(level) -// return brotli_enc.NewBrotliWriter(params, w) -// }) -func (c *Compressor) SetEncoder(encoding string, fn EncoderFunc) { - encoding = strings.ToLower(encoding) - if encoding == "" { - panic("the encoding can not be empty") - } - if fn == nil { - panic("attempted to set a nil encoder function") - } - - // If we are adding a new encoder that is already registered, we have to - // clear that one out first. - if _, ok := c.pooledEncoders[encoding]; ok { - delete(c.pooledEncoders, encoding) - } - if _, ok := c.encoders[encoding]; ok { - delete(c.encoders, encoding) - } - - // If the encoder supports Resetting (IoReseterWriter), then it can be pooled. - encoder := fn(ioutil.Discard, c.level) - if encoder != nil { - if _, ok := encoder.(ioResetterWriter); ok { - pool := &sync.Pool{ - New: func() interface{} { - return fn(ioutil.Discard, c.level) - }, - } - c.pooledEncoders[encoding] = pool - } - } - // If the encoder is not in the pooledEncoders, add it to the normal encoders. - if _, ok := c.pooledEncoders[encoding]; !ok { - c.encoders[encoding] = fn - } - - for i, v := range c.encodingPrecedence { - if v == encoding { - c.encodingPrecedence = append(c.encodingPrecedence[:i], c.encodingPrecedence[i+1:]...) - } - } - - c.encodingPrecedence = append([]string{encoding}, c.encodingPrecedence...) -} - -// Handler returns a new middleware that will compress the response based on the -// current Compressor. -func (c *Compressor) Handler(next http.Handler) http.Handler { - return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { - encoder, encoding, cleanup := c.selectEncoder(r.Header, w) - - cw := &compressResponseWriter{ - ResponseWriter: w, - w: w, - contentTypes: c.allowedTypes, - contentWildcards: c.allowedWildcards, - encoding: encoding, - compressable: false, // determined in post-handler - } - if encoder != nil { - cw.w = encoder - } - // Re-add the encoder to the pool if applicable. - defer cleanup() - defer cw.Close() - - next.ServeHTTP(cw, r) - }) -} - -// selectEncoder returns the encoder, the name of the encoder, and a closer function. -func (c *Compressor) selectEncoder(h http.Header, w io.Writer) (io.Writer, string, func()) { - header := h.Get("Accept-Encoding") - - // Parse the names of all accepted algorithms from the header. - accepted := strings.Split(strings.ToLower(header), ",") - - // Find supported encoder by accepted list by precedence - for _, name := range c.encodingPrecedence { - if matchAcceptEncoding(accepted, name) { - if pool, ok := c.pooledEncoders[name]; ok { - encoder := pool.Get().(ioResetterWriter) - cleanup := func() { - pool.Put(encoder) - } - encoder.Reset(w) - return encoder, name, cleanup - - } - if fn, ok := c.encoders[name]; ok { - return fn(w, c.level), name, func() {} - } - } - - } - - // No encoder found to match the accepted encoding - return nil, "", func() {} -} - -func matchAcceptEncoding(accepted []string, encoding string) bool { - for _, v := range accepted { - if strings.Contains(v, encoding) { - return true - } - } - return false -} - -// An EncoderFunc is a function that wraps the provided io.Writer with a -// streaming compression algorithm and returns it. -// -// In case of failure, the function should return nil. -type EncoderFunc func(w io.Writer, level int) io.Writer - -// Interface for types that allow resetting io.Writers. -type ioResetterWriter interface { - io.Writer - Reset(w io.Writer) -} - -type compressResponseWriter struct { - http.ResponseWriter - - // The streaming encoder writer to be used if there is one. Otherwise, - // this is just the normal writer. - w io.Writer - encoding string - contentTypes map[string]struct{} - contentWildcards map[string]struct{} - wroteHeader bool - compressable bool -} - -func (cw *compressResponseWriter) isCompressable() bool { - // Parse the first part of the Content-Type response header. - contentType := cw.Header().Get("Content-Type") - if idx := strings.Index(contentType, ";"); idx >= 0 { - contentType = contentType[0:idx] - } - - // Is the content type compressable? - if _, ok := cw.contentTypes[contentType]; ok { - return true - } - if idx := strings.Index(contentType, "/"); idx > 0 { - contentType = contentType[0:idx] - _, ok := cw.contentWildcards[contentType] - return ok - } - return false -} - -func (cw *compressResponseWriter) WriteHeader(code int) { - if cw.wroteHeader { - cw.ResponseWriter.WriteHeader(code) // Allow multiple calls to propagate. - return - } - cw.wroteHeader = true - defer cw.ResponseWriter.WriteHeader(code) - - // Already compressed data? - if cw.Header().Get("Content-Encoding") != "" { - return - } - - if !cw.isCompressable() { - cw.compressable = false - return - } - - if cw.encoding != "" { - cw.compressable = true - cw.Header().Set("Content-Encoding", cw.encoding) - cw.Header().Set("Vary", "Accept-Encoding") - - // The content-length after compression is unknown - cw.Header().Del("Content-Length") - } -} - -func (cw *compressResponseWriter) Write(p []byte) (int, error) { - if !cw.wroteHeader { - cw.WriteHeader(http.StatusOK) - } - - return cw.writer().Write(p) -} - -func (cw *compressResponseWriter) writer() io.Writer { - if cw.compressable { - return cw.w - } else { - return cw.ResponseWriter - } -} - -type compressFlusher interface { - Flush() error -} - -func (cw *compressResponseWriter) Flush() { - if f, ok := cw.writer().(http.Flusher); ok { - f.Flush() - } - // If the underlying writer has a compression flush signature, - // call this Flush() method instead - if f, ok := cw.writer().(compressFlusher); ok { - f.Flush() - - // Also flush the underlying response writer - if f, ok := cw.ResponseWriter.(http.Flusher); ok { - f.Flush() - } - } -} - -func (cw *compressResponseWriter) Hijack() (net.Conn, *bufio.ReadWriter, error) { - if hj, ok := cw.writer().(http.Hijacker); ok { - return hj.Hijack() - } - return nil, nil, errors.New("chi/middleware: http.Hijacker is unavailable on the writer") -} - -func (cw *compressResponseWriter) Push(target string, opts *http.PushOptions) error { - if ps, ok := cw.writer().(http.Pusher); ok { - return ps.Push(target, opts) - } - return errors.New("chi/middleware: http.Pusher is unavailable on the writer") -} - -func (cw *compressResponseWriter) Close() error { - if c, ok := cw.writer().(io.WriteCloser); ok { - return c.Close() - } - return errors.New("chi/middleware: io.WriteCloser is unavailable on the writer") -} - -func encoderGzip(w io.Writer, level int) io.Writer { - gw, err := gzip.NewWriterLevel(w, level) - if err != nil { - return nil - } - return gw -} - -func encoderDeflate(w io.Writer, level int) io.Writer { - dw, err := flate.NewWriter(w, level) - if err != nil { - return nil - } - return dw -} diff --git a/vendor/github.com/go-chi/chi/middleware/content_charset.go b/vendor/github.com/go-chi/chi/middleware/content_charset.go deleted file mode 100644 index 07b5ce6f66..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/content_charset.go +++ /dev/null @@ -1,51 +0,0 @@ -package middleware - -import ( - "net/http" - "strings" -) - -// ContentCharset generates a handler that writes a 415 Unsupported Media Type response if none of the charsets match. -// An empty charset will allow requests with no Content-Type header or no specified charset. -func ContentCharset(charsets ...string) func(next http.Handler) http.Handler { - for i, c := range charsets { - charsets[i] = strings.ToLower(c) - } - - return func(next http.Handler) http.Handler { - return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { - if !contentEncoding(r.Header.Get("Content-Type"), charsets...) { - w.WriteHeader(http.StatusUnsupportedMediaType) - return - } - - next.ServeHTTP(w, r) - }) - } -} - -// Check the content encoding against a list of acceptable values. -func contentEncoding(ce string, charsets ...string) bool { - _, ce = split(strings.ToLower(ce), ";") - _, ce = split(ce, "charset=") - ce, _ = split(ce, ";") - for _, c := range charsets { - if ce == c { - return true - } - } - - return false -} - -// Split a string in two parts, cleaning any whitespace. -func split(str, sep string) (string, string) { - var a, b string - var parts = strings.SplitN(str, sep, 2) - a = strings.TrimSpace(parts[0]) - if len(parts) == 2 { - b = strings.TrimSpace(parts[1]) - } - - return a, b -} diff --git a/vendor/github.com/go-chi/chi/middleware/content_encoding.go b/vendor/github.com/go-chi/chi/middleware/content_encoding.go deleted file mode 100644 index e0b9ccc08a..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/content_encoding.go +++ /dev/null @@ -1,34 +0,0 @@ -package middleware - -import ( - "net/http" - "strings" -) - -// AllowContentEncoding enforces a whitelist of request Content-Encoding otherwise responds -// with a 415 Unsupported Media Type status. -func AllowContentEncoding(contentEncoding ...string) func(next http.Handler) http.Handler { - allowedEncodings := make(map[string]struct{}, len(contentEncoding)) - for _, encoding := range contentEncoding { - allowedEncodings[strings.TrimSpace(strings.ToLower(encoding))] = struct{}{} - } - return func(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - requestEncodings := r.Header["Content-Encoding"] - // skip check for empty content body or no Content-Encoding - if r.ContentLength == 0 { - next.ServeHTTP(w, r) - return - } - // All encodings in the request must be allowed - for _, encoding := range requestEncodings { - if _, ok := allowedEncodings[strings.TrimSpace(strings.ToLower(encoding))]; !ok { - w.WriteHeader(http.StatusUnsupportedMediaType) - return - } - } - next.ServeHTTP(w, r) - } - return http.HandlerFunc(fn) - } -} diff --git a/vendor/github.com/go-chi/chi/middleware/content_type.go b/vendor/github.com/go-chi/chi/middleware/content_type.go deleted file mode 100644 index ee4957874f..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/content_type.go +++ /dev/null @@ -1,51 +0,0 @@ -package middleware - -import ( - "net/http" - "strings" -) - -// SetHeader is a convenience handler to set a response header key/value -func SetHeader(key, value string) func(next http.Handler) http.Handler { - return func(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - w.Header().Set(key, value) - next.ServeHTTP(w, r) - } - return http.HandlerFunc(fn) - } -} - -// AllowContentType enforces a whitelist of request Content-Types otherwise responds -// with a 415 Unsupported Media Type status. -func AllowContentType(contentTypes ...string) func(next http.Handler) http.Handler { - cT := []string{} - for _, t := range contentTypes { - cT = append(cT, strings.ToLower(t)) - } - - return func(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - if r.ContentLength == 0 { - // skip check for empty content body - next.ServeHTTP(w, r) - return - } - - s := strings.ToLower(strings.TrimSpace(r.Header.Get("Content-Type"))) - if i := strings.Index(s, ";"); i > -1 { - s = s[0:i] - } - - for _, t := range cT { - if t == s { - next.ServeHTTP(w, r) - return - } - } - - w.WriteHeader(http.StatusUnsupportedMediaType) - } - return http.HandlerFunc(fn) - } -} diff --git a/vendor/github.com/go-chi/chi/middleware/get_head.go b/vendor/github.com/go-chi/chi/middleware/get_head.go deleted file mode 100644 index 86068a96db..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/get_head.go +++ /dev/null @@ -1,39 +0,0 @@ -package middleware - -import ( - "net/http" - - "github.com/go-chi/chi" -) - -// GetHead automatically route undefined HEAD requests to GET handlers. -func GetHead(next http.Handler) http.Handler { - return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { - if r.Method == "HEAD" { - rctx := chi.RouteContext(r.Context()) - routePath := rctx.RoutePath - if routePath == "" { - if r.URL.RawPath != "" { - routePath = r.URL.RawPath - } else { - routePath = r.URL.Path - } - } - - // Temporary routing context to look-ahead before routing the request - tctx := chi.NewRouteContext() - - // Attempt to find a HEAD handler for the routing path, if not found, traverse - // the router as through its a GET route, but proceed with the request - // with the HEAD method. - if !rctx.Routes.Match(tctx, "HEAD", routePath) { - rctx.RouteMethod = "GET" - rctx.RoutePath = routePath - next.ServeHTTP(w, r) - return - } - } - - next.ServeHTTP(w, r) - }) -} diff --git a/vendor/github.com/go-chi/chi/middleware/heartbeat.go b/vendor/github.com/go-chi/chi/middleware/heartbeat.go deleted file mode 100644 index fe822fb536..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/heartbeat.go +++ /dev/null @@ -1,26 +0,0 @@ -package middleware - -import ( - "net/http" - "strings" -) - -// Heartbeat endpoint middleware useful to setting up a path like -// `/ping` that load balancers or uptime testing external services -// can make a request before hitting any routes. It's also convenient -// to place this above ACL middlewares as well. -func Heartbeat(endpoint string) func(http.Handler) http.Handler { - f := func(h http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - if r.Method == "GET" && strings.EqualFold(r.URL.Path, endpoint) { - w.Header().Set("Content-Type", "text/plain") - w.WriteHeader(http.StatusOK) - w.Write([]byte(".")) - return - } - h.ServeHTTP(w, r) - } - return http.HandlerFunc(fn) - } - return f -} diff --git a/vendor/github.com/go-chi/chi/middleware/logger.go b/vendor/github.com/go-chi/chi/middleware/logger.go deleted file mode 100644 index 158a6a3905..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/logger.go +++ /dev/null @@ -1,155 +0,0 @@ -package middleware - -import ( - "bytes" - "context" - "log" - "net/http" - "os" - "time" -) - -var ( - // LogEntryCtxKey is the context.Context key to store the request log entry. - LogEntryCtxKey = &contextKey{"LogEntry"} - - // DefaultLogger is called by the Logger middleware handler to log each request. - // Its made a package-level variable so that it can be reconfigured for custom - // logging configurations. - DefaultLogger = RequestLogger(&DefaultLogFormatter{Logger: log.New(os.Stdout, "", log.LstdFlags), NoColor: false}) -) - -// Logger is a middleware that logs the start and end of each request, along -// with some useful data about what was requested, what the response status was, -// and how long it took to return. When standard output is a TTY, Logger will -// print in color, otherwise it will print in black and white. Logger prints a -// request ID if one is provided. -// -// Alternatively, look at https://github.com/goware/httplog for a more in-depth -// http logger with structured logging support. -func Logger(next http.Handler) http.Handler { - return DefaultLogger(next) -} - -// RequestLogger returns a logger handler using a custom LogFormatter. -func RequestLogger(f LogFormatter) func(next http.Handler) http.Handler { - return func(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - entry := f.NewLogEntry(r) - ww := NewWrapResponseWriter(w, r.ProtoMajor) - - t1 := time.Now() - defer func() { - entry.Write(ww.Status(), ww.BytesWritten(), ww.Header(), time.Since(t1), nil) - }() - - next.ServeHTTP(ww, WithLogEntry(r, entry)) - } - return http.HandlerFunc(fn) - } -} - -// LogFormatter initiates the beginning of a new LogEntry per request. -// See DefaultLogFormatter for an example implementation. -type LogFormatter interface { - NewLogEntry(r *http.Request) LogEntry -} - -// LogEntry records the final log when a request completes. -// See defaultLogEntry for an example implementation. -type LogEntry interface { - Write(status, bytes int, header http.Header, elapsed time.Duration, extra interface{}) - Panic(v interface{}, stack []byte) -} - -// GetLogEntry returns the in-context LogEntry for a request. -func GetLogEntry(r *http.Request) LogEntry { - entry, _ := r.Context().Value(LogEntryCtxKey).(LogEntry) - return entry -} - -// WithLogEntry sets the in-context LogEntry for a request. -func WithLogEntry(r *http.Request, entry LogEntry) *http.Request { - r = r.WithContext(context.WithValue(r.Context(), LogEntryCtxKey, entry)) - return r -} - -// LoggerInterface accepts printing to stdlib logger or compatible logger. -type LoggerInterface interface { - Print(v ...interface{}) -} - -// DefaultLogFormatter is a simple logger that implements a LogFormatter. -type DefaultLogFormatter struct { - Logger LoggerInterface - NoColor bool -} - -// NewLogEntry creates a new LogEntry for the request. -func (l *DefaultLogFormatter) NewLogEntry(r *http.Request) LogEntry { - useColor := !l.NoColor - entry := &defaultLogEntry{ - DefaultLogFormatter: l, - request: r, - buf: &bytes.Buffer{}, - useColor: useColor, - } - - reqID := GetReqID(r.Context()) - if reqID != "" { - cW(entry.buf, useColor, nYellow, "[%s] ", reqID) - } - cW(entry.buf, useColor, nCyan, "\"") - cW(entry.buf, useColor, bMagenta, "%s ", r.Method) - - scheme := "http" - if r.TLS != nil { - scheme = "https" - } - cW(entry.buf, useColor, nCyan, "%s://%s%s %s\" ", scheme, r.Host, r.RequestURI, r.Proto) - - entry.buf.WriteString("from ") - entry.buf.WriteString(r.RemoteAddr) - entry.buf.WriteString(" - ") - - return entry -} - -type defaultLogEntry struct { - *DefaultLogFormatter - request *http.Request - buf *bytes.Buffer - useColor bool -} - -func (l *defaultLogEntry) Write(status, bytes int, header http.Header, elapsed time.Duration, extra interface{}) { - switch { - case status < 200: - cW(l.buf, l.useColor, bBlue, "%03d", status) - case status < 300: - cW(l.buf, l.useColor, bGreen, "%03d", status) - case status < 400: - cW(l.buf, l.useColor, bCyan, "%03d", status) - case status < 500: - cW(l.buf, l.useColor, bYellow, "%03d", status) - default: - cW(l.buf, l.useColor, bRed, "%03d", status) - } - - cW(l.buf, l.useColor, bBlue, " %dB", bytes) - - l.buf.WriteString(" in ") - if elapsed < 500*time.Millisecond { - cW(l.buf, l.useColor, nGreen, "%s", elapsed) - } else if elapsed < 5*time.Second { - cW(l.buf, l.useColor, nYellow, "%s", elapsed) - } else { - cW(l.buf, l.useColor, nRed, "%s", elapsed) - } - - l.Logger.Print(l.buf.String()) -} - -func (l *defaultLogEntry) Panic(v interface{}, stack []byte) { - PrintPrettyStack(v) -} diff --git a/vendor/github.com/go-chi/chi/middleware/middleware.go b/vendor/github.com/go-chi/chi/middleware/middleware.go deleted file mode 100644 index cc371e00a8..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/middleware.go +++ /dev/null @@ -1,23 +0,0 @@ -package middleware - -import "net/http" - -// New will create a new middleware handler from a http.Handler. -func New(h http.Handler) func(next http.Handler) http.Handler { - return func(next http.Handler) http.Handler { - return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { - h.ServeHTTP(w, r) - }) - } -} - -// contextKey is a value for use with context.WithValue. It's used as -// a pointer so it fits in an interface{} without allocation. This technique -// for defining context keys was copied from Go 1.7's new use of context in net/http. -type contextKey struct { - name string -} - -func (k *contextKey) String() string { - return "chi/middleware context value " + k.name -} diff --git a/vendor/github.com/go-chi/chi/middleware/nocache.go b/vendor/github.com/go-chi/chi/middleware/nocache.go deleted file mode 100644 index 2412829e1b..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/nocache.go +++ /dev/null @@ -1,58 +0,0 @@ -package middleware - -// Ported from Goji's middleware, source: -// https://github.com/zenazn/goji/tree/master/web/middleware - -import ( - "net/http" - "time" -) - -// Unix epoch time -var epoch = time.Unix(0, 0).Format(time.RFC1123) - -// Taken from https://github.com/mytrile/nocache -var noCacheHeaders = map[string]string{ - "Expires": epoch, - "Cache-Control": "no-cache, no-store, no-transform, must-revalidate, private, max-age=0", - "Pragma": "no-cache", - "X-Accel-Expires": "0", -} - -var etagHeaders = []string{ - "ETag", - "If-Modified-Since", - "If-Match", - "If-None-Match", - "If-Range", - "If-Unmodified-Since", -} - -// NoCache is a simple piece of middleware that sets a number of HTTP headers to prevent -// a router (or subrouter) from being cached by an upstream proxy and/or client. -// -// As per http://wiki.nginx.org/HttpProxyModule - NoCache sets: -// Expires: Thu, 01 Jan 1970 00:00:00 UTC -// Cache-Control: no-cache, private, max-age=0 -// X-Accel-Expires: 0 -// Pragma: no-cache (for HTTP/1.0 proxies/clients) -func NoCache(h http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - - // Delete any ETag headers that may have been set - for _, v := range etagHeaders { - if r.Header.Get(v) != "" { - r.Header.Del(v) - } - } - - // Set our NoCache headers - for k, v := range noCacheHeaders { - w.Header().Set(k, v) - } - - h.ServeHTTP(w, r) - } - - return http.HandlerFunc(fn) -} diff --git a/vendor/github.com/go-chi/chi/middleware/profiler.go b/vendor/github.com/go-chi/chi/middleware/profiler.go deleted file mode 100644 index 1d44b8259a..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/profiler.go +++ /dev/null @@ -1,55 +0,0 @@ -package middleware - -import ( - "expvar" - "fmt" - "net/http" - "net/http/pprof" - - "github.com/go-chi/chi" -) - -// Profiler is a convenient subrouter used for mounting net/http/pprof. ie. -// -// func MyService() http.Handler { -// r := chi.NewRouter() -// // ..middlewares -// r.Mount("/debug", middleware.Profiler()) -// // ..routes -// return r -// } -func Profiler() http.Handler { - r := chi.NewRouter() - r.Use(NoCache) - - r.Get("/", func(w http.ResponseWriter, r *http.Request) { - http.Redirect(w, r, r.RequestURI+"/pprof/", 301) - }) - r.HandleFunc("/pprof", func(w http.ResponseWriter, r *http.Request) { - http.Redirect(w, r, r.RequestURI+"/", 301) - }) - - r.HandleFunc("/pprof/*", pprof.Index) - r.HandleFunc("/pprof/cmdline", pprof.Cmdline) - r.HandleFunc("/pprof/profile", pprof.Profile) - r.HandleFunc("/pprof/symbol", pprof.Symbol) - r.HandleFunc("/pprof/trace", pprof.Trace) - r.HandleFunc("/vars", expVars) - - return r -} - -// Replicated from expvar.go as not public. -func expVars(w http.ResponseWriter, r *http.Request) { - first := true - w.Header().Set("Content-Type", "application/json") - fmt.Fprintf(w, "{\n") - expvar.Do(func(kv expvar.KeyValue) { - if !first { - fmt.Fprintf(w, ",\n") - } - first = false - fmt.Fprintf(w, "%q: %s", kv.Key, kv.Value) - }) - fmt.Fprintf(w, "\n}\n") -} diff --git a/vendor/github.com/go-chi/chi/middleware/realip.go b/vendor/github.com/go-chi/chi/middleware/realip.go deleted file mode 100644 index 72db6ca9f5..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/realip.go +++ /dev/null @@ -1,54 +0,0 @@ -package middleware - -// Ported from Goji's middleware, source: -// https://github.com/zenazn/goji/tree/master/web/middleware - -import ( - "net/http" - "strings" -) - -var xForwardedFor = http.CanonicalHeaderKey("X-Forwarded-For") -var xRealIP = http.CanonicalHeaderKey("X-Real-IP") - -// RealIP is a middleware that sets a http.Request's RemoteAddr to the results -// of parsing either the X-Forwarded-For header or the X-Real-IP header (in that -// order). -// -// This middleware should be inserted fairly early in the middleware stack to -// ensure that subsequent layers (e.g., request loggers) which examine the -// RemoteAddr will see the intended value. -// -// You should only use this middleware if you can trust the headers passed to -// you (in particular, the two headers this middleware uses), for example -// because you have placed a reverse proxy like HAProxy or nginx in front of -// chi. If your reverse proxies are configured to pass along arbitrary header -// values from the client, or if you use this middleware without a reverse -// proxy, malicious clients will be able to make you very sad (or, depending on -// how you're using RemoteAddr, vulnerable to an attack of some sort). -func RealIP(h http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - if rip := realIP(r); rip != "" { - r.RemoteAddr = rip - } - h.ServeHTTP(w, r) - } - - return http.HandlerFunc(fn) -} - -func realIP(r *http.Request) string { - var ip string - - if xrip := r.Header.Get(xRealIP); xrip != "" { - ip = xrip - } else if xff := r.Header.Get(xForwardedFor); xff != "" { - i := strings.Index(xff, ", ") - if i == -1 { - i = len(xff) - } - ip = xff[:i] - } - - return ip -} diff --git a/vendor/github.com/go-chi/chi/middleware/recoverer.go b/vendor/github.com/go-chi/chi/middleware/recoverer.go deleted file mode 100644 index 785b18c52b..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/recoverer.go +++ /dev/null @@ -1,192 +0,0 @@ -package middleware - -// The original work was derived from Goji's middleware, source: -// https://github.com/zenazn/goji/tree/master/web/middleware - -import ( - "bytes" - "errors" - "fmt" - "net/http" - "os" - "runtime/debug" - "strings" -) - -// Recoverer is a middleware that recovers from panics, logs the panic (and a -// backtrace), and returns a HTTP 500 (Internal Server Error) status if -// possible. Recoverer prints a request ID if one is provided. -// -// Alternatively, look at https://github.com/pressly/lg middleware pkgs. -func Recoverer(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - defer func() { - if rvr := recover(); rvr != nil && rvr != http.ErrAbortHandler { - - logEntry := GetLogEntry(r) - if logEntry != nil { - logEntry.Panic(rvr, debug.Stack()) - } else { - PrintPrettyStack(rvr) - } - - w.WriteHeader(http.StatusInternalServerError) - } - }() - - next.ServeHTTP(w, r) - } - - return http.HandlerFunc(fn) -} - -func PrintPrettyStack(rvr interface{}) { - debugStack := debug.Stack() - s := prettyStack{} - out, err := s.parse(debugStack, rvr) - if err == nil { - os.Stderr.Write(out) - } else { - // print stdlib output as a fallback - os.Stderr.Write(debugStack) - } -} - -type prettyStack struct { -} - -func (s prettyStack) parse(debugStack []byte, rvr interface{}) ([]byte, error) { - var err error - useColor := true - buf := &bytes.Buffer{} - - cW(buf, false, bRed, "\n") - cW(buf, useColor, bCyan, " panic: ") - cW(buf, useColor, bBlue, "%v", rvr) - cW(buf, false, bWhite, "\n \n") - - // process debug stack info - stack := strings.Split(string(debugStack), "\n") - lines := []string{} - - // locate panic line, as we may have nested panics - for i := len(stack) - 1; i > 0; i-- { - lines = append(lines, stack[i]) - if strings.HasPrefix(stack[i], "panic(0x") { - lines = lines[0 : len(lines)-2] // remove boilerplate - break - } - } - - // reverse - for i := len(lines)/2 - 1; i >= 0; i-- { - opp := len(lines) - 1 - i - lines[i], lines[opp] = lines[opp], lines[i] - } - - // decorate - for i, line := range lines { - lines[i], err = s.decorateLine(line, useColor, i) - if err != nil { - return nil, err - } - } - - for _, l := range lines { - fmt.Fprintf(buf, "%s", l) - } - return buf.Bytes(), nil -} - -func (s prettyStack) decorateLine(line string, useColor bool, num int) (string, error) { - line = strings.TrimSpace(line) - if strings.HasPrefix(line, "\t") || strings.Contains(line, ".go:") { - return s.decorateSourceLine(line, useColor, num) - } else if strings.HasSuffix(line, ")") { - return s.decorateFuncCallLine(line, useColor, num) - } else { - if strings.HasPrefix(line, "\t") { - return strings.Replace(line, "\t", " ", 1), nil - } else { - return fmt.Sprintf(" %s\n", line), nil - } - } -} - -func (s prettyStack) decorateFuncCallLine(line string, useColor bool, num int) (string, error) { - idx := strings.LastIndex(line, "(") - if idx < 0 { - return "", errors.New("not a func call line") - } - - buf := &bytes.Buffer{} - pkg := line[0:idx] - // addr := line[idx:] - method := "" - - idx = strings.LastIndex(pkg, string(os.PathSeparator)) - if idx < 0 { - idx = strings.Index(pkg, ".") - method = pkg[idx:] - pkg = pkg[0:idx] - } else { - method = pkg[idx+1:] - pkg = pkg[0 : idx+1] - idx = strings.Index(method, ".") - pkg += method[0:idx] - method = method[idx:] - } - pkgColor := nYellow - methodColor := bGreen - - if num == 0 { - cW(buf, useColor, bRed, " -> ") - pkgColor = bMagenta - methodColor = bRed - } else { - cW(buf, useColor, bWhite, " ") - } - cW(buf, useColor, pkgColor, "%s", pkg) - cW(buf, useColor, methodColor, "%s\n", method) - // cW(buf, useColor, nBlack, "%s", addr) - return buf.String(), nil -} - -func (s prettyStack) decorateSourceLine(line string, useColor bool, num int) (string, error) { - idx := strings.LastIndex(line, ".go:") - if idx < 0 { - return "", errors.New("not a source line") - } - - buf := &bytes.Buffer{} - path := line[0 : idx+3] - lineno := line[idx+3:] - - idx = strings.LastIndex(path, string(os.PathSeparator)) - dir := path[0 : idx+1] - file := path[idx+1:] - - idx = strings.Index(lineno, " ") - if idx > 0 { - lineno = lineno[0:idx] - } - fileColor := bCyan - lineColor := bGreen - - if num == 1 { - cW(buf, useColor, bRed, " -> ") - fileColor = bRed - lineColor = bMagenta - } else { - cW(buf, false, bWhite, " ") - } - cW(buf, useColor, bWhite, "%s", dir) - cW(buf, useColor, fileColor, "%s", file) - cW(buf, useColor, lineColor, "%s", lineno) - if num == 1 { - cW(buf, false, bWhite, "\n") - } - cW(buf, false, bWhite, "\n") - - return buf.String(), nil -} diff --git a/vendor/github.com/go-chi/chi/middleware/request_id.go b/vendor/github.com/go-chi/chi/middleware/request_id.go deleted file mode 100644 index 4903ecc214..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/request_id.go +++ /dev/null @@ -1,96 +0,0 @@ -package middleware - -// Ported from Goji's middleware, source: -// https://github.com/zenazn/goji/tree/master/web/middleware - -import ( - "context" - "crypto/rand" - "encoding/base64" - "fmt" - "net/http" - "os" - "strings" - "sync/atomic" -) - -// Key to use when setting the request ID. -type ctxKeyRequestID int - -// RequestIDKey is the key that holds the unique request ID in a request context. -const RequestIDKey ctxKeyRequestID = 0 - -// RequestIDHeader is the name of the HTTP Header which contains the request id. -// Exported so that it can be changed by developers -var RequestIDHeader = "X-Request-Id" - -var prefix string -var reqid uint64 - -// A quick note on the statistics here: we're trying to calculate the chance that -// two randomly generated base62 prefixes will collide. We use the formula from -// http://en.wikipedia.org/wiki/Birthday_problem -// -// P[m, n] \approx 1 - e^{-m^2/2n} -// -// We ballpark an upper bound for $m$ by imagining (for whatever reason) a server -// that restarts every second over 10 years, for $m = 86400 * 365 * 10 = 315360000$ -// -// For a $k$ character base-62 identifier, we have $n(k) = 62^k$ -// -// Plugging this in, we find $P[m, n(10)] \approx 5.75%$, which is good enough for -// our purposes, and is surely more than anyone would ever need in practice -- a -// process that is rebooted a handful of times a day for a hundred years has less -// than a millionth of a percent chance of generating two colliding IDs. - -func init() { - hostname, err := os.Hostname() - if hostname == "" || err != nil { - hostname = "localhost" - } - var buf [12]byte - var b64 string - for len(b64) < 10 { - rand.Read(buf[:]) - b64 = base64.StdEncoding.EncodeToString(buf[:]) - b64 = strings.NewReplacer("+", "", "/", "").Replace(b64) - } - - prefix = fmt.Sprintf("%s/%s", hostname, b64[0:10]) -} - -// RequestID is a middleware that injects a request ID into the context of each -// request. A request ID is a string of the form "host.example.com/random-0001", -// where "random" is a base62 random string that uniquely identifies this go -// process, and where the last number is an atomically incremented request -// counter. -func RequestID(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - ctx := r.Context() - requestID := r.Header.Get(RequestIDHeader) - if requestID == "" { - myid := atomic.AddUint64(&reqid, 1) - requestID = fmt.Sprintf("%s-%06d", prefix, myid) - } - ctx = context.WithValue(ctx, RequestIDKey, requestID) - next.ServeHTTP(w, r.WithContext(ctx)) - } - return http.HandlerFunc(fn) -} - -// GetReqID returns a request ID from the given context if one is present. -// Returns the empty string if a request ID cannot be found. -func GetReqID(ctx context.Context) string { - if ctx == nil { - return "" - } - if reqID, ok := ctx.Value(RequestIDKey).(string); ok { - return reqID - } - return "" -} - -// NextRequestID generates the next request ID in the sequence. -func NextRequestID() uint64 { - return atomic.AddUint64(&reqid, 1) -} diff --git a/vendor/github.com/go-chi/chi/middleware/route_headers.go b/vendor/github.com/go-chi/chi/middleware/route_headers.go deleted file mode 100644 index 7ee30c8773..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/route_headers.go +++ /dev/null @@ -1,160 +0,0 @@ -package middleware - -import ( - "net/http" - "strings" -) - -// RouteHeaders is a neat little header-based router that allows you to direct -// the flow of a request through a middleware stack based on a request header. -// -// For example, lets say you'd like to setup multiple routers depending on the -// request Host header, you could then do something as so: -// -// r := chi.NewRouter() -// rSubdomain := chi.NewRouter() -// -// r.Use(middleware.RouteHeaders(). -// Route("Host", "example.com", middleware.New(r)). -// Route("Host", "*.example.com", middleware.New(rSubdomain)). -// Handler) -// -// r.Get("/", h) -// rSubdomain.Get("/", h2) -// -// -// Another example, imagine you want to setup multiple CORS handlers, where for -// your origin servers you allow authorized requests, but for third-party public -// requests, authorization is disabled. -// -// r := chi.NewRouter() -// -// r.Use(middleware.RouteHeaders(). -// Route("Origin", "https://app.skyweaver.net", cors.Handler(cors.Options{ -// AllowedOrigins: []string{"https://api.skyweaver.net"}, -// AllowedMethods: []string{"GET", "POST", "PUT", "DELETE", "OPTIONS"}, -// AllowedHeaders: []string{"Accept", "Authorization", "Content-Type"}, -// AllowCredentials: true, // <----------<<< allow credentials -// })). -// Route("Origin", "*", cors.Handler(cors.Options{ -// AllowedOrigins: []string{"*"}, -// AllowedMethods: []string{"GET", "POST", "PUT", "DELETE", "OPTIONS"}, -// AllowedHeaders: []string{"Accept", "Content-Type"}, -// AllowCredentials: false, // <----------<<< do not allow credentials -// })). -// Handler) -// -func RouteHeaders() HeaderRouter { - return HeaderRouter{} -} - -type HeaderRouter map[string][]HeaderRoute - -func (hr HeaderRouter) Route(header string, match string, middlewareHandler func(next http.Handler) http.Handler) HeaderRouter { - header = strings.ToLower(header) - k := hr[header] - if k == nil { - hr[header] = []HeaderRoute{} - } - hr[header] = append(hr[header], HeaderRoute{MatchOne: NewPattern(match), Middleware: middlewareHandler}) - return hr -} - -func (hr HeaderRouter) RouteAny(header string, match []string, middlewareHandler func(next http.Handler) http.Handler) HeaderRouter { - header = strings.ToLower(header) - k := hr[header] - if k == nil { - hr[header] = []HeaderRoute{} - } - patterns := []Pattern{} - for _, m := range match { - patterns = append(patterns, NewPattern(m)) - } - hr[header] = append(hr[header], HeaderRoute{MatchAny: patterns, Middleware: middlewareHandler}) - return hr -} - -func (hr HeaderRouter) RouteDefault(handler func(next http.Handler) http.Handler) HeaderRouter { - hr["*"] = []HeaderRoute{{Middleware: handler}} - return hr -} - -func (hr HeaderRouter) Handler(next http.Handler) http.Handler { - return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { - if len(hr) == 0 { - // skip if no routes set - next.ServeHTTP(w, r) - } - - // find first matching header route, and continue - for header, matchers := range hr { - headerValue := r.Header.Get(header) - if headerValue == "" { - continue - } - headerValue = strings.ToLower(headerValue) - for _, matcher := range matchers { - if matcher.IsMatch(headerValue) { - matcher.Middleware(next).ServeHTTP(w, r) - return - } - } - } - - // if no match, check for "*" default route - matcher, ok := hr["*"] - if !ok || matcher[0].Middleware == nil { - next.ServeHTTP(w, r) - return - } - matcher[0].Middleware(next).ServeHTTP(w, r) - }) -} - -type HeaderRoute struct { - MatchAny []Pattern - MatchOne Pattern - Middleware func(next http.Handler) http.Handler -} - -func (r HeaderRoute) IsMatch(value string) bool { - if len(r.MatchAny) > 0 { - for _, m := range r.MatchAny { - if m.Match(value) { - return true - } - } - } else if r.MatchOne.Match(value) { - return true - } - return false -} - -type Pattern struct { - prefix string - suffix string - wildcard bool -} - -func NewPattern(value string) Pattern { - p := Pattern{} - if i := strings.IndexByte(value, '*'); i >= 0 { - p.wildcard = true - p.prefix = value[0:i] - p.suffix = value[i+1:] - } else { - p.prefix = value - } - return p -} - -func (p Pattern) Match(v string) bool { - if !p.wildcard { - if p.prefix == v { - return true - } else { - return false - } - } - return len(v) >= len(p.prefix+p.suffix) && strings.HasPrefix(v, p.prefix) && strings.HasSuffix(v, p.suffix) -} diff --git a/vendor/github.com/go-chi/chi/middleware/strip.go b/vendor/github.com/go-chi/chi/middleware/strip.go deleted file mode 100644 index 2b8b1842ab..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/strip.go +++ /dev/null @@ -1,56 +0,0 @@ -package middleware - -import ( - "fmt" - "net/http" - - "github.com/go-chi/chi" -) - -// StripSlashes is a middleware that will match request paths with a trailing -// slash, strip it from the path and continue routing through the mux, if a route -// matches, then it will serve the handler. -func StripSlashes(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - var path string - rctx := chi.RouteContext(r.Context()) - if rctx.RoutePath != "" { - path = rctx.RoutePath - } else { - path = r.URL.Path - } - if len(path) > 1 && path[len(path)-1] == '/' { - rctx.RoutePath = path[:len(path)-1] - } - next.ServeHTTP(w, r) - } - return http.HandlerFunc(fn) -} - -// RedirectSlashes is a middleware that will match request paths with a trailing -// slash and redirect to the same path, less the trailing slash. -// -// NOTE: RedirectSlashes middleware is *incompatible* with http.FileServer, -// see https://github.com/go-chi/chi/issues/343 -func RedirectSlashes(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - var path string - rctx := chi.RouteContext(r.Context()) - if rctx.RoutePath != "" { - path = rctx.RoutePath - } else { - path = r.URL.Path - } - if len(path) > 1 && path[len(path)-1] == '/' { - if r.URL.RawQuery != "" { - path = fmt.Sprintf("%s?%s", path[:len(path)-1], r.URL.RawQuery) - } else { - path = path[:len(path)-1] - } - http.Redirect(w, r, path, 301) - return - } - next.ServeHTTP(w, r) - } - return http.HandlerFunc(fn) -} diff --git a/vendor/github.com/go-chi/chi/middleware/terminal.go b/vendor/github.com/go-chi/chi/middleware/terminal.go deleted file mode 100644 index 5ead7b9243..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/terminal.go +++ /dev/null @@ -1,63 +0,0 @@ -package middleware - -// Ported from Goji's middleware, source: -// https://github.com/zenazn/goji/tree/master/web/middleware - -import ( - "fmt" - "io" - "os" -) - -var ( - // Normal colors - nBlack = []byte{'\033', '[', '3', '0', 'm'} - nRed = []byte{'\033', '[', '3', '1', 'm'} - nGreen = []byte{'\033', '[', '3', '2', 'm'} - nYellow = []byte{'\033', '[', '3', '3', 'm'} - nBlue = []byte{'\033', '[', '3', '4', 'm'} - nMagenta = []byte{'\033', '[', '3', '5', 'm'} - nCyan = []byte{'\033', '[', '3', '6', 'm'} - nWhite = []byte{'\033', '[', '3', '7', 'm'} - // Bright colors - bBlack = []byte{'\033', '[', '3', '0', ';', '1', 'm'} - bRed = []byte{'\033', '[', '3', '1', ';', '1', 'm'} - bGreen = []byte{'\033', '[', '3', '2', ';', '1', 'm'} - bYellow = []byte{'\033', '[', '3', '3', ';', '1', 'm'} - bBlue = []byte{'\033', '[', '3', '4', ';', '1', 'm'} - bMagenta = []byte{'\033', '[', '3', '5', ';', '1', 'm'} - bCyan = []byte{'\033', '[', '3', '6', ';', '1', 'm'} - bWhite = []byte{'\033', '[', '3', '7', ';', '1', 'm'} - - reset = []byte{'\033', '[', '0', 'm'} -) - -var IsTTY bool - -func init() { - // This is sort of cheating: if stdout is a character device, we assume - // that means it's a TTY. Unfortunately, there are many non-TTY - // character devices, but fortunately stdout is rarely set to any of - // them. - // - // We could solve this properly by pulling in a dependency on - // code.google.com/p/go.crypto/ssh/terminal, for instance, but as a - // heuristic for whether to print in color or in black-and-white, I'd - // really rather not. - fi, err := os.Stdout.Stat() - if err == nil { - m := os.ModeDevice | os.ModeCharDevice - IsTTY = fi.Mode()&m == m - } -} - -// colorWrite -func cW(w io.Writer, useColor bool, color []byte, s string, args ...interface{}) { - if IsTTY && useColor { - w.Write(color) - } - fmt.Fprintf(w, s, args...) - if IsTTY && useColor { - w.Write(reset) - } -} diff --git a/vendor/github.com/go-chi/chi/middleware/throttle.go b/vendor/github.com/go-chi/chi/middleware/throttle.go deleted file mode 100644 index fdedd3c127..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/throttle.go +++ /dev/null @@ -1,132 +0,0 @@ -package middleware - -import ( - "net/http" - "strconv" - "time" -) - -const ( - errCapacityExceeded = "Server capacity exceeded." - errTimedOut = "Timed out while waiting for a pending request to complete." - errContextCanceled = "Context was canceled." -) - -var ( - defaultBacklogTimeout = time.Second * 60 -) - -// ThrottleOpts represents a set of throttling options. -type ThrottleOpts struct { - Limit int - BacklogLimit int - BacklogTimeout time.Duration - RetryAfterFn func(ctxDone bool) time.Duration -} - -// Throttle is a middleware that limits number of currently processed requests -// at a time across all users. Note: Throttle is not a rate-limiter per user, -// instead it just puts a ceiling on the number of currentl in-flight requests -// being processed from the point from where the Throttle middleware is mounted. -func Throttle(limit int) func(http.Handler) http.Handler { - return ThrottleWithOpts(ThrottleOpts{Limit: limit, BacklogTimeout: defaultBacklogTimeout}) -} - -// ThrottleBacklog is a middleware that limits number of currently processed -// requests at a time and provides a backlog for holding a finite number of -// pending requests. -func ThrottleBacklog(limit int, backlogLimit int, backlogTimeout time.Duration) func(http.Handler) http.Handler { - return ThrottleWithOpts(ThrottleOpts{Limit: limit, BacklogLimit: backlogLimit, BacklogTimeout: backlogTimeout}) -} - -// ThrottleWithOpts is a middleware that limits number of currently processed requests using passed ThrottleOpts. -func ThrottleWithOpts(opts ThrottleOpts) func(http.Handler) http.Handler { - if opts.Limit < 1 { - panic("chi/middleware: Throttle expects limit > 0") - } - - if opts.BacklogLimit < 0 { - panic("chi/middleware: Throttle expects backlogLimit to be positive") - } - - t := throttler{ - tokens: make(chan token, opts.Limit), - backlogTokens: make(chan token, opts.Limit+opts.BacklogLimit), - backlogTimeout: opts.BacklogTimeout, - retryAfterFn: opts.RetryAfterFn, - } - - // Filling tokens. - for i := 0; i < opts.Limit+opts.BacklogLimit; i++ { - if i < opts.Limit { - t.tokens <- token{} - } - t.backlogTokens <- token{} - } - - return func(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - ctx := r.Context() - - select { - - case <-ctx.Done(): - t.setRetryAfterHeaderIfNeeded(w, true) - http.Error(w, errContextCanceled, http.StatusServiceUnavailable) - return - - case btok := <-t.backlogTokens: - timer := time.NewTimer(t.backlogTimeout) - - defer func() { - t.backlogTokens <- btok - }() - - select { - case <-timer.C: - t.setRetryAfterHeaderIfNeeded(w, false) - http.Error(w, errTimedOut, http.StatusServiceUnavailable) - return - case <-ctx.Done(): - timer.Stop() - t.setRetryAfterHeaderIfNeeded(w, true) - http.Error(w, errContextCanceled, http.StatusServiceUnavailable) - return - case tok := <-t.tokens: - defer func() { - timer.Stop() - t.tokens <- tok - }() - next.ServeHTTP(w, r) - } - return - - default: - t.setRetryAfterHeaderIfNeeded(w, false) - http.Error(w, errCapacityExceeded, http.StatusServiceUnavailable) - return - } - } - - return http.HandlerFunc(fn) - } -} - -// token represents a request that is being processed. -type token struct{} - -// throttler limits number of currently processed requests at a time. -type throttler struct { - tokens chan token - backlogTokens chan token - backlogTimeout time.Duration - retryAfterFn func(ctxDone bool) time.Duration -} - -// setRetryAfterHeaderIfNeeded sets Retry-After HTTP header if corresponding retryAfterFn option of throttler is initialized. -func (t throttler) setRetryAfterHeaderIfNeeded(w http.ResponseWriter, ctxDone bool) { - if t.retryAfterFn == nil { - return - } - w.Header().Set("Retry-After", strconv.Itoa(int(t.retryAfterFn(ctxDone).Seconds()))) -} diff --git a/vendor/github.com/go-chi/chi/middleware/timeout.go b/vendor/github.com/go-chi/chi/middleware/timeout.go deleted file mode 100644 index 8e373536cf..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/timeout.go +++ /dev/null @@ -1,49 +0,0 @@ -package middleware - -import ( - "context" - "net/http" - "time" -) - -// Timeout is a middleware that cancels ctx after a given timeout and return -// a 504 Gateway Timeout error to the client. -// -// It's required that you select the ctx.Done() channel to check for the signal -// if the context has reached its deadline and return, otherwise the timeout -// signal will be just ignored. -// -// ie. a route/handler may look like: -// -// r.Get("/long", func(w http.ResponseWriter, r *http.Request) { -// ctx := r.Context() -// processTime := time.Duration(rand.Intn(4)+1) * time.Second -// -// select { -// case <-ctx.Done(): -// return -// -// case <-time.After(processTime): -// // The above channel simulates some hard work. -// } -// -// w.Write([]byte("done")) -// }) -// -func Timeout(timeout time.Duration) func(next http.Handler) http.Handler { - return func(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - ctx, cancel := context.WithTimeout(r.Context(), timeout) - defer func() { - cancel() - if ctx.Err() == context.DeadlineExceeded { - w.WriteHeader(http.StatusGatewayTimeout) - } - }() - - r = r.WithContext(ctx) - next.ServeHTTP(w, r) - } - return http.HandlerFunc(fn) - } -} diff --git a/vendor/github.com/go-chi/chi/middleware/url_format.go b/vendor/github.com/go-chi/chi/middleware/url_format.go deleted file mode 100644 index 5749e4f32b..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/url_format.go +++ /dev/null @@ -1,72 +0,0 @@ -package middleware - -import ( - "context" - "net/http" - "strings" - - "github.com/go-chi/chi" -) - -var ( - // URLFormatCtxKey is the context.Context key to store the URL format data - // for a request. - URLFormatCtxKey = &contextKey{"URLFormat"} -) - -// URLFormat is a middleware that parses the url extension from a request path and stores it -// on the context as a string under the key `middleware.URLFormatCtxKey`. The middleware will -// trim the suffix from the routing path and continue routing. -// -// Routers should not include a url parameter for the suffix when using this middleware. -// -// Sample usage.. for url paths: `/articles/1`, `/articles/1.json` and `/articles/1.xml` -// -// func routes() http.Handler { -// r := chi.NewRouter() -// r.Use(middleware.URLFormat) -// -// r.Get("/articles/{id}", ListArticles) -// -// return r -// } -// -// func ListArticles(w http.ResponseWriter, r *http.Request) { -// urlFormat, _ := r.Context().Value(middleware.URLFormatCtxKey).(string) -// -// switch urlFormat { -// case "json": -// render.JSON(w, r, articles) -// case "xml:" -// render.XML(w, r, articles) -// default: -// render.JSON(w, r, articles) -// } -// } -// -func URLFormat(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - ctx := r.Context() - - var format string - path := r.URL.Path - - if strings.Index(path, ".") > 0 { - base := strings.LastIndex(path, "/") - idx := strings.Index(path[base:], ".") - - if idx > 0 { - idx += base - format = path[idx+1:] - - rctx := chi.RouteContext(r.Context()) - rctx.RoutePath = path[:idx] - } - } - - r = r.WithContext(context.WithValue(ctx, URLFormatCtxKey, format)) - - next.ServeHTTP(w, r) - } - return http.HandlerFunc(fn) -} diff --git a/vendor/github.com/go-chi/chi/middleware/value.go b/vendor/github.com/go-chi/chi/middleware/value.go deleted file mode 100644 index fbbd0393fb..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/value.go +++ /dev/null @@ -1,17 +0,0 @@ -package middleware - -import ( - "context" - "net/http" -) - -// WithValue is a middleware that sets a given key/value in a context chain. -func WithValue(key interface{}, val interface{}) func(next http.Handler) http.Handler { - return func(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { - r = r.WithContext(context.WithValue(r.Context(), key, val)) - next.ServeHTTP(w, r) - } - return http.HandlerFunc(fn) - } -} diff --git a/vendor/github.com/go-chi/chi/middleware/wrap_writer.go b/vendor/github.com/go-chi/chi/middleware/wrap_writer.go deleted file mode 100644 index 382a523e48..0000000000 --- a/vendor/github.com/go-chi/chi/middleware/wrap_writer.go +++ /dev/null @@ -1,180 +0,0 @@ -package middleware - -// The original work was derived from Goji's middleware, source: -// https://github.com/zenazn/goji/tree/master/web/middleware - -import ( - "bufio" - "io" - "net" - "net/http" -) - -// NewWrapResponseWriter wraps an http.ResponseWriter, returning a proxy that allows you to -// hook into various parts of the response process. -func NewWrapResponseWriter(w http.ResponseWriter, protoMajor int) WrapResponseWriter { - _, fl := w.(http.Flusher) - - bw := basicWriter{ResponseWriter: w} - - if protoMajor == 2 { - _, ps := w.(http.Pusher) - if fl && ps { - return &http2FancyWriter{bw} - } - } else { - _, hj := w.(http.Hijacker) - _, rf := w.(io.ReaderFrom) - if fl && hj && rf { - return &httpFancyWriter{bw} - } - } - if fl { - return &flushWriter{bw} - } - - return &bw -} - -// WrapResponseWriter is a proxy around an http.ResponseWriter that allows you to hook -// into various parts of the response process. -type WrapResponseWriter interface { - http.ResponseWriter - // Status returns the HTTP status of the request, or 0 if one has not - // yet been sent. - Status() int - // BytesWritten returns the total number of bytes sent to the client. - BytesWritten() int - // Tee causes the response body to be written to the given io.Writer in - // addition to proxying the writes through. Only one io.Writer can be - // tee'd to at once: setting a second one will overwrite the first. - // Writes will be sent to the proxy before being written to this - // io.Writer. It is illegal for the tee'd writer to be modified - // concurrently with writes. - Tee(io.Writer) - // Unwrap returns the original proxied target. - Unwrap() http.ResponseWriter -} - -// basicWriter wraps a http.ResponseWriter that implements the minimal -// http.ResponseWriter interface. -type basicWriter struct { - http.ResponseWriter - wroteHeader bool - code int - bytes int - tee io.Writer -} - -func (b *basicWriter) WriteHeader(code int) { - if !b.wroteHeader { - b.code = code - b.wroteHeader = true - b.ResponseWriter.WriteHeader(code) - } -} - -func (b *basicWriter) Write(buf []byte) (int, error) { - b.maybeWriteHeader() - n, err := b.ResponseWriter.Write(buf) - if b.tee != nil { - _, err2 := b.tee.Write(buf[:n]) - // Prefer errors generated by the proxied writer. - if err == nil { - err = err2 - } - } - b.bytes += n - return n, err -} - -func (b *basicWriter) maybeWriteHeader() { - if !b.wroteHeader { - b.WriteHeader(http.StatusOK) - } -} - -func (b *basicWriter) Status() int { - return b.code -} - -func (b *basicWriter) BytesWritten() int { - return b.bytes -} - -func (b *basicWriter) Tee(w io.Writer) { - b.tee = w -} - -func (b *basicWriter) Unwrap() http.ResponseWriter { - return b.ResponseWriter -} - -type flushWriter struct { - basicWriter -} - -func (f *flushWriter) Flush() { - f.wroteHeader = true - fl := f.basicWriter.ResponseWriter.(http.Flusher) - fl.Flush() -} - -var _ http.Flusher = &flushWriter{} - -// httpFancyWriter is a HTTP writer that additionally satisfies -// http.Flusher, http.Hijacker, and io.ReaderFrom. It exists for the common case -// of wrapping the http.ResponseWriter that package http gives you, in order to -// make the proxied object support the full method set of the proxied object. -type httpFancyWriter struct { - basicWriter -} - -func (f *httpFancyWriter) Flush() { - f.wroteHeader = true - fl := f.basicWriter.ResponseWriter.(http.Flusher) - fl.Flush() -} - -func (f *httpFancyWriter) Hijack() (net.Conn, *bufio.ReadWriter, error) { - hj := f.basicWriter.ResponseWriter.(http.Hijacker) - return hj.Hijack() -} - -func (f *http2FancyWriter) Push(target string, opts *http.PushOptions) error { - return f.basicWriter.ResponseWriter.(http.Pusher).Push(target, opts) -} - -func (f *httpFancyWriter) ReadFrom(r io.Reader) (int64, error) { - if f.basicWriter.tee != nil { - n, err := io.Copy(&f.basicWriter, r) - f.basicWriter.bytes += int(n) - return n, err - } - rf := f.basicWriter.ResponseWriter.(io.ReaderFrom) - f.basicWriter.maybeWriteHeader() - n, err := rf.ReadFrom(r) - f.basicWriter.bytes += int(n) - return n, err -} - -var _ http.Flusher = &httpFancyWriter{} -var _ http.Hijacker = &httpFancyWriter{} -var _ http.Pusher = &http2FancyWriter{} -var _ io.ReaderFrom = &httpFancyWriter{} - -// http2FancyWriter is a HTTP2 writer that additionally satisfies -// http.Flusher, and io.ReaderFrom. It exists for the common case -// of wrapping the http.ResponseWriter that package http gives you, in order to -// make the proxied object support the full method set of the proxied object. -type http2FancyWriter struct { - basicWriter -} - -func (f *http2FancyWriter) Flush() { - f.wroteHeader = true - fl := f.basicWriter.ResponseWriter.(http.Flusher) - fl.Flush() -} - -var _ http.Flusher = &http2FancyWriter{} diff --git a/vendor/github.com/go-chi/chi/mux.go b/vendor/github.com/go-chi/chi/mux.go deleted file mode 100644 index 52950e97b5..0000000000 --- a/vendor/github.com/go-chi/chi/mux.go +++ /dev/null @@ -1,466 +0,0 @@ -package chi - -import ( - "context" - "fmt" - "net/http" - "strings" - "sync" -) - -var _ Router = &Mux{} - -// Mux is a simple HTTP route multiplexer that parses a request path, -// records any URL params, and executes an end handler. It implements -// the http.Handler interface and is friendly with the standard library. -// -// Mux is designed to be fast, minimal and offer a powerful API for building -// modular and composable HTTP services with a large set of handlers. It's -// particularly useful for writing large REST API services that break a handler -// into many smaller parts composed of middlewares and end handlers. -type Mux struct { - // The radix trie router - tree *node - - // The middleware stack - middlewares []func(http.Handler) http.Handler - - // Controls the behaviour of middleware chain generation when a mux - // is registered as an inline group inside another mux. - inline bool - parent *Mux - - // The computed mux handler made of the chained middleware stack and - // the tree router - handler http.Handler - - // Routing context pool - pool *sync.Pool - - // Custom route not found handler - notFoundHandler http.HandlerFunc - - // Custom method not allowed handler - methodNotAllowedHandler http.HandlerFunc -} - -// NewMux returns a newly initialized Mux object that implements the Router -// interface. -func NewMux() *Mux { - mux := &Mux{tree: &node{}, pool: &sync.Pool{}} - mux.pool.New = func() interface{} { - return NewRouteContext() - } - return mux -} - -// ServeHTTP is the single method of the http.Handler interface that makes -// Mux interoperable with the standard library. It uses a sync.Pool to get and -// reuse routing contexts for each request. -func (mx *Mux) ServeHTTP(w http.ResponseWriter, r *http.Request) { - // Ensure the mux has some routes defined on the mux - if mx.handler == nil { - mx.NotFoundHandler().ServeHTTP(w, r) - return - } - - // Check if a routing context already exists from a parent router. - rctx, _ := r.Context().Value(RouteCtxKey).(*Context) - if rctx != nil { - mx.handler.ServeHTTP(w, r) - return - } - - // Fetch a RouteContext object from the sync pool, and call the computed - // mx.handler that is comprised of mx.middlewares + mx.routeHTTP. - // Once the request is finished, reset the routing context and put it back - // into the pool for reuse from another request. - rctx = mx.pool.Get().(*Context) - rctx.Reset() - rctx.Routes = mx - - // NOTE: r.WithContext() causes 2 allocations and context.WithValue() causes 1 allocation - r = r.WithContext(context.WithValue(r.Context(), RouteCtxKey, rctx)) - - // Serve the request and once its done, put the request context back in the sync pool - mx.handler.ServeHTTP(w, r) - mx.pool.Put(rctx) -} - -// Use appends a middleware handler to the Mux middleware stack. -// -// The middleware stack for any Mux will execute before searching for a matching -// route to a specific handler, which provides opportunity to respond early, -// change the course of the request execution, or set request-scoped values for -// the next http.Handler. -func (mx *Mux) Use(middlewares ...func(http.Handler) http.Handler) { - if mx.handler != nil { - panic("chi: all middlewares must be defined before routes on a mux") - } - mx.middlewares = append(mx.middlewares, middlewares...) -} - -// Handle adds the route `pattern` that matches any http method to -// execute the `handler` http.Handler. -func (mx *Mux) Handle(pattern string, handler http.Handler) { - mx.handle(mALL, pattern, handler) -} - -// HandleFunc adds the route `pattern` that matches any http method to -// execute the `handlerFn` http.HandlerFunc. -func (mx *Mux) HandleFunc(pattern string, handlerFn http.HandlerFunc) { - mx.handle(mALL, pattern, handlerFn) -} - -// Method adds the route `pattern` that matches `method` http method to -// execute the `handler` http.Handler. -func (mx *Mux) Method(method, pattern string, handler http.Handler) { - m, ok := methodMap[strings.ToUpper(method)] - if !ok { - panic(fmt.Sprintf("chi: '%s' http method is not supported.", method)) - } - mx.handle(m, pattern, handler) -} - -// MethodFunc adds the route `pattern` that matches `method` http method to -// execute the `handlerFn` http.HandlerFunc. -func (mx *Mux) MethodFunc(method, pattern string, handlerFn http.HandlerFunc) { - mx.Method(method, pattern, handlerFn) -} - -// Connect adds the route `pattern` that matches a CONNECT http method to -// execute the `handlerFn` http.HandlerFunc. -func (mx *Mux) Connect(pattern string, handlerFn http.HandlerFunc) { - mx.handle(mCONNECT, pattern, handlerFn) -} - -// Delete adds the route `pattern` that matches a DELETE http method to -// execute the `handlerFn` http.HandlerFunc. -func (mx *Mux) Delete(pattern string, handlerFn http.HandlerFunc) { - mx.handle(mDELETE, pattern, handlerFn) -} - -// Get adds the route `pattern` that matches a GET http method to -// execute the `handlerFn` http.HandlerFunc. -func (mx *Mux) Get(pattern string, handlerFn http.HandlerFunc) { - mx.handle(mGET, pattern, handlerFn) -} - -// Head adds the route `pattern` that matches a HEAD http method to -// execute the `handlerFn` http.HandlerFunc. -func (mx *Mux) Head(pattern string, handlerFn http.HandlerFunc) { - mx.handle(mHEAD, pattern, handlerFn) -} - -// Options adds the route `pattern` that matches a OPTIONS http method to -// execute the `handlerFn` http.HandlerFunc. -func (mx *Mux) Options(pattern string, handlerFn http.HandlerFunc) { - mx.handle(mOPTIONS, pattern, handlerFn) -} - -// Patch adds the route `pattern` that matches a PATCH http method to -// execute the `handlerFn` http.HandlerFunc. -func (mx *Mux) Patch(pattern string, handlerFn http.HandlerFunc) { - mx.handle(mPATCH, pattern, handlerFn) -} - -// Post adds the route `pattern` that matches a POST http method to -// execute the `handlerFn` http.HandlerFunc. -func (mx *Mux) Post(pattern string, handlerFn http.HandlerFunc) { - mx.handle(mPOST, pattern, handlerFn) -} - -// Put adds the route `pattern` that matches a PUT http method to -// execute the `handlerFn` http.HandlerFunc. -func (mx *Mux) Put(pattern string, handlerFn http.HandlerFunc) { - mx.handle(mPUT, pattern, handlerFn) -} - -// Trace adds the route `pattern` that matches a TRACE http method to -// execute the `handlerFn` http.HandlerFunc. -func (mx *Mux) Trace(pattern string, handlerFn http.HandlerFunc) { - mx.handle(mTRACE, pattern, handlerFn) -} - -// NotFound sets a custom http.HandlerFunc for routing paths that could -// not be found. The default 404 handler is `http.NotFound`. -func (mx *Mux) NotFound(handlerFn http.HandlerFunc) { - // Build NotFound handler chain - m := mx - hFn := handlerFn - if mx.inline && mx.parent != nil { - m = mx.parent - hFn = Chain(mx.middlewares...).HandlerFunc(hFn).ServeHTTP - } - - // Update the notFoundHandler from this point forward - m.notFoundHandler = hFn - m.updateSubRoutes(func(subMux *Mux) { - if subMux.notFoundHandler == nil { - subMux.NotFound(hFn) - } - }) -} - -// MethodNotAllowed sets a custom http.HandlerFunc for routing paths where the -// method is unresolved. The default handler returns a 405 with an empty body. -func (mx *Mux) MethodNotAllowed(handlerFn http.HandlerFunc) { - // Build MethodNotAllowed handler chain - m := mx - hFn := handlerFn - if mx.inline && mx.parent != nil { - m = mx.parent - hFn = Chain(mx.middlewares...).HandlerFunc(hFn).ServeHTTP - } - - // Update the methodNotAllowedHandler from this point forward - m.methodNotAllowedHandler = hFn - m.updateSubRoutes(func(subMux *Mux) { - if subMux.methodNotAllowedHandler == nil { - subMux.MethodNotAllowed(hFn) - } - }) -} - -// With adds inline middlewares for an endpoint handler. -func (mx *Mux) With(middlewares ...func(http.Handler) http.Handler) Router { - // Similarly as in handle(), we must build the mux handler once additional - // middleware registration isn't allowed for this stack, like now. - if !mx.inline && mx.handler == nil { - mx.buildRouteHandler() - } - - // Copy middlewares from parent inline muxs - var mws Middlewares - if mx.inline { - mws = make(Middlewares, len(mx.middlewares)) - copy(mws, mx.middlewares) - } - mws = append(mws, middlewares...) - - im := &Mux{ - pool: mx.pool, inline: true, parent: mx, tree: mx.tree, middlewares: mws, - notFoundHandler: mx.notFoundHandler, methodNotAllowedHandler: mx.methodNotAllowedHandler, - } - - return im -} - -// Group creates a new inline-Mux with a fresh middleware stack. It's useful -// for a group of handlers along the same routing path that use an additional -// set of middlewares. See _examples/. -func (mx *Mux) Group(fn func(r Router)) Router { - im := mx.With().(*Mux) - if fn != nil { - fn(im) - } - return im -} - -// Route creates a new Mux with a fresh middleware stack and mounts it -// along the `pattern` as a subrouter. Effectively, this is a short-hand -// call to Mount. See _examples/. -func (mx *Mux) Route(pattern string, fn func(r Router)) Router { - subRouter := NewRouter() - if fn != nil { - fn(subRouter) - } - mx.Mount(pattern, subRouter) - return subRouter -} - -// Mount attaches another http.Handler or chi Router as a subrouter along a routing -// path. It's very useful to split up a large API as many independent routers and -// compose them as a single service using Mount. See _examples/. -// -// Note that Mount() simply sets a wildcard along the `pattern` that will continue -// routing at the `handler`, which in most cases is another chi.Router. As a result, -// if you define two Mount() routes on the exact same pattern the mount will panic. -func (mx *Mux) Mount(pattern string, handler http.Handler) { - // Provide runtime safety for ensuring a pattern isn't mounted on an existing - // routing pattern. - if mx.tree.findPattern(pattern+"*") || mx.tree.findPattern(pattern+"/*") { - panic(fmt.Sprintf("chi: attempting to Mount() a handler on an existing path, '%s'", pattern)) - } - - // Assign sub-Router's with the parent not found & method not allowed handler if not specified. - subr, ok := handler.(*Mux) - if ok && subr.notFoundHandler == nil && mx.notFoundHandler != nil { - subr.NotFound(mx.notFoundHandler) - } - if ok && subr.methodNotAllowedHandler == nil && mx.methodNotAllowedHandler != nil { - subr.MethodNotAllowed(mx.methodNotAllowedHandler) - } - - mountHandler := http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { - rctx := RouteContext(r.Context()) - rctx.RoutePath = mx.nextRoutePath(rctx) - handler.ServeHTTP(w, r) - }) - - if pattern == "" || pattern[len(pattern)-1] != '/' { - mx.handle(mALL|mSTUB, pattern, mountHandler) - mx.handle(mALL|mSTUB, pattern+"/", mountHandler) - pattern += "/" - } - - method := mALL - subroutes, _ := handler.(Routes) - if subroutes != nil { - method |= mSTUB - } - n := mx.handle(method, pattern+"*", mountHandler) - - if subroutes != nil { - n.subroutes = subroutes - } -} - -// Routes returns a slice of routing information from the tree, -// useful for traversing available routes of a router. -func (mx *Mux) Routes() []Route { - return mx.tree.routes() -} - -// Middlewares returns a slice of middleware handler functions. -func (mx *Mux) Middlewares() Middlewares { - return mx.middlewares -} - -// Match searches the routing tree for a handler that matches the method/path. -// It's similar to routing a http request, but without executing the handler -// thereafter. -// -// Note: the *Context state is updated during execution, so manage -// the state carefully or make a NewRouteContext(). -func (mx *Mux) Match(rctx *Context, method, path string) bool { - m, ok := methodMap[method] - if !ok { - return false - } - - node, _, h := mx.tree.FindRoute(rctx, m, path) - - if node != nil && node.subroutes != nil { - rctx.RoutePath = mx.nextRoutePath(rctx) - return node.subroutes.Match(rctx, method, rctx.RoutePath) - } - - return h != nil -} - -// NotFoundHandler returns the default Mux 404 responder whenever a route -// cannot be found. -func (mx *Mux) NotFoundHandler() http.HandlerFunc { - if mx.notFoundHandler != nil { - return mx.notFoundHandler - } - return http.NotFound -} - -// MethodNotAllowedHandler returns the default Mux 405 responder whenever -// a method cannot be resolved for a route. -func (mx *Mux) MethodNotAllowedHandler() http.HandlerFunc { - if mx.methodNotAllowedHandler != nil { - return mx.methodNotAllowedHandler - } - return methodNotAllowedHandler -} - -// buildRouteHandler builds the single mux handler that is a chain of the middleware -// stack, as defined by calls to Use(), and the tree router (Mux) itself. After this -// point, no other middlewares can be registered on this Mux's stack. But you can still -// compose additional middlewares via Group()'s or using a chained middleware handler. -func (mx *Mux) buildRouteHandler() { - mx.handler = chain(mx.middlewares, http.HandlerFunc(mx.routeHTTP)) -} - -// handle registers a http.Handler in the routing tree for a particular http method -// and routing pattern. -func (mx *Mux) handle(method methodTyp, pattern string, handler http.Handler) *node { - if len(pattern) == 0 || pattern[0] != '/' { - panic(fmt.Sprintf("chi: routing pattern must begin with '/' in '%s'", pattern)) - } - - // Build the computed routing handler for this routing pattern. - if !mx.inline && mx.handler == nil { - mx.buildRouteHandler() - } - - // Build endpoint handler with inline middlewares for the route - var h http.Handler - if mx.inline { - mx.handler = http.HandlerFunc(mx.routeHTTP) - h = Chain(mx.middlewares...).Handler(handler) - } else { - h = handler - } - - // Add the endpoint to the tree and return the node - return mx.tree.InsertRoute(method, pattern, h) -} - -// routeHTTP routes a http.Request through the Mux routing tree to serve -// the matching handler for a particular http method. -func (mx *Mux) routeHTTP(w http.ResponseWriter, r *http.Request) { - // Grab the route context object - rctx := r.Context().Value(RouteCtxKey).(*Context) - - // The request routing path - routePath := rctx.RoutePath - if routePath == "" { - if r.URL.RawPath != "" { - routePath = r.URL.RawPath - } else { - routePath = r.URL.Path - } - } - - // Check if method is supported by chi - if rctx.RouteMethod == "" { - rctx.RouteMethod = r.Method - } - method, ok := methodMap[rctx.RouteMethod] - if !ok { - mx.MethodNotAllowedHandler().ServeHTTP(w, r) - return - } - - // Find the route - if _, _, h := mx.tree.FindRoute(rctx, method, routePath); h != nil { - h.ServeHTTP(w, r) - return - } - if rctx.methodNotAllowed { - mx.MethodNotAllowedHandler().ServeHTTP(w, r) - } else { - mx.NotFoundHandler().ServeHTTP(w, r) - } -} - -func (mx *Mux) nextRoutePath(rctx *Context) string { - routePath := "/" - nx := len(rctx.routeParams.Keys) - 1 // index of last param in list - if nx >= 0 && rctx.routeParams.Keys[nx] == "*" && len(rctx.routeParams.Values) > nx { - routePath = "/" + rctx.routeParams.Values[nx] - } - return routePath -} - -// Recursively update data on child routers. -func (mx *Mux) updateSubRoutes(fn func(subMux *Mux)) { - for _, r := range mx.tree.routes() { - subMux, ok := r.SubRoutes.(*Mux) - if !ok { - continue - } - fn(subMux) - } -} - -// methodNotAllowedHandler is a helper function to respond with a 405, -// method not allowed. -func methodNotAllowedHandler(w http.ResponseWriter, r *http.Request) { - w.WriteHeader(405) - w.Write(nil) -} diff --git a/vendor/github.com/go-chi/chi/tree.go b/vendor/github.com/go-chi/chi/tree.go deleted file mode 100644 index 59b5b5f7b0..0000000000 --- a/vendor/github.com/go-chi/chi/tree.go +++ /dev/null @@ -1,865 +0,0 @@ -package chi - -// Radix tree implementation below is a based on the original work by -// Armon Dadgar in https://github.com/armon/go-radix/blob/master/radix.go -// (MIT licensed). It's been heavily modified for use as a HTTP routing tree. - -import ( - "fmt" - "math" - "net/http" - "regexp" - "sort" - "strconv" - "strings" -) - -type methodTyp int - -const ( - mSTUB methodTyp = 1 << iota - mCONNECT - mDELETE - mGET - mHEAD - mOPTIONS - mPATCH - mPOST - mPUT - mTRACE -) - -var mALL = mCONNECT | mDELETE | mGET | mHEAD | - mOPTIONS | mPATCH | mPOST | mPUT | mTRACE - -var methodMap = map[string]methodTyp{ - http.MethodConnect: mCONNECT, - http.MethodDelete: mDELETE, - http.MethodGet: mGET, - http.MethodHead: mHEAD, - http.MethodOptions: mOPTIONS, - http.MethodPatch: mPATCH, - http.MethodPost: mPOST, - http.MethodPut: mPUT, - http.MethodTrace: mTRACE, -} - -// RegisterMethod adds support for custom HTTP method handlers, available -// via Router#Method and Router#MethodFunc -func RegisterMethod(method string) { - if method == "" { - return - } - method = strings.ToUpper(method) - if _, ok := methodMap[method]; ok { - return - } - n := len(methodMap) - if n > strconv.IntSize { - panic(fmt.Sprintf("chi: max number of methods reached (%d)", strconv.IntSize)) - } - mt := methodTyp(math.Exp2(float64(n))) - methodMap[method] = mt - mALL |= mt -} - -type nodeTyp uint8 - -const ( - ntStatic nodeTyp = iota // /home - ntRegexp // /{id:[0-9]+} - ntParam // /{user} - ntCatchAll // /api/v1/* -) - -type node struct { - // node type: static, regexp, param, catchAll - typ nodeTyp - - // first byte of the prefix - label byte - - // first byte of the child prefix - tail byte - - // prefix is the common prefix we ignore - prefix string - - // regexp matcher for regexp nodes - rex *regexp.Regexp - - // HTTP handler endpoints on the leaf node - endpoints endpoints - - // subroutes on the leaf node - subroutes Routes - - // child nodes should be stored in-order for iteration, - // in groups of the node type. - children [ntCatchAll + 1]nodes -} - -// endpoints is a mapping of http method constants to handlers -// for a given route. -type endpoints map[methodTyp]*endpoint - -type endpoint struct { - // endpoint handler - handler http.Handler - - // pattern is the routing pattern for handler nodes - pattern string - - // parameter keys recorded on handler nodes - paramKeys []string -} - -func (s endpoints) Value(method methodTyp) *endpoint { - mh, ok := s[method] - if !ok { - mh = &endpoint{} - s[method] = mh - } - return mh -} - -func (n *node) InsertRoute(method methodTyp, pattern string, handler http.Handler) *node { - var parent *node - search := pattern - - for { - // Handle key exhaustion - if len(search) == 0 { - // Insert or update the node's leaf handler - n.setEndpoint(method, handler, pattern) - return n - } - - // We're going to be searching for a wild node next, - // in this case, we need to get the tail - var label = search[0] - var segTail byte - var segEndIdx int - var segTyp nodeTyp - var segRexpat string - if label == '{' || label == '*' { - segTyp, _, segRexpat, segTail, _, segEndIdx = patNextSegment(search) - } - - var prefix string - if segTyp == ntRegexp { - prefix = segRexpat - } - - // Look for the edge to attach to - parent = n - n = n.getEdge(segTyp, label, segTail, prefix) - - // No edge, create one - if n == nil { - child := &node{label: label, tail: segTail, prefix: search} - hn := parent.addChild(child, search) - hn.setEndpoint(method, handler, pattern) - - return hn - } - - // Found an edge to match the pattern - - if n.typ > ntStatic { - // We found a param node, trim the param from the search path and continue. - // This param/wild pattern segment would already be on the tree from a previous - // call to addChild when creating a new node. - search = search[segEndIdx:] - continue - } - - // Static nodes fall below here. - // Determine longest prefix of the search key on match. - commonPrefix := longestPrefix(search, n.prefix) - if commonPrefix == len(n.prefix) { - // the common prefix is as long as the current node's prefix we're attempting to insert. - // keep the search going. - search = search[commonPrefix:] - continue - } - - // Split the node - child := &node{ - typ: ntStatic, - prefix: search[:commonPrefix], - } - parent.replaceChild(search[0], segTail, child) - - // Restore the existing node - n.label = n.prefix[commonPrefix] - n.prefix = n.prefix[commonPrefix:] - child.addChild(n, n.prefix) - - // If the new key is a subset, set the method/handler on this node and finish. - search = search[commonPrefix:] - if len(search) == 0 { - child.setEndpoint(method, handler, pattern) - return child - } - - // Create a new edge for the node - subchild := &node{ - typ: ntStatic, - label: search[0], - prefix: search, - } - hn := child.addChild(subchild, search) - hn.setEndpoint(method, handler, pattern) - return hn - } -} - -// addChild appends the new `child` node to the tree using the `pattern` as the trie key. -// For a URL router like chi's, we split the static, param, regexp and wildcard segments -// into different nodes. In addition, addChild will recursively call itself until every -// pattern segment is added to the url pattern tree as individual nodes, depending on type. -func (n *node) addChild(child *node, prefix string) *node { - search := prefix - - // handler leaf node added to the tree is the child. - // this may be overridden later down the flow - hn := child - - // Parse next segment - segTyp, _, segRexpat, segTail, segStartIdx, segEndIdx := patNextSegment(search) - - // Add child depending on next up segment - switch segTyp { - - case ntStatic: - // Search prefix is all static (that is, has no params in path) - // noop - - default: - // Search prefix contains a param, regexp or wildcard - - if segTyp == ntRegexp { - rex, err := regexp.Compile(segRexpat) - if err != nil { - panic(fmt.Sprintf("chi: invalid regexp pattern '%s' in route param", segRexpat)) - } - child.prefix = segRexpat - child.rex = rex - } - - if segStartIdx == 0 { - // Route starts with a param - child.typ = segTyp - - if segTyp == ntCatchAll { - segStartIdx = -1 - } else { - segStartIdx = segEndIdx - } - if segStartIdx < 0 { - segStartIdx = len(search) - } - child.tail = segTail // for params, we set the tail - - if segStartIdx != len(search) { - // add static edge for the remaining part, split the end. - // its not possible to have adjacent param nodes, so its certainly - // going to be a static node next. - - search = search[segStartIdx:] // advance search position - - nn := &node{ - typ: ntStatic, - label: search[0], - prefix: search, - } - hn = child.addChild(nn, search) - } - - } else if segStartIdx > 0 { - // Route has some param - - // starts with a static segment - child.typ = ntStatic - child.prefix = search[:segStartIdx] - child.rex = nil - - // add the param edge node - search = search[segStartIdx:] - - nn := &node{ - typ: segTyp, - label: search[0], - tail: segTail, - } - hn = child.addChild(nn, search) - - } - } - - n.children[child.typ] = append(n.children[child.typ], child) - n.children[child.typ].Sort() - return hn -} - -func (n *node) replaceChild(label, tail byte, child *node) { - for i := 0; i < len(n.children[child.typ]); i++ { - if n.children[child.typ][i].label == label && n.children[child.typ][i].tail == tail { - n.children[child.typ][i] = child - n.children[child.typ][i].label = label - n.children[child.typ][i].tail = tail - return - } - } - panic("chi: replacing missing child") -} - -func (n *node) getEdge(ntyp nodeTyp, label, tail byte, prefix string) *node { - nds := n.children[ntyp] - for i := 0; i < len(nds); i++ { - if nds[i].label == label && nds[i].tail == tail { - if ntyp == ntRegexp && nds[i].prefix != prefix { - continue - } - return nds[i] - } - } - return nil -} - -func (n *node) setEndpoint(method methodTyp, handler http.Handler, pattern string) { - // Set the handler for the method type on the node - if n.endpoints == nil { - n.endpoints = make(endpoints) - } - - paramKeys := patParamKeys(pattern) - - if method&mSTUB == mSTUB { - n.endpoints.Value(mSTUB).handler = handler - } - if method&mALL == mALL { - h := n.endpoints.Value(mALL) - h.handler = handler - h.pattern = pattern - h.paramKeys = paramKeys - for _, m := range methodMap { - h := n.endpoints.Value(m) - h.handler = handler - h.pattern = pattern - h.paramKeys = paramKeys - } - } else { - h := n.endpoints.Value(method) - h.handler = handler - h.pattern = pattern - h.paramKeys = paramKeys - } -} - -func (n *node) FindRoute(rctx *Context, method methodTyp, path string) (*node, endpoints, http.Handler) { - // Reset the context routing pattern and params - rctx.routePattern = "" - rctx.routeParams.Keys = rctx.routeParams.Keys[:0] - rctx.routeParams.Values = rctx.routeParams.Values[:0] - - // Find the routing handlers for the path - rn := n.findRoute(rctx, method, path) - if rn == nil { - return nil, nil, nil - } - - // Record the routing params in the request lifecycle - rctx.URLParams.Keys = append(rctx.URLParams.Keys, rctx.routeParams.Keys...) - rctx.URLParams.Values = append(rctx.URLParams.Values, rctx.routeParams.Values...) - - // Record the routing pattern in the request lifecycle - if rn.endpoints[method].pattern != "" { - rctx.routePattern = rn.endpoints[method].pattern - rctx.RoutePatterns = append(rctx.RoutePatterns, rctx.routePattern) - } - - return rn, rn.endpoints, rn.endpoints[method].handler -} - -// Recursive edge traversal by checking all nodeTyp groups along the way. -// It's like searching through a multi-dimensional radix trie. -func (n *node) findRoute(rctx *Context, method methodTyp, path string) *node { - nn := n - search := path - - for t, nds := range nn.children { - ntyp := nodeTyp(t) - if len(nds) == 0 { - continue - } - - var xn *node - xsearch := search - - var label byte - if search != "" { - label = search[0] - } - - switch ntyp { - case ntStatic: - xn = nds.findEdge(label) - if xn == nil || !strings.HasPrefix(xsearch, xn.prefix) { - continue - } - xsearch = xsearch[len(xn.prefix):] - - case ntParam, ntRegexp: - // short-circuit and return no matching route for empty param values - if xsearch == "" { - continue - } - - // serially loop through each node grouped by the tail delimiter - for idx := 0; idx < len(nds); idx++ { - xn = nds[idx] - - // label for param nodes is the delimiter byte - p := strings.IndexByte(xsearch, xn.tail) - - if p < 0 { - if xn.tail == '/' { - p = len(xsearch) - } else { - continue - } - } - - if ntyp == ntRegexp && xn.rex != nil { - if !xn.rex.Match([]byte(xsearch[:p])) { - continue - } - } else if strings.IndexByte(xsearch[:p], '/') != -1 { - // avoid a match across path segments - continue - } - - prevlen := len(rctx.routeParams.Values) - rctx.routeParams.Values = append(rctx.routeParams.Values, xsearch[:p]) - xsearch = xsearch[p:] - - if len(xsearch) == 0 { - if xn.isLeaf() { - h := xn.endpoints[method] - if h != nil && h.handler != nil { - rctx.routeParams.Keys = append(rctx.routeParams.Keys, h.paramKeys...) - return xn - } - - // flag that the routing context found a route, but not a corresponding - // supported method - rctx.methodNotAllowed = true - } - } - - // recursively find the next node on this branch - fin := xn.findRoute(rctx, method, xsearch) - if fin != nil { - return fin - } - - // not found on this branch, reset vars - rctx.routeParams.Values = rctx.routeParams.Values[:prevlen] - xsearch = search - } - - rctx.routeParams.Values = append(rctx.routeParams.Values, "") - - default: - // catch-all nodes - rctx.routeParams.Values = append(rctx.routeParams.Values, search) - xn = nds[0] - xsearch = "" - } - - if xn == nil { - continue - } - - // did we find it yet? - if len(xsearch) == 0 { - if xn.isLeaf() { - h := xn.endpoints[method] - if h != nil && h.handler != nil { - rctx.routeParams.Keys = append(rctx.routeParams.Keys, h.paramKeys...) - return xn - } - - // flag that the routing context found a route, but not a corresponding - // supported method - rctx.methodNotAllowed = true - } - } - - // recursively find the next node.. - fin := xn.findRoute(rctx, method, xsearch) - if fin != nil { - return fin - } - - // Did not find final handler, let's remove the param here if it was set - if xn.typ > ntStatic { - if len(rctx.routeParams.Values) > 0 { - rctx.routeParams.Values = rctx.routeParams.Values[:len(rctx.routeParams.Values)-1] - } - } - - } - - return nil -} - -func (n *node) findEdge(ntyp nodeTyp, label byte) *node { - nds := n.children[ntyp] - num := len(nds) - idx := 0 - - switch ntyp { - case ntStatic, ntParam, ntRegexp: - i, j := 0, num-1 - for i <= j { - idx = i + (j-i)/2 - if label > nds[idx].label { - i = idx + 1 - } else if label < nds[idx].label { - j = idx - 1 - } else { - i = num // breaks cond - } - } - if nds[idx].label != label { - return nil - } - return nds[idx] - - default: // catch all - return nds[idx] - } -} - -func (n *node) isLeaf() bool { - return n.endpoints != nil -} - -func (n *node) findPattern(pattern string) bool { - nn := n - for _, nds := range nn.children { - if len(nds) == 0 { - continue - } - - n = nn.findEdge(nds[0].typ, pattern[0]) - if n == nil { - continue - } - - var idx int - var xpattern string - - switch n.typ { - case ntStatic: - idx = longestPrefix(pattern, n.prefix) - if idx < len(n.prefix) { - continue - } - - case ntParam, ntRegexp: - idx = strings.IndexByte(pattern, '}') + 1 - - case ntCatchAll: - idx = longestPrefix(pattern, "*") - - default: - panic("chi: unknown node type") - } - - xpattern = pattern[idx:] - if len(xpattern) == 0 { - return true - } - - return n.findPattern(xpattern) - } - return false -} - -func (n *node) routes() []Route { - rts := []Route{} - - n.walk(func(eps endpoints, subroutes Routes) bool { - if eps[mSTUB] != nil && eps[mSTUB].handler != nil && subroutes == nil { - return false - } - - // Group methodHandlers by unique patterns - pats := make(map[string]endpoints) - - for mt, h := range eps { - if h.pattern == "" { - continue - } - p, ok := pats[h.pattern] - if !ok { - p = endpoints{} - pats[h.pattern] = p - } - p[mt] = h - } - - for p, mh := range pats { - hs := make(map[string]http.Handler) - if mh[mALL] != nil && mh[mALL].handler != nil { - hs["*"] = mh[mALL].handler - } - - for mt, h := range mh { - if h.handler == nil { - continue - } - m := methodTypString(mt) - if m == "" { - continue - } - hs[m] = h.handler - } - - rt := Route{p, hs, subroutes} - rts = append(rts, rt) - } - - return false - }) - - return rts -} - -func (n *node) walk(fn func(eps endpoints, subroutes Routes) bool) bool { - // Visit the leaf values if any - if (n.endpoints != nil || n.subroutes != nil) && fn(n.endpoints, n.subroutes) { - return true - } - - // Recurse on the children - for _, ns := range n.children { - for _, cn := range ns { - if cn.walk(fn) { - return true - } - } - } - return false -} - -// patNextSegment returns the next segment details from a pattern: -// node type, param key, regexp string, param tail byte, param starting index, param ending index -func patNextSegment(pattern string) (nodeTyp, string, string, byte, int, int) { - ps := strings.Index(pattern, "{") - ws := strings.Index(pattern, "*") - - if ps < 0 && ws < 0 { - return ntStatic, "", "", 0, 0, len(pattern) // we return the entire thing - } - - // Sanity check - if ps >= 0 && ws >= 0 && ws < ps { - panic("chi: wildcard '*' must be the last pattern in a route, otherwise use a '{param}'") - } - - var tail byte = '/' // Default endpoint tail to / byte - - if ps >= 0 { - // Param/Regexp pattern is next - nt := ntParam - - // Read to closing } taking into account opens and closes in curl count (cc) - cc := 0 - pe := ps - for i, c := range pattern[ps:] { - if c == '{' { - cc++ - } else if c == '}' { - cc-- - if cc == 0 { - pe = ps + i - break - } - } - } - if pe == ps { - panic("chi: route param closing delimiter '}' is missing") - } - - key := pattern[ps+1 : pe] - pe++ // set end to next position - - if pe < len(pattern) { - tail = pattern[pe] - } - - var rexpat string - if idx := strings.Index(key, ":"); idx >= 0 { - nt = ntRegexp - rexpat = key[idx+1:] - key = key[:idx] - } - - if len(rexpat) > 0 { - if rexpat[0] != '^' { - rexpat = "^" + rexpat - } - if rexpat[len(rexpat)-1] != '$' { - rexpat += "$" - } - } - - return nt, key, rexpat, tail, ps, pe - } - - // Wildcard pattern as finale - if ws < len(pattern)-1 { - panic("chi: wildcard '*' must be the last value in a route. trim trailing text or use a '{param}' instead") - } - return ntCatchAll, "*", "", 0, ws, len(pattern) -} - -func patParamKeys(pattern string) []string { - pat := pattern - paramKeys := []string{} - for { - ptyp, paramKey, _, _, _, e := patNextSegment(pat) - if ptyp == ntStatic { - return paramKeys - } - for i := 0; i < len(paramKeys); i++ { - if paramKeys[i] == paramKey { - panic(fmt.Sprintf("chi: routing pattern '%s' contains duplicate param key, '%s'", pattern, paramKey)) - } - } - paramKeys = append(paramKeys, paramKey) - pat = pat[e:] - } -} - -// longestPrefix finds the length of the shared prefix -// of two strings -func longestPrefix(k1, k2 string) int { - max := len(k1) - if l := len(k2); l < max { - max = l - } - var i int - for i = 0; i < max; i++ { - if k1[i] != k2[i] { - break - } - } - return i -} - -func methodTypString(method methodTyp) string { - for s, t := range methodMap { - if method == t { - return s - } - } - return "" -} - -type nodes []*node - -// Sort the list of nodes by label -func (ns nodes) Sort() { sort.Sort(ns); ns.tailSort() } -func (ns nodes) Len() int { return len(ns) } -func (ns nodes) Swap(i, j int) { ns[i], ns[j] = ns[j], ns[i] } -func (ns nodes) Less(i, j int) bool { return ns[i].label < ns[j].label } - -// tailSort pushes nodes with '/' as the tail to the end of the list for param nodes. -// The list order determines the traversal order. -func (ns nodes) tailSort() { - for i := len(ns) - 1; i >= 0; i-- { - if ns[i].typ > ntStatic && ns[i].tail == '/' { - ns.Swap(i, len(ns)-1) - return - } - } -} - -func (ns nodes) findEdge(label byte) *node { - num := len(ns) - idx := 0 - i, j := 0, num-1 - for i <= j { - idx = i + (j-i)/2 - if label > ns[idx].label { - i = idx + 1 - } else if label < ns[idx].label { - j = idx - 1 - } else { - i = num // breaks cond - } - } - if ns[idx].label != label { - return nil - } - return ns[idx] -} - -// Route describes the details of a routing handler. -// Handlers map key is an HTTP method -type Route struct { - Pattern string - Handlers map[string]http.Handler - SubRoutes Routes -} - -// WalkFunc is the type of the function called for each method and route visited by Walk. -type WalkFunc func(method string, route string, handler http.Handler, middlewares ...func(http.Handler) http.Handler) error - -// Walk walks any router tree that implements Routes interface. -func Walk(r Routes, walkFn WalkFunc) error { - return walk(r, walkFn, "") -} - -func walk(r Routes, walkFn WalkFunc, parentRoute string, parentMw ...func(http.Handler) http.Handler) error { - for _, route := range r.Routes() { - mws := make([]func(http.Handler) http.Handler, len(parentMw)) - copy(mws, parentMw) - mws = append(mws, r.Middlewares()...) - - if route.SubRoutes != nil { - if err := walk(route.SubRoutes, walkFn, parentRoute+route.Pattern, mws...); err != nil { - return err - } - continue - } - - for method, handler := range route.Handlers { - if method == "*" { - // Ignore a "catchAll" method, since we pass down all the specific methods for each route. - continue - } - - fullRoute := parentRoute + route.Pattern - fullRoute = strings.Replace(fullRoute, "/*/", "/", -1) - - if chain, ok := handler.(*ChainHandler); ok { - if err := walkFn(method, fullRoute, chain.Endpoint, append(mws, chain.Middlewares...)...); err != nil { - return err - } - } else { - if err := walkFn(method, fullRoute, handler, mws...); err != nil { - return err - } - } - } - } - - return nil -} diff --git a/vendor/github.com/go-chi/chi/v5/README.md b/vendor/github.com/go-chi/chi/v5/README.md index 21cbb0fc0a..7f662ab45f 100644 --- a/vendor/github.com/go-chi/chi/v5/README.md +++ b/vendor/github.com/go-chi/chi/v5/README.md @@ -65,7 +65,7 @@ func main() { **REST Preview:** -Here is a little preview of how routing looks like with chi. Also take a look at the generated routing docs +Here is a little preview of what routing looks like with chi. Also take a look at the generated routing docs in JSON ([routes.json](https://github.com/go-chi/chi/blob/master/_examples/rest/routes.json)) and in Markdown ([routes.md](https://github.com/go-chi/chi/blob/master/_examples/rest/routes.md)). @@ -469,7 +469,8 @@ how setting context on a request in Go works. * Carl Jackson for https://github.com/zenazn/goji * Parts of chi's thinking comes from goji, and chi's middleware package - sources from goji. + sources from [goji](https://github.com/zenazn/goji/tree/master/web/middleware). + * Please see goji's [LICENSE](https://github.com/zenazn/goji/blob/master/LICENSE) (MIT) * Armon Dadgar for https://github.com/armon/go-radix * Contributions: [@VojtechVitek](https://github.com/VojtechVitek) diff --git a/vendor/github.com/go-chi/chi/v5/chi.go b/vendor/github.com/go-chi/chi/v5/chi.go index a1691bbeb1..fc32c4efe9 100644 --- a/vendor/github.com/go-chi/chi/v5/chi.go +++ b/vendor/github.com/go-chi/chi/v5/chi.go @@ -51,7 +51,7 @@ // "/user/{name}" matches "/user/jsmith" but not "/user/jsmith/info" or "/user/jsmith/" // "/user/{name}/info" matches "/user/jsmith/info" // "/page/*" matches "/page/intro/latest" -// "/page/{other}/index" also matches "/page/intro/latest" +// "/page/{other}/latest" also matches "/page/intro/latest" // "/date/{yyyy:\\d\\d\\d\\d}/{mm:\\d\\d}/{dd:\\d\\d}" matches "/date/2017/04/01" package chi @@ -127,6 +127,10 @@ type Routes interface { // the method/path - similar to routing a http request, but without // executing the handler thereafter. Match(rctx *Context, method, path string) bool + + // Find searches the routing tree for the pattern that matches + // the method/path. + Find(rctx *Context, method, path string) string } // Middlewares type is a slice of standard middleware handlers with methods diff --git a/vendor/github.com/go-chi/chi/v5/context.go b/vendor/github.com/go-chi/chi/v5/context.go index e2cd908d72..aacf6eff72 100644 --- a/vendor/github.com/go-chi/chi/v5/context.go +++ b/vendor/github.com/go-chi/chi/v5/context.go @@ -109,7 +109,7 @@ func (x *Context) URLParam(key string) string { // RoutePattern builds the routing pattern string for the particular // request, at the particular point during routing. This means, the value // will change throughout the execution of a request in a router. That is -// why its advised to only use this value after calling the next handler. +// why it's advised to only use this value after calling the next handler. // // For example, // @@ -121,6 +121,9 @@ func (x *Context) URLParam(key string) string { // }) // } func (x *Context) RoutePattern() string { + if x == nil { + return "" + } routePattern := strings.Join(x.RoutePatterns, "") routePattern = replaceWildcards(routePattern) if routePattern != "/" { diff --git a/vendor/github.com/go-chi/chi/v5/middleware/content_type.go b/vendor/github.com/go-chi/chi/v5/middleware/content_type.go index 023978fac0..e61ff26403 100644 --- a/vendor/github.com/go-chi/chi/v5/middleware/content_type.go +++ b/vendor/github.com/go-chi/chi/v5/middleware/content_type.go @@ -6,36 +6,32 @@ import ( ) // SetHeader is a convenience handler to set a response header key/value -func SetHeader(key, value string) func(next http.Handler) http.Handler { +func SetHeader(key, value string) func(http.Handler) http.Handler { return func(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { + return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { w.Header().Set(key, value) next.ServeHTTP(w, r) - } - return http.HandlerFunc(fn) + }) } } // AllowContentType enforces a whitelist of request Content-Types otherwise responds // with a 415 Unsupported Media Type status. -func AllowContentType(contentTypes ...string) func(next http.Handler) http.Handler { +func AllowContentType(contentTypes ...string) func(http.Handler) http.Handler { allowedContentTypes := make(map[string]struct{}, len(contentTypes)) for _, ctype := range contentTypes { allowedContentTypes[strings.TrimSpace(strings.ToLower(ctype))] = struct{}{} } return func(next http.Handler) http.Handler { - fn := func(w http.ResponseWriter, r *http.Request) { + return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { if r.ContentLength == 0 { - // skip check for empty content body + // Skip check for empty content body next.ServeHTTP(w, r) return } - s := strings.ToLower(strings.TrimSpace(r.Header.Get("Content-Type"))) - if i := strings.Index(s, ";"); i > -1 { - s = s[0:i] - } + s := strings.ToLower(strings.TrimSpace(strings.Split(r.Header.Get("Content-Type"), ";")[0])) if _, ok := allowedContentTypes[s]; ok { next.ServeHTTP(w, r) @@ -43,7 +39,7 @@ func AllowContentType(contentTypes ...string) func(next http.Handler) http.Handl } w.WriteHeader(http.StatusUnsupportedMediaType) - } - return http.HandlerFunc(fn) + }) } } + diff --git a/vendor/github.com/go-chi/chi/v5/middleware/strip.go b/vendor/github.com/go-chi/chi/v5/middleware/strip.go index ce8ebfccea..1368fa7ab7 100644 --- a/vendor/github.com/go-chi/chi/v5/middleware/strip.go +++ b/vendor/github.com/go-chi/chi/v5/middleware/strip.go @@ -60,3 +60,11 @@ func RedirectSlashes(next http.Handler) http.Handler { } return http.HandlerFunc(fn) } + +// StripPrefix is a middleware that will strip the provided prefix from the +// request path before handing the request over to the next handler. +func StripPrefix(prefix string) func(http.Handler) http.Handler { + return func(next http.Handler) http.Handler { + return http.StripPrefix(prefix, next) + } +} diff --git a/vendor/github.com/go-chi/chi/v5/middleware/throttle.go b/vendor/github.com/go-chi/chi/v5/middleware/throttle.go index bdf4f9f187..9a870d88b6 100644 --- a/vendor/github.com/go-chi/chi/v5/middleware/throttle.go +++ b/vendor/github.com/go-chi/chi/v5/middleware/throttle.go @@ -22,11 +22,12 @@ type ThrottleOpts struct { Limit int BacklogLimit int BacklogTimeout time.Duration + StatusCode int } // Throttle is a middleware that limits number of currently processed requests // at a time across all users. Note: Throttle is not a rate-limiter per user, -// instead it just puts a ceiling on the number of currently in-flight requests +// instead it just puts a ceiling on the number of current in-flight requests // being processed from the point from where the Throttle middleware is mounted. func Throttle(limit int) func(http.Handler) http.Handler { return ThrottleWithOpts(ThrottleOpts{Limit: limit, BacklogTimeout: defaultBacklogTimeout}) @@ -49,10 +50,16 @@ func ThrottleWithOpts(opts ThrottleOpts) func(http.Handler) http.Handler { panic("chi/middleware: Throttle expects backlogLimit to be positive") } + statusCode := opts.StatusCode + if statusCode == 0 { + statusCode = http.StatusTooManyRequests + } + t := throttler{ tokens: make(chan token, opts.Limit), backlogTokens: make(chan token, opts.Limit+opts.BacklogLimit), backlogTimeout: opts.BacklogTimeout, + statusCode: statusCode, retryAfterFn: opts.RetryAfterFn, } @@ -72,7 +79,7 @@ func ThrottleWithOpts(opts ThrottleOpts) func(http.Handler) http.Handler { case <-ctx.Done(): t.setRetryAfterHeaderIfNeeded(w, true) - http.Error(w, errContextCanceled, http.StatusTooManyRequests) + http.Error(w, errContextCanceled, t.statusCode) return case btok := <-t.backlogTokens: @@ -85,12 +92,12 @@ func ThrottleWithOpts(opts ThrottleOpts) func(http.Handler) http.Handler { select { case <-timer.C: t.setRetryAfterHeaderIfNeeded(w, false) - http.Error(w, errTimedOut, http.StatusTooManyRequests) + http.Error(w, errTimedOut, t.statusCode) return case <-ctx.Done(): timer.Stop() t.setRetryAfterHeaderIfNeeded(w, true) - http.Error(w, errContextCanceled, http.StatusTooManyRequests) + http.Error(w, errContextCanceled, t.statusCode) return case tok := <-t.tokens: defer func() { @@ -103,7 +110,7 @@ func ThrottleWithOpts(opts ThrottleOpts) func(http.Handler) http.Handler { default: t.setRetryAfterHeaderIfNeeded(w, false) - http.Error(w, errCapacityExceeded, http.StatusTooManyRequests) + http.Error(w, errCapacityExceeded, t.statusCode) return } } @@ -119,8 +126,9 @@ type token struct{} type throttler struct { tokens chan token backlogTokens chan token - retryAfterFn func(ctxDone bool) time.Duration backlogTimeout time.Duration + statusCode int + retryAfterFn func(ctxDone bool) time.Duration } // setRetryAfterHeaderIfNeeded sets Retry-After HTTP header if corresponding retryAfterFn option of throttler is initialized. diff --git a/vendor/github.com/go-chi/chi/v5/middleware/wrap_writer.go b/vendor/github.com/go-chi/chi/v5/middleware/wrap_writer.go index bf27088189..12d4faf017 100644 --- a/vendor/github.com/go-chi/chi/v5/middleware/wrap_writer.go +++ b/vendor/github.com/go-chi/chi/v5/middleware/wrap_writer.go @@ -81,7 +81,11 @@ type basicWriter struct { } func (b *basicWriter) WriteHeader(code int) { - if !b.wroteHeader { + if code >= 100 && code <= 199 && code != http.StatusSwitchingProtocols { + if !b.discard { + b.ResponseWriter.WriteHeader(code) + } + } else if !b.wroteHeader { b.code = code b.wroteHeader = true if !b.discard { diff --git a/vendor/github.com/go-chi/chi/v5/mux.go b/vendor/github.com/go-chi/chi/v5/mux.go index 6dc1904d9b..91daf691e9 100644 --- a/vendor/github.com/go-chi/chi/v5/mux.go +++ b/vendor/github.com/go-chi/chi/v5/mux.go @@ -363,19 +363,40 @@ func (mx *Mux) Middlewares() Middlewares { // Note: the *Context state is updated during execution, so manage // the state carefully or make a NewRouteContext(). func (mx *Mux) Match(rctx *Context, method, path string) bool { + return mx.Find(rctx, method, path) != "" +} + +// Find searches the routing tree for the pattern that matches +// the method/path. +// +// Note: the *Context state is updated during execution, so manage +// the state carefully or make a NewRouteContext(). +func (mx *Mux) Find(rctx *Context, method, path string) string { m, ok := methodMap[method] if !ok { - return false + return "" } - node, _, h := mx.tree.FindRoute(rctx, m, path) + node, _, _ := mx.tree.FindRoute(rctx, m, path) + pattern := rctx.routePattern + + if node != nil { + if node.subroutes == nil { + e := node.endpoints[m] + return e.pattern + } - if node != nil && node.subroutes != nil { rctx.RoutePath = mx.nextRoutePath(rctx) - return node.subroutes.Match(rctx, method, rctx.RoutePath) + subPattern := node.subroutes.Find(rctx, method, rctx.RoutePath) + if subPattern == "" { + return "" + } + + pattern = strings.TrimSuffix(pattern, "/*") + pattern += subPattern } - return h != nil + return pattern } // NotFoundHandler returns the default Mux 404 responder whenever a route diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index 21508edbdb..f06ba51c56 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -281,6 +281,7 @@ Exit Code 1 | AMXBF16 | Tile computational operations on BFLOAT16 numbers | | AMXINT8 | Tile computational operations on 8-bit integers | | AMXFP16 | Tile computational operations on FP16 numbers | +| AMXFP8 | Tile computational operations on FP8 numbers | | AMXTILE | Tile architecture | | APX_F | Intel APX | | AVX | AVX functions | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 53bc18ca71..db99eb62f7 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -55,6 +55,12 @@ const ( Qualcomm Marvell + QEMU + QNX + ACRN + SRE + Apple + lastVendor ) @@ -75,6 +81,7 @@ const ( AMXBF16 // Tile computational operations on BFLOAT16 numbers AMXFP16 // Tile computational operations on FP16 numbers AMXINT8 // Tile computational operations on 8-bit integers + AMXFP8 // Tile computational operations on FP8 numbers AMXTILE // Tile architecture APX_F // Intel APX AVX // AVX functions @@ -296,20 +303,22 @@ const ( // CPUInfo contains information about the detected system CPU. type CPUInfo struct { - BrandName string // Brand name reported by the CPU - VendorID Vendor // Comparable CPU vendor ID - VendorString string // Raw vendor string. - featureSet flagSet // Features of the CPU - PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. - ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. - LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. - Family int // CPU family number - Model int // CPU model number - Stepping int // CPU stepping info - CacheLine int // Cache line size in bytes. Will be 0 if undetectable. - Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. - BoostFreq int64 // Max clock speed, if known, 0 otherwise - Cache struct { + BrandName string // Brand name reported by the CPU + VendorID Vendor // Comparable CPU vendor ID + VendorString string // Raw vendor string. + HypervisorVendorID Vendor // Hypervisor vendor + HypervisorVendorString string // Raw hypervisor vendor string + featureSet flagSet // Features of the CPU + PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. + ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. + LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. + Family int // CPU family number + Model int // CPU model number + Stepping int // CPU stepping info + CacheLine int // Cache line size in bytes. Will be 0 if undetectable. + Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. + BoostFreq int64 // Max clock speed, if known, 0 otherwise + Cache struct { L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected L2 int // L2 Cache (per core or shared). Will be -1 if undetected @@ -318,8 +327,9 @@ type CPUInfo struct { SGX SGXSupport AMDMemEncryption AMDMemEncryptionSupport AVX10Level uint8 - maxFunc uint32 - maxExFunc uint32 + + maxFunc uint32 + maxExFunc uint32 } var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) @@ -503,7 +513,7 @@ func (c CPUInfo) FeatureSet() []string { // Uses the RDTSCP instruction. The value 0 is returned // if the CPU does not support the instruction. func (c CPUInfo) RTCounter() uint64 { - if !c.Supports(RDTSCP) { + if !c.Has(RDTSCP) { return 0 } a, _, _, d := rdtscpAsm() @@ -515,13 +525,22 @@ func (c CPUInfo) RTCounter() uint64 { // about the current cpu/core the code is running on. // If the RDTSCP instruction isn't supported on the CPU, the value 0 is returned. func (c CPUInfo) Ia32TscAux() uint32 { - if !c.Supports(RDTSCP) { + if !c.Has(RDTSCP) { return 0 } _, _, ecx, _ := rdtscpAsm() return ecx } +// SveLengths returns arm SVE vector and predicate lengths. +// Will return 0, 0 if SVE is not enabled or otherwise unable to detect. +func (c CPUInfo) SveLengths() (vl, pl uint64) { + if !c.Has(SVE) { + return 0, 0 + } + return getVectorLength() +} + // LogicalCPU will return the Logical CPU the code is currently executing on. // This is likely to change when the OS re-schedules the running thread // to another CPU. @@ -781,11 +800,16 @@ func threadsPerCore() int { _, b, _, _ := cpuidex(0xb, 0) if b&0xffff == 0 { if vend == AMD { - // Workaround for AMD returning 0, assume 2 if >= Zen 2 - // It will be more correct than not. + // if >= Zen 2 0x8000001e EBX 15-8 bits means threads per core. + // The number of threads per core is ThreadsPerCore+1 + // See PPR for AMD Family 17h Models 00h-0Fh (page 82) fam, _, _ := familyModel() _, _, _, d := cpuid(1) if (d&(1<<28)) != 0 && fam >= 23 { + if maxExtendedFunction() >= 0x8000001e { + _, b, _, _ := cpuid(0x8000001e) + return int((b>>8)&0xff) + 1 + } return 2 } } @@ -877,7 +901,9 @@ var vendorMapping = map[string]Vendor{ "GenuineTMx86": Transmeta, "Geode by NSC": NSC, "VIA VIA VIA ": VIA, - "KVMKVMKVMKVM": KVM, + "KVMKVMKVM": KVM, + "Linux KVM Hv": KVM, + "TCGTCGTCGTCG": QEMU, "Microsoft Hv": MSVM, "VMwareVMware": VMware, "XenVMMXenVMM": XenHVM, @@ -887,6 +913,10 @@ var vendorMapping = map[string]Vendor{ "SiS SiS SiS ": SiS, "RiseRiseRise": SiS, "Genuine RDC": RDC, + "QNXQVMBSQG": QNX, + "ACRNACRNACRN": ACRN, + "SRESRESRESRE": SRE, + "Apple VZ": Apple, } func vendorID() (Vendor, string) { @@ -899,6 +929,17 @@ func vendorID() (Vendor, string) { return vend, v } +func hypervisorVendorID() (Vendor, string) { + // https://lwn.net/Articles/301888/ + _, b, c, d := cpuid(0x40000000) + v := string(valAsString(b, c, d)) + vend, ok := vendorMapping[v] + if !ok { + return VendorUnknown, v + } + return vend, v +} + func cacheLine() int { if maxFunctionID() < 0x1 { return 0 @@ -1271,6 +1312,7 @@ func support() flagSet { fs.setIf(ebx&(1<<31) != 0, AVX512VL) // ecx fs.setIf(ecx&(1<<1) != 0, AVX512VBMI) + fs.setIf(ecx&(1<<3) != 0, AMXFP8) fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2) fs.setIf(ecx&(1<<11) != 0, AVX512VNNI) fs.setIf(ecx&(1<<12) != 0, AVX512BITALG) diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s index b31d6aec43..b196f78eb4 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s @@ -24,3 +24,13 @@ TEXT ·getInstAttributes(SB), 7, $0 MOVD R1, instAttrReg1+8(FP) RET +TEXT ·getVectorLength(SB), 7, $0 + WORD $0xd2800002 // mov x2, #0 + WORD $0x04225022 // addvl x2, x2, #1 + WORD $0xd37df042 // lsl x2, x2, #3 + WORD $0xd2800003 // mov x3, #0 + WORD $0x04635023 // addpl x3, x3, #1 + WORD $0xd37df063 // lsl x3, x3, #3 + MOVD R2, vl+0(FP) + MOVD R3, pl+8(FP) + RET diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go index 9a53504a04..566743d220 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go @@ -10,6 +10,7 @@ import "runtime" func getMidr() (midr uint64) func getProcFeatures() (procFeatures uint64) func getInstAttributes() (instAttrReg0, instAttrReg1 uint64) +func getVectorLength() (vl, pl uint64) func initCPU() { cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } @@ -24,7 +25,7 @@ func addInfo(c *CPUInfo, safe bool) { detectOS(c) // ARM64 disabled since it may crash if interrupt is not intercepted by OS. - if safe && !c.Supports(ARMCPUID) && runtime.GOOS != "freebsd" { + if safe && !c.Has(ARMCPUID) && runtime.GOOS != "freebsd" { return } midr := getMidr() diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go index 9636c2bc17..574f9389c0 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go @@ -10,6 +10,8 @@ func initCPU() { cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } xgetbv = func(uint32) (a, b uint32) { return 0, 0 } rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } + } func addInfo(info *CPUInfo, safe bool) {} +func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index 799b400c2e..f924c9d839 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -32,7 +32,10 @@ func addInfo(c *CPUInfo, safe bool) { c.LogicalCores = logicalCores() c.PhysicalCores = physicalCores() c.VendorID, c.VendorString = vendorID() + c.HypervisorVendorID, c.HypervisorVendorString = hypervisorVendorID() c.AVX10Level = c.supportAVX10() c.cacheSize() c.frequencies() } + +func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 3a25603103..e7f874a7e8 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -15,224 +15,225 @@ func _() { _ = x[AMXBF16-5] _ = x[AMXFP16-6] _ = x[AMXINT8-7] - _ = x[AMXTILE-8] - _ = x[APX_F-9] - _ = x[AVX-10] - _ = x[AVX10-11] - _ = x[AVX10_128-12] - _ = x[AVX10_256-13] - _ = x[AVX10_512-14] - _ = x[AVX2-15] - _ = x[AVX512BF16-16] - _ = x[AVX512BITALG-17] - _ = x[AVX512BW-18] - _ = x[AVX512CD-19] - _ = x[AVX512DQ-20] - _ = x[AVX512ER-21] - _ = x[AVX512F-22] - _ = x[AVX512FP16-23] - _ = x[AVX512IFMA-24] - _ = x[AVX512PF-25] - _ = x[AVX512VBMI-26] - _ = x[AVX512VBMI2-27] - _ = x[AVX512VL-28] - _ = x[AVX512VNNI-29] - _ = x[AVX512VP2INTERSECT-30] - _ = x[AVX512VPOPCNTDQ-31] - _ = x[AVXIFMA-32] - _ = x[AVXNECONVERT-33] - _ = x[AVXSLOW-34] - _ = x[AVXVNNI-35] - _ = x[AVXVNNIINT8-36] - _ = x[AVXVNNIINT16-37] - _ = x[BHI_CTRL-38] - _ = x[BMI1-39] - _ = x[BMI2-40] - _ = x[CETIBT-41] - _ = x[CETSS-42] - _ = x[CLDEMOTE-43] - _ = x[CLMUL-44] - _ = x[CLZERO-45] - _ = x[CMOV-46] - _ = x[CMPCCXADD-47] - _ = x[CMPSB_SCADBS_SHORT-48] - _ = x[CMPXCHG8-49] - _ = x[CPBOOST-50] - _ = x[CPPC-51] - _ = x[CX16-52] - _ = x[EFER_LMSLE_UNS-53] - _ = x[ENQCMD-54] - _ = x[ERMS-55] - _ = x[F16C-56] - _ = x[FLUSH_L1D-57] - _ = x[FMA3-58] - _ = x[FMA4-59] - _ = x[FP128-60] - _ = x[FP256-61] - _ = x[FSRM-62] - _ = x[FXSR-63] - _ = x[FXSROPT-64] - _ = x[GFNI-65] - _ = x[HLE-66] - _ = x[HRESET-67] - _ = x[HTT-68] - _ = x[HWA-69] - _ = x[HYBRID_CPU-70] - _ = x[HYPERVISOR-71] - _ = x[IA32_ARCH_CAP-72] - _ = x[IA32_CORE_CAP-73] - _ = x[IBPB-74] - _ = x[IBPB_BRTYPE-75] - _ = x[IBRS-76] - _ = x[IBRS_PREFERRED-77] - _ = x[IBRS_PROVIDES_SMP-78] - _ = x[IBS-79] - _ = x[IBSBRNTRGT-80] - _ = x[IBSFETCHSAM-81] - _ = x[IBSFFV-82] - _ = x[IBSOPCNT-83] - _ = x[IBSOPCNTEXT-84] - _ = x[IBSOPSAM-85] - _ = x[IBSRDWROPCNT-86] - _ = x[IBSRIPINVALIDCHK-87] - _ = x[IBS_FETCH_CTLX-88] - _ = x[IBS_OPDATA4-89] - _ = x[IBS_OPFUSE-90] - _ = x[IBS_PREVENTHOST-91] - _ = x[IBS_ZEN4-92] - _ = x[IDPRED_CTRL-93] - _ = x[INT_WBINVD-94] - _ = x[INVLPGB-95] - _ = x[KEYLOCKER-96] - _ = x[KEYLOCKERW-97] - _ = x[LAHF-98] - _ = x[LAM-99] - _ = x[LBRVIRT-100] - _ = x[LZCNT-101] - _ = x[MCAOVERFLOW-102] - _ = x[MCDT_NO-103] - _ = x[MCOMMIT-104] - _ = x[MD_CLEAR-105] - _ = x[MMX-106] - _ = x[MMXEXT-107] - _ = x[MOVBE-108] - _ = x[MOVDIR64B-109] - _ = x[MOVDIRI-110] - _ = x[MOVSB_ZL-111] - _ = x[MOVU-112] - _ = x[MPX-113] - _ = x[MSRIRC-114] - _ = x[MSRLIST-115] - _ = x[MSR_PAGEFLUSH-116] - _ = x[NRIPS-117] - _ = x[NX-118] - _ = x[OSXSAVE-119] - _ = x[PCONFIG-120] - _ = x[POPCNT-121] - _ = x[PPIN-122] - _ = x[PREFETCHI-123] - _ = x[PSFD-124] - _ = x[RDPRU-125] - _ = x[RDRAND-126] - _ = x[RDSEED-127] - _ = x[RDTSCP-128] - _ = x[RRSBA_CTRL-129] - _ = x[RTM-130] - _ = x[RTM_ALWAYS_ABORT-131] - _ = x[SBPB-132] - _ = x[SERIALIZE-133] - _ = x[SEV-134] - _ = x[SEV_64BIT-135] - _ = x[SEV_ALTERNATIVE-136] - _ = x[SEV_DEBUGSWAP-137] - _ = x[SEV_ES-138] - _ = x[SEV_RESTRICTED-139] - _ = x[SEV_SNP-140] - _ = x[SGX-141] - _ = x[SGXLC-142] - _ = x[SHA-143] - _ = x[SME-144] - _ = x[SME_COHERENT-145] - _ = x[SPEC_CTRL_SSBD-146] - _ = x[SRBDS_CTRL-147] - _ = x[SRSO_MSR_FIX-148] - _ = x[SRSO_NO-149] - _ = x[SRSO_USER_KERNEL_NO-150] - _ = x[SSE-151] - _ = x[SSE2-152] - _ = x[SSE3-153] - _ = x[SSE4-154] - _ = x[SSE42-155] - _ = x[SSE4A-156] - _ = x[SSSE3-157] - _ = x[STIBP-158] - _ = x[STIBP_ALWAYSON-159] - _ = x[STOSB_SHORT-160] - _ = x[SUCCOR-161] - _ = x[SVM-162] - _ = x[SVMDA-163] - _ = x[SVMFBASID-164] - _ = x[SVML-165] - _ = x[SVMNP-166] - _ = x[SVMPF-167] - _ = x[SVMPFT-168] - _ = x[SYSCALL-169] - _ = x[SYSEE-170] - _ = x[TBM-171] - _ = x[TDX_GUEST-172] - _ = x[TLB_FLUSH_NESTED-173] - _ = x[TME-174] - _ = x[TOPEXT-175] - _ = x[TSCRATEMSR-176] - _ = x[TSXLDTRK-177] - _ = x[VAES-178] - _ = x[VMCBCLEAN-179] - _ = x[VMPL-180] - _ = x[VMSA_REGPROT-181] - _ = x[VMX-182] - _ = x[VPCLMULQDQ-183] - _ = x[VTE-184] - _ = x[WAITPKG-185] - _ = x[WBNOINVD-186] - _ = x[WRMSRNS-187] - _ = x[X87-188] - _ = x[XGETBV1-189] - _ = x[XOP-190] - _ = x[XSAVE-191] - _ = x[XSAVEC-192] - _ = x[XSAVEOPT-193] - _ = x[XSAVES-194] - _ = x[AESARM-195] - _ = x[ARMCPUID-196] - _ = x[ASIMD-197] - _ = x[ASIMDDP-198] - _ = x[ASIMDHP-199] - _ = x[ASIMDRDM-200] - _ = x[ATOMICS-201] - _ = x[CRC32-202] - _ = x[DCPOP-203] - _ = x[EVTSTRM-204] - _ = x[FCMA-205] - _ = x[FP-206] - _ = x[FPHP-207] - _ = x[GPA-208] - _ = x[JSCVT-209] - _ = x[LRCPC-210] - _ = x[PMULL-211] - _ = x[SHA1-212] - _ = x[SHA2-213] - _ = x[SHA3-214] - _ = x[SHA512-215] - _ = x[SM3-216] - _ = x[SM4-217] - _ = x[SVE-218] - _ = x[lastID-219] + _ = x[AMXFP8-8] + _ = x[AMXTILE-9] + _ = x[APX_F-10] + _ = x[AVX-11] + _ = x[AVX10-12] + _ = x[AVX10_128-13] + _ = x[AVX10_256-14] + _ = x[AVX10_512-15] + _ = x[AVX2-16] + _ = x[AVX512BF16-17] + _ = x[AVX512BITALG-18] + _ = x[AVX512BW-19] + _ = x[AVX512CD-20] + _ = x[AVX512DQ-21] + _ = x[AVX512ER-22] + _ = x[AVX512F-23] + _ = x[AVX512FP16-24] + _ = x[AVX512IFMA-25] + _ = x[AVX512PF-26] + _ = x[AVX512VBMI-27] + _ = x[AVX512VBMI2-28] + _ = x[AVX512VL-29] + _ = x[AVX512VNNI-30] + _ = x[AVX512VP2INTERSECT-31] + _ = x[AVX512VPOPCNTDQ-32] + _ = x[AVXIFMA-33] + _ = x[AVXNECONVERT-34] + _ = x[AVXSLOW-35] + _ = x[AVXVNNI-36] + _ = x[AVXVNNIINT8-37] + _ = x[AVXVNNIINT16-38] + _ = x[BHI_CTRL-39] + _ = x[BMI1-40] + _ = x[BMI2-41] + _ = x[CETIBT-42] + _ = x[CETSS-43] + _ = x[CLDEMOTE-44] + _ = x[CLMUL-45] + _ = x[CLZERO-46] + _ = x[CMOV-47] + _ = x[CMPCCXADD-48] + _ = x[CMPSB_SCADBS_SHORT-49] + _ = x[CMPXCHG8-50] + _ = x[CPBOOST-51] + _ = x[CPPC-52] + _ = x[CX16-53] + _ = x[EFER_LMSLE_UNS-54] + _ = x[ENQCMD-55] + _ = x[ERMS-56] + _ = x[F16C-57] + _ = x[FLUSH_L1D-58] + _ = x[FMA3-59] + _ = x[FMA4-60] + _ = x[FP128-61] + _ = x[FP256-62] + _ = x[FSRM-63] + _ = x[FXSR-64] + _ = x[FXSROPT-65] + _ = x[GFNI-66] + _ = x[HLE-67] + _ = x[HRESET-68] + _ = x[HTT-69] + _ = x[HWA-70] + _ = x[HYBRID_CPU-71] + _ = x[HYPERVISOR-72] + _ = x[IA32_ARCH_CAP-73] + _ = x[IA32_CORE_CAP-74] + _ = x[IBPB-75] + _ = x[IBPB_BRTYPE-76] + _ = x[IBRS-77] + _ = x[IBRS_PREFERRED-78] + _ = x[IBRS_PROVIDES_SMP-79] + _ = x[IBS-80] + _ = x[IBSBRNTRGT-81] + _ = x[IBSFETCHSAM-82] + _ = x[IBSFFV-83] + _ = x[IBSOPCNT-84] + _ = x[IBSOPCNTEXT-85] + _ = x[IBSOPSAM-86] + _ = x[IBSRDWROPCNT-87] + _ = x[IBSRIPINVALIDCHK-88] + _ = x[IBS_FETCH_CTLX-89] + _ = x[IBS_OPDATA4-90] + _ = x[IBS_OPFUSE-91] + _ = x[IBS_PREVENTHOST-92] + _ = x[IBS_ZEN4-93] + _ = x[IDPRED_CTRL-94] + _ = x[INT_WBINVD-95] + _ = x[INVLPGB-96] + _ = x[KEYLOCKER-97] + _ = x[KEYLOCKERW-98] + _ = x[LAHF-99] + _ = x[LAM-100] + _ = x[LBRVIRT-101] + _ = x[LZCNT-102] + _ = x[MCAOVERFLOW-103] + _ = x[MCDT_NO-104] + _ = x[MCOMMIT-105] + _ = x[MD_CLEAR-106] + _ = x[MMX-107] + _ = x[MMXEXT-108] + _ = x[MOVBE-109] + _ = x[MOVDIR64B-110] + _ = x[MOVDIRI-111] + _ = x[MOVSB_ZL-112] + _ = x[MOVU-113] + _ = x[MPX-114] + _ = x[MSRIRC-115] + _ = x[MSRLIST-116] + _ = x[MSR_PAGEFLUSH-117] + _ = x[NRIPS-118] + _ = x[NX-119] + _ = x[OSXSAVE-120] + _ = x[PCONFIG-121] + _ = x[POPCNT-122] + _ = x[PPIN-123] + _ = x[PREFETCHI-124] + _ = x[PSFD-125] + _ = x[RDPRU-126] + _ = x[RDRAND-127] + _ = x[RDSEED-128] + _ = x[RDTSCP-129] + _ = x[RRSBA_CTRL-130] + _ = x[RTM-131] + _ = x[RTM_ALWAYS_ABORT-132] + _ = x[SBPB-133] + _ = x[SERIALIZE-134] + _ = x[SEV-135] + _ = x[SEV_64BIT-136] + _ = x[SEV_ALTERNATIVE-137] + _ = x[SEV_DEBUGSWAP-138] + _ = x[SEV_ES-139] + _ = x[SEV_RESTRICTED-140] + _ = x[SEV_SNP-141] + _ = x[SGX-142] + _ = x[SGXLC-143] + _ = x[SHA-144] + _ = x[SME-145] + _ = x[SME_COHERENT-146] + _ = x[SPEC_CTRL_SSBD-147] + _ = x[SRBDS_CTRL-148] + _ = x[SRSO_MSR_FIX-149] + _ = x[SRSO_NO-150] + _ = x[SRSO_USER_KERNEL_NO-151] + _ = x[SSE-152] + _ = x[SSE2-153] + _ = x[SSE3-154] + _ = x[SSE4-155] + _ = x[SSE42-156] + _ = x[SSE4A-157] + _ = x[SSSE3-158] + _ = x[STIBP-159] + _ = x[STIBP_ALWAYSON-160] + _ = x[STOSB_SHORT-161] + _ = x[SUCCOR-162] + _ = x[SVM-163] + _ = x[SVMDA-164] + _ = x[SVMFBASID-165] + _ = x[SVML-166] + _ = x[SVMNP-167] + _ = x[SVMPF-168] + _ = x[SVMPFT-169] + _ = x[SYSCALL-170] + _ = x[SYSEE-171] + _ = x[TBM-172] + _ = x[TDX_GUEST-173] + _ = x[TLB_FLUSH_NESTED-174] + _ = x[TME-175] + _ = x[TOPEXT-176] + _ = x[TSCRATEMSR-177] + _ = x[TSXLDTRK-178] + _ = x[VAES-179] + _ = x[VMCBCLEAN-180] + _ = x[VMPL-181] + _ = x[VMSA_REGPROT-182] + _ = x[VMX-183] + _ = x[VPCLMULQDQ-184] + _ = x[VTE-185] + _ = x[WAITPKG-186] + _ = x[WBNOINVD-187] + _ = x[WRMSRNS-188] + _ = x[X87-189] + _ = x[XGETBV1-190] + _ = x[XOP-191] + _ = x[XSAVE-192] + _ = x[XSAVEC-193] + _ = x[XSAVEOPT-194] + _ = x[XSAVES-195] + _ = x[AESARM-196] + _ = x[ARMCPUID-197] + _ = x[ASIMD-198] + _ = x[ASIMDDP-199] + _ = x[ASIMDHP-200] + _ = x[ASIMDRDM-201] + _ = x[ATOMICS-202] + _ = x[CRC32-203] + _ = x[DCPOP-204] + _ = x[EVTSTRM-205] + _ = x[FCMA-206] + _ = x[FP-207] + _ = x[FPHP-208] + _ = x[GPA-209] + _ = x[JSCVT-210] + _ = x[LRCPC-211] + _ = x[PMULL-212] + _ = x[SHA1-213] + _ = x[SHA2-214] + _ = x[SHA3-215] + _ = x[SHA512-216] + _ = x[SM3-217] + _ = x[SM4-218] + _ = x[SVE-219] + _ = x[lastID-220] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 323, 331, 335, 339, 345, 350, 358, 363, 369, 373, 382, 400, 408, 415, 419, 423, 437, 443, 447, 451, 460, 464, 468, 473, 478, 482, 486, 493, 497, 500, 506, 509, 512, 522, 532, 545, 558, 562, 573, 577, 591, 608, 611, 621, 632, 638, 646, 657, 665, 677, 693, 707, 718, 728, 743, 751, 762, 772, 779, 788, 798, 802, 805, 812, 817, 828, 835, 842, 850, 853, 859, 864, 873, 880, 888, 892, 895, 901, 908, 921, 926, 928, 935, 942, 948, 952, 961, 965, 970, 976, 982, 988, 998, 1001, 1017, 1021, 1030, 1033, 1042, 1057, 1070, 1076, 1090, 1097, 1100, 1105, 1108, 1111, 1123, 1137, 1147, 1159, 1166, 1185, 1188, 1192, 1196, 1200, 1205, 1210, 1215, 1220, 1234, 1245, 1251, 1254, 1259, 1268, 1272, 1277, 1282, 1288, 1295, 1300, 1303, 1312, 1328, 1331, 1337, 1347, 1355, 1359, 1368, 1372, 1384, 1387, 1397, 1400, 1407, 1415, 1422, 1425, 1432, 1435, 1440, 1446, 1454, 1460, 1466, 1474, 1479, 1486, 1493, 1501, 1508, 1513, 1518, 1525, 1529, 1531, 1535, 1538, 1543, 1548, 1553, 1557, 1561, 1565, 1571, 1574, 1577, 1580, 1586} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 73, 76, 81, 90, 99, 108, 112, 122, 134, 142, 150, 158, 166, 173, 183, 193, 201, 211, 222, 230, 240, 258, 273, 280, 292, 299, 306, 317, 329, 337, 341, 345, 351, 356, 364, 369, 375, 379, 388, 406, 414, 421, 425, 429, 443, 449, 453, 457, 466, 470, 474, 479, 484, 488, 492, 499, 503, 506, 512, 515, 518, 528, 538, 551, 564, 568, 579, 583, 597, 614, 617, 627, 638, 644, 652, 663, 671, 683, 699, 713, 724, 734, 749, 757, 768, 778, 785, 794, 804, 808, 811, 818, 823, 834, 841, 848, 856, 859, 865, 870, 879, 886, 894, 898, 901, 907, 914, 927, 932, 934, 941, 948, 954, 958, 967, 971, 976, 982, 988, 994, 1004, 1007, 1023, 1027, 1036, 1039, 1048, 1063, 1076, 1082, 1096, 1103, 1106, 1111, 1114, 1117, 1129, 1143, 1153, 1165, 1172, 1191, 1194, 1198, 1202, 1206, 1211, 1216, 1221, 1226, 1240, 1251, 1257, 1260, 1265, 1274, 1278, 1283, 1288, 1294, 1301, 1306, 1309, 1318, 1334, 1337, 1343, 1353, 1361, 1365, 1374, 1378, 1390, 1393, 1403, 1406, 1413, 1421, 1428, 1431, 1438, 1441, 1446, 1452, 1460, 1466, 1472, 1480, 1485, 1492, 1499, 1507, 1514, 1519, 1524, 1531, 1535, 1537, 1541, 1544, 1549, 1554, 1559, 1563, 1567, 1571, 1577, 1580, 1583, 1586, 1592} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { @@ -270,12 +271,17 @@ func _() { _ = x[AMCC-23] _ = x[Qualcomm-24] _ = x[Marvell-25] - _ = x[lastVendor-26] + _ = x[QEMU-26] + _ = x[QNX-27] + _ = x[ACRN-28] + _ = x[SRE-29] + _ = x[Apple-30] + _ = x[lastVendor-31] } -const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvelllastVendor" +const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvellQEMUQNXACRNSREApplelastVendor" -var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 155} +var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 149, 152, 156, 159, 164, 174} func (i Vendor) String() string { if i < 0 || i >= Vendor(len(_Vendor_index)-1) { diff --git a/vendor/github.com/onsi/ginkgo/v2/formatter/formatter.go b/vendor/github.com/onsi/ginkgo/v2/formatter/formatter.go index 743555ddea..4d5749114c 100644 --- a/vendor/github.com/onsi/ginkgo/v2/formatter/formatter.go +++ b/vendor/github.com/onsi/ginkgo/v2/formatter/formatter.go @@ -82,6 +82,10 @@ func New(colorMode ColorMode) Formatter { return fmt.Sprintf("\x1b[38;5;%dm", colorCode) } + if _, noColor := os.LookupEnv("GINKGO_NO_COLOR"); noColor { + colorMode = ColorModeNone + } + f := Formatter{ ColorMode: colorMode, colors: map[string]string{ diff --git a/vendor/github.com/onsi/ginkgo/v2/types/config.go b/vendor/github.com/onsi/ginkgo/v2/types/config.go index 97a049e0c1..8c0dfab8c0 100644 --- a/vendor/github.com/onsi/ginkgo/v2/types/config.go +++ b/vendor/github.com/onsi/ginkgo/v2/types/config.go @@ -328,7 +328,7 @@ var ParallelConfigFlags = GinkgoFlags{ // ReporterConfigFlags provides flags for the Ginkgo test process, and CLI var ReporterConfigFlags = GinkgoFlags{ {KeyPath: "R.NoColor", Name: "no-color", SectionKey: "output", DeprecatedName: "noColor", DeprecatedDocLink: "changed-command-line-flags", - Usage: "If set, suppress color output in default reporter."}, + Usage: "If set, suppress color output in default reporter. You can also set the environment variable GINKGO_NO_COLOR=TRUE"}, {KeyPath: "R.Verbose", Name: "v", SectionKey: "output", Usage: "If set, emits more output including GinkgoWriter contents."}, {KeyPath: "R.VeryVerbose", Name: "vv", SectionKey: "output", diff --git a/vendor/github.com/onsi/ginkgo/v2/types/types.go b/vendor/github.com/onsi/ginkgo/v2/types/types.go index aae69b04c9..ddcbec1ba8 100644 --- a/vendor/github.com/onsi/ginkgo/v2/types/types.go +++ b/vendor/github.com/onsi/ginkgo/v2/types/types.go @@ -3,13 +3,21 @@ package types import ( "encoding/json" "fmt" + "os" "sort" "strings" "time" ) const GINKGO_FOCUS_EXIT_CODE = 197 -const GINKGO_TIME_FORMAT = "01/02/06 15:04:05.999" + +var GINKGO_TIME_FORMAT = "01/02/06 15:04:05.999" + +func init() { + if os.Getenv("GINKGO_TIME_FORMAT") != "" { + GINKGO_TIME_FORMAT = os.Getenv("GINKGO_TIME_FORMAT") + } +} // Report captures information about a Ginkgo test run type Report struct { diff --git a/vendor/github.com/onsi/ginkgo/v2/types/version.go b/vendor/github.com/onsi/ginkgo/v2/types/version.go index 6dfb25f249..0b51c0b565 100644 --- a/vendor/github.com/onsi/ginkgo/v2/types/version.go +++ b/vendor/github.com/onsi/ginkgo/v2/types/version.go @@ -1,3 +1,3 @@ package types -const VERSION = "2.20.2" +const VERSION = "2.22.0" diff --git a/vendor/github.com/quic-go/quic-go/closed_conn.go b/vendor/github.com/quic-go/quic-go/closed_conn.go index 8333853271..6486ea65e8 100644 --- a/vendor/github.com/quic-go/quic-go/closed_conn.go +++ b/vendor/github.com/quic-go/quic-go/closed_conn.go @@ -3,6 +3,7 @@ package quic import ( "math/bits" "net" + "sync/atomic" "github.com/quic-go/quic-go/internal/utils" ) @@ -11,7 +12,7 @@ import ( // When receiving packets for such a connection, we need to retransmit the packet containing the CONNECTION_CLOSE frame, // with an exponential backoff. type closedLocalConn struct { - counter uint32 + counter atomic.Uint32 logger utils.Logger sendPacket func(net.Addr, packetInfo) @@ -28,13 +29,13 @@ func newClosedLocalConn(sendPacket func(net.Addr, packetInfo), logger utils.Logg } func (c *closedLocalConn) handlePacket(p receivedPacket) { - c.counter++ + n := c.counter.Add(1) // exponential backoff // only send a CONNECTION_CLOSE for the 1st, 2nd, 4th, 8th, 16th, ... packet arriving - if bits.OnesCount32(c.counter) != 1 { + if bits.OnesCount32(n) != 1 { return } - c.logger.Debugf("Received %d packets after sending CONNECTION_CLOSE. Retransmitting.", c.counter) + c.logger.Debugf("Received %d packets after sending CONNECTION_CLOSE. Retransmitting.", n) c.sendPacket(p.remoteAddr, p.info) } diff --git a/vendor/github.com/quic-go/quic-go/connection.go b/vendor/github.com/quic-go/quic-go/connection.go index 1411a77b73..4390f5ca87 100644 --- a/vendor/github.com/quic-go/quic-go/connection.go +++ b/vendor/github.com/quic-go/quic-go/connection.go @@ -689,7 +689,7 @@ func (s *connection) nextIdleTimeoutTime() time.Time { // Time when the next keep-alive packet should be sent. // It returns a zero time if no keep-alive should be sent. func (s *connection) nextKeepAliveTime() time.Time { - if s.config.KeepAlivePeriod == 0 || s.keepAlivePingSent || !s.firstAckElicitingPacketAfterIdleSentTime.IsZero() { + if s.config.KeepAlivePeriod == 0 || s.keepAlivePingSent { return time.Time{} } keepAliveInterval := max(s.keepAliveInterval, s.rttStats.PTO(true)*3/2) diff --git a/vendor/github.com/quic-go/quic-go/sys_conn_df_linux.go b/vendor/github.com/quic-go/quic-go/sys_conn_df_linux.go index f09eaa5dff..b09a2394e8 100644 --- a/vendor/github.com/quic-go/quic-go/sys_conn_df_linux.go +++ b/vendor/github.com/quic-go/quic-go/sys_conn_df_linux.go @@ -16,8 +16,8 @@ func setDF(rawConn syscall.RawConn) (bool, error) { // and the datagram will not be fragmented var errDFIPv4, errDFIPv6 error if err := rawConn.Control(func(fd uintptr) { - errDFIPv4 = unix.SetsockoptInt(int(fd), unix.IPPROTO_IP, unix.IP_MTU_DISCOVER, unix.IP_PMTUDISC_DO) - errDFIPv6 = unix.SetsockoptInt(int(fd), unix.IPPROTO_IPV6, unix.IPV6_MTU_DISCOVER, unix.IPV6_PMTUDISC_DO) + errDFIPv4 = unix.SetsockoptInt(int(fd), unix.IPPROTO_IP, unix.IP_MTU_DISCOVER, unix.IP_PMTUDISC_PROBE) + errDFIPv6 = unix.SetsockoptInt(int(fd), unix.IPPROTO_IPV6, unix.IPV6_MTU_DISCOVER, unix.IPV6_PMTUDISC_PROBE) }); err != nil { return false, err } diff --git a/vendor/github.com/skycoin/skycoin-service-discovery/pkg/service-discovery/api/api.go b/vendor/github.com/skycoin/skycoin-service-discovery/pkg/service-discovery/api/api.go index 0ebfe1b0ac..d6095aaabe 100644 --- a/vendor/github.com/skycoin/skycoin-service-discovery/pkg/service-discovery/api/api.go +++ b/vendor/github.com/skycoin/skycoin-service-discovery/pkg/service-discovery/api/api.go @@ -12,8 +12,8 @@ import ( "strconv" "time" - "github.com/go-chi/chi" - "github.com/go-chi/chi/middleware" + "github.com/go-chi/chi/v5" + "github.com/go-chi/chi/v5/middleware" "github.com/go-chi/cors" "github.com/sirupsen/logrus" "github.com/skycoin/skywire/pkg/servicedisc" diff --git a/vendor/github.com/stretchr/testify/assert/assertion_compare.go b/vendor/github.com/stretchr/testify/assert/assertion_compare.go index 4d4b4aad6f..7e19eba090 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_compare.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_compare.go @@ -7,10 +7,13 @@ import ( "time" ) -type CompareType int +// Deprecated: CompareType has only ever been for internal use and has accidentally been published since v1.6.0. Do not use it. +type CompareType = compareResult + +type compareResult int const ( - compareLess CompareType = iota - 1 + compareLess compareResult = iota - 1 compareEqual compareGreater ) @@ -39,7 +42,7 @@ var ( bytesType = reflect.TypeOf([]byte{}) ) -func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { +func compare(obj1, obj2 interface{}, kind reflect.Kind) (compareResult, bool) { obj1Value := reflect.ValueOf(obj1) obj2Value := reflect.ValueOf(obj2) @@ -325,7 +328,13 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { timeObj2 = obj2Value.Convert(timeType).Interface().(time.Time) } - return compare(timeObj1.UnixNano(), timeObj2.UnixNano(), reflect.Int64) + if timeObj1.Before(timeObj2) { + return compareLess, true + } + if timeObj1.Equal(timeObj2) { + return compareEqual, true + } + return compareGreater, true } case reflect.Slice: { @@ -345,7 +354,7 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { bytesObj2 = obj2Value.Convert(bytesType).Interface().([]byte) } - return CompareType(bytes.Compare(bytesObj1, bytesObj2)), true + return compareResult(bytes.Compare(bytesObj1, bytesObj2)), true } case reflect.Uintptr: { @@ -381,7 +390,7 @@ func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface if h, ok := t.(tHelper); ok { h.Helper() } - return compareTwoValues(t, e1, e2, []CompareType{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) + return compareTwoValues(t, e1, e2, []compareResult{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) } // GreaterOrEqual asserts that the first element is greater than or equal to the second @@ -394,7 +403,7 @@ func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...in if h, ok := t.(tHelper); ok { h.Helper() } - return compareTwoValues(t, e1, e2, []CompareType{compareGreater, compareEqual}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) + return compareTwoValues(t, e1, e2, []compareResult{compareGreater, compareEqual}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) } // Less asserts that the first element is less than the second @@ -406,7 +415,7 @@ func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) if h, ok := t.(tHelper); ok { h.Helper() } - return compareTwoValues(t, e1, e2, []CompareType{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) + return compareTwoValues(t, e1, e2, []compareResult{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) } // LessOrEqual asserts that the first element is less than or equal to the second @@ -419,7 +428,7 @@ func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...inter if h, ok := t.(tHelper); ok { h.Helper() } - return compareTwoValues(t, e1, e2, []CompareType{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) + return compareTwoValues(t, e1, e2, []compareResult{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) } // Positive asserts that the specified element is positive @@ -431,7 +440,7 @@ func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { h.Helper() } zero := reflect.Zero(reflect.TypeOf(e)) - return compareTwoValues(t, e, zero.Interface(), []CompareType{compareGreater}, "\"%v\" is not positive", msgAndArgs...) + return compareTwoValues(t, e, zero.Interface(), []compareResult{compareGreater}, "\"%v\" is not positive", msgAndArgs...) } // Negative asserts that the specified element is negative @@ -443,10 +452,10 @@ func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { h.Helper() } zero := reflect.Zero(reflect.TypeOf(e)) - return compareTwoValues(t, e, zero.Interface(), []CompareType{compareLess}, "\"%v\" is not negative", msgAndArgs...) + return compareTwoValues(t, e, zero.Interface(), []compareResult{compareLess}, "\"%v\" is not negative", msgAndArgs...) } -func compareTwoValues(t TestingT, e1 interface{}, e2 interface{}, allowedComparesResults []CompareType, failMessage string, msgAndArgs ...interface{}) bool { +func compareTwoValues(t TestingT, e1 interface{}, e2 interface{}, allowedComparesResults []compareResult, failMessage string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() } @@ -469,7 +478,7 @@ func compareTwoValues(t TestingT, e1 interface{}, e2 interface{}, allowedCompare return true } -func containsValue(values []CompareType, value CompareType) bool { +func containsValue(values []compareResult, value compareResult) bool { for _, v := range values { if v == value { return true diff --git a/vendor/github.com/stretchr/testify/assert/assertion_format.go b/vendor/github.com/stretchr/testify/assert/assertion_format.go index 3ddab109ad..1906341657 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_format.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_format.go @@ -104,8 +104,8 @@ func EqualExportedValuesf(t TestingT, expected interface{}, actual interface{}, return EqualExportedValues(t, expected, actual, append([]interface{}{msg}, args...)...) } -// EqualValuesf asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValuesf asserts that two objects are equal or convertible to the larger +// type and equal. // // assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { @@ -186,7 +186,7 @@ func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick // assert.EventuallyWithTf(t, func(c *assert.CollectT, "error message %s", "formatted") { // // add assertions as needed; any assertion failure will fail the current tick // assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func EventuallyWithTf(t TestingT, condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -568,6 +568,23 @@ func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, a return NotContains(t, s, contains, append([]interface{}{msg}, args...)...) } +// NotElementsMatchf asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// assert.NotElementsMatchf(t, [1, 1, 2, 3], [1, 1, 2, 3], "error message %s", "formatted") -> false +// +// assert.NotElementsMatchf(t, [1, 1, 2, 3], [1, 2, 3], "error message %s", "formatted") -> true +// +// assert.NotElementsMatchf(t, [1, 2, 3], [1, 2, 4], "error message %s", "formatted") -> true +func NotElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return NotElementsMatch(t, listA, listB, append([]interface{}{msg}, args...)...) +} + // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // @@ -604,7 +621,16 @@ func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg s return NotEqualValues(t, expected, actual, append([]interface{}{msg}, args...)...) } -// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// NotErrorAsf asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func NotErrorAsf(t TestingT, err error, target interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return NotErrorAs(t, err, target, append([]interface{}{msg}, args...)...) +} + +// NotErrorIsf asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { diff --git a/vendor/github.com/stretchr/testify/assert/assertion_forward.go b/vendor/github.com/stretchr/testify/assert/assertion_forward.go index a84e09bd40..21629087ba 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_forward.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_forward.go @@ -186,8 +186,8 @@ func (a *Assertions) EqualExportedValuesf(expected interface{}, actual interface return EqualExportedValuesf(a.t, expected, actual, msg, args...) } -// EqualValues asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValues asserts that two objects are equal or convertible to the larger +// type and equal. // // a.EqualValues(uint32(123), int32(123)) func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { @@ -197,8 +197,8 @@ func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAn return EqualValues(a.t, expected, actual, msgAndArgs...) } -// EqualValuesf asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValuesf asserts that two objects are equal or convertible to the larger +// type and equal. // // a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { @@ -336,7 +336,7 @@ func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, ti // a.EventuallyWithT(func(c *assert.CollectT) { // // add assertions as needed; any assertion failure will fail the current tick // assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func (a *Assertions) EventuallyWithT(condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -361,7 +361,7 @@ func (a *Assertions) EventuallyWithT(condition func(collect *CollectT), waitFor // a.EventuallyWithTf(func(c *assert.CollectT, "error message %s", "formatted") { // // add assertions as needed; any assertion failure will fail the current tick // assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func (a *Assertions) EventuallyWithTf(condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1128,6 +1128,40 @@ func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg strin return NotContainsf(a.t, s, contains, msg, args...) } +// NotElementsMatch asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// a.NotElementsMatch([1, 1, 2, 3], [1, 1, 2, 3]) -> false +// +// a.NotElementsMatch([1, 1, 2, 3], [1, 2, 3]) -> true +// +// a.NotElementsMatch([1, 2, 3], [1, 2, 4]) -> true +func (a *Assertions) NotElementsMatch(listA interface{}, listB interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotElementsMatch(a.t, listA, listB, msgAndArgs...) +} + +// NotElementsMatchf asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// a.NotElementsMatchf([1, 1, 2, 3], [1, 1, 2, 3], "error message %s", "formatted") -> false +// +// a.NotElementsMatchf([1, 1, 2, 3], [1, 2, 3], "error message %s", "formatted") -> true +// +// a.NotElementsMatchf([1, 2, 3], [1, 2, 4], "error message %s", "formatted") -> true +func (a *Assertions) NotElementsMatchf(listA interface{}, listB interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotElementsMatchf(a.t, listA, listB, msg, args...) +} + // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // @@ -1200,7 +1234,25 @@ func (a *Assertions) NotEqualf(expected interface{}, actual interface{}, msg str return NotEqualf(a.t, expected, actual, msg, args...) } -// NotErrorIs asserts that at none of the errors in err's chain matches target. +// NotErrorAs asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func (a *Assertions) NotErrorAs(err error, target interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotErrorAs(a.t, err, target, msgAndArgs...) +} + +// NotErrorAsf asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func (a *Assertions) NotErrorAsf(err error, target interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotErrorAsf(a.t, err, target, msg, args...) +} + +// NotErrorIs asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { @@ -1209,7 +1261,7 @@ func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface return NotErrorIs(a.t, err, target, msgAndArgs...) } -// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// NotErrorIsf asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { diff --git a/vendor/github.com/stretchr/testify/assert/assertion_order.go b/vendor/github.com/stretchr/testify/assert/assertion_order.go index 00df62a059..1d2f71824a 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_order.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_order.go @@ -6,7 +6,7 @@ import ( ) // isOrdered checks that collection contains orderable elements. -func isOrdered(t TestingT, object interface{}, allowedComparesResults []CompareType, failMessage string, msgAndArgs ...interface{}) bool { +func isOrdered(t TestingT, object interface{}, allowedComparesResults []compareResult, failMessage string, msgAndArgs ...interface{}) bool { objKind := reflect.TypeOf(object).Kind() if objKind != reflect.Slice && objKind != reflect.Array { return false @@ -50,7 +50,7 @@ func isOrdered(t TestingT, object interface{}, allowedComparesResults []CompareT // assert.IsIncreasing(t, []float{1, 2}) // assert.IsIncreasing(t, []string{"a", "b"}) func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { - return isOrdered(t, object, []CompareType{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) + return isOrdered(t, object, []compareResult{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) } // IsNonIncreasing asserts that the collection is not increasing @@ -59,7 +59,7 @@ func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) boo // assert.IsNonIncreasing(t, []float{2, 1}) // assert.IsNonIncreasing(t, []string{"b", "a"}) func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { - return isOrdered(t, object, []CompareType{compareEqual, compareGreater}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) + return isOrdered(t, object, []compareResult{compareEqual, compareGreater}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) } // IsDecreasing asserts that the collection is decreasing @@ -68,7 +68,7 @@ func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) // assert.IsDecreasing(t, []float{2, 1}) // assert.IsDecreasing(t, []string{"b", "a"}) func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { - return isOrdered(t, object, []CompareType{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) + return isOrdered(t, object, []compareResult{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) } // IsNonDecreasing asserts that the collection is not decreasing @@ -77,5 +77,5 @@ func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) boo // assert.IsNonDecreasing(t, []float{1, 2}) // assert.IsNonDecreasing(t, []string{"a", "b"}) func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { - return isOrdered(t, object, []CompareType{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) + return isOrdered(t, object, []compareResult{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) } diff --git a/vendor/github.com/stretchr/testify/assert/assertions.go b/vendor/github.com/stretchr/testify/assert/assertions.go index 0b7570f21c..4e91332bb5 100644 --- a/vendor/github.com/stretchr/testify/assert/assertions.go +++ b/vendor/github.com/stretchr/testify/assert/assertions.go @@ -19,7 +19,9 @@ import ( "github.com/davecgh/go-spew/spew" "github.com/pmezard/go-difflib/difflib" - "gopkg.in/yaml.v3" + + // Wrapper around gopkg.in/yaml.v3 + "github.com/stretchr/testify/assert/yaml" ) //go:generate sh -c "cd ../_codegen && go build && cd - && ../_codegen/_codegen -output-package=assert -template=assertion_format.go.tmpl" @@ -45,6 +47,10 @@ type BoolAssertionFunc func(TestingT, bool, ...interface{}) bool // for table driven tests. type ErrorAssertionFunc func(TestingT, error, ...interface{}) bool +// PanicAssertionFunc is a common function prototype when validating a panic value. Can be useful +// for table driven tests. +type PanicAssertionFunc = func(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool + // Comparison is a custom function that returns true on success and false on failure type Comparison func() (success bool) @@ -496,7 +502,13 @@ func Same(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) b h.Helper() } - if !samePointers(expected, actual) { + same, ok := samePointers(expected, actual) + if !ok { + return Fail(t, "Both arguments must be pointers", msgAndArgs...) + } + + if !same { + // both are pointers but not the same type & pointing to the same address return Fail(t, fmt.Sprintf("Not same: \n"+ "expected: %p %#v\n"+ "actual : %p %#v", expected, expected, actual, actual), msgAndArgs...) @@ -516,7 +528,13 @@ func NotSame(t TestingT, expected, actual interface{}, msgAndArgs ...interface{} h.Helper() } - if samePointers(expected, actual) { + same, ok := samePointers(expected, actual) + if !ok { + //fails when the arguments are not pointers + return !(Fail(t, "Both arguments must be pointers", msgAndArgs...)) + } + + if same { return Fail(t, fmt.Sprintf( "Expected and actual point to the same object: %p %#v", expected, expected), msgAndArgs...) @@ -524,21 +542,23 @@ func NotSame(t TestingT, expected, actual interface{}, msgAndArgs ...interface{} return true } -// samePointers compares two generic interface objects and returns whether -// they point to the same object -func samePointers(first, second interface{}) bool { +// samePointers checks if two generic interface objects are pointers of the same +// type pointing to the same object. It returns two values: same indicating if +// they are the same type and point to the same object, and ok indicating that +// both inputs are pointers. +func samePointers(first, second interface{}) (same bool, ok bool) { firstPtr, secondPtr := reflect.ValueOf(first), reflect.ValueOf(second) if firstPtr.Kind() != reflect.Ptr || secondPtr.Kind() != reflect.Ptr { - return false + return false, false //not both are pointers } firstType, secondType := reflect.TypeOf(first), reflect.TypeOf(second) if firstType != secondType { - return false + return false, true // both are pointers, but of different types } // compare pointer addresses - return first == second + return first == second, true } // formatUnequalValues takes two values of arbitrary types and returns string @@ -572,8 +592,8 @@ func truncatingFormat(data interface{}) string { return value } -// EqualValues asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValues asserts that two objects are equal or convertible to the larger +// type and equal. // // assert.EqualValues(t, uint32(123), int32(123)) func EqualValues(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { @@ -615,21 +635,6 @@ func EqualExportedValues(t TestingT, expected, actual interface{}, msgAndArgs .. return Fail(t, fmt.Sprintf("Types expected to match exactly\n\t%v != %v", aType, bType), msgAndArgs...) } - if aType.Kind() == reflect.Ptr { - aType = aType.Elem() - } - if bType.Kind() == reflect.Ptr { - bType = bType.Elem() - } - - if aType.Kind() != reflect.Struct { - return Fail(t, fmt.Sprintf("Types expected to both be struct or pointer to struct \n\t%v != %v", aType.Kind(), reflect.Struct), msgAndArgs...) - } - - if bType.Kind() != reflect.Struct { - return Fail(t, fmt.Sprintf("Types expected to both be struct or pointer to struct \n\t%v != %v", bType.Kind(), reflect.Struct), msgAndArgs...) - } - expected = copyExportedFields(expected) actual = copyExportedFields(actual) @@ -1170,6 +1175,39 @@ func formatListDiff(listA, listB interface{}, extraA, extraB []interface{}) stri return msg.String() } +// NotElementsMatch asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// assert.NotElementsMatch(t, [1, 1, 2, 3], [1, 1, 2, 3]) -> false +// +// assert.NotElementsMatch(t, [1, 1, 2, 3], [1, 2, 3]) -> true +// +// assert.NotElementsMatch(t, [1, 2, 3], [1, 2, 4]) -> true +func NotElementsMatch(t TestingT, listA, listB interface{}, msgAndArgs ...interface{}) (ok bool) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if isEmpty(listA) && isEmpty(listB) { + return Fail(t, "listA and listB contain the same elements", msgAndArgs) + } + + if !isList(t, listA, msgAndArgs...) { + return Fail(t, "listA is not a list type", msgAndArgs...) + } + if !isList(t, listB, msgAndArgs...) { + return Fail(t, "listB is not a list type", msgAndArgs...) + } + + extraA, extraB := diffLists(listA, listB) + if len(extraA) == 0 && len(extraB) == 0 { + return Fail(t, "listA and listB contain the same elements", msgAndArgs) + } + + return true +} + // Condition uses a Comparison to assert a complex condition. func Condition(t TestingT, comp Comparison, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { @@ -1488,6 +1526,9 @@ func InEpsilon(t TestingT, expected, actual interface{}, epsilon float64, msgAnd if err != nil { return Fail(t, err.Error(), msgAndArgs...) } + if math.IsNaN(actualEpsilon) { + return Fail(t, "relative error is NaN", msgAndArgs...) + } if actualEpsilon > epsilon { return Fail(t, fmt.Sprintf("Relative error is too high: %#v (expected)\n"+ " < %#v (actual)", epsilon, actualEpsilon), msgAndArgs...) @@ -1611,7 +1652,6 @@ func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...in // matchRegexp return true if a specified regexp matches a string. func matchRegexp(rx interface{}, str interface{}) bool { - var r *regexp.Regexp if rr, ok := rx.(*regexp.Regexp); ok { r = rr @@ -1619,7 +1659,14 @@ func matchRegexp(rx interface{}, str interface{}) bool { r = regexp.MustCompile(fmt.Sprint(rx)) } - return (r.FindStringIndex(fmt.Sprint(str)) != nil) + switch v := str.(type) { + case []byte: + return r.Match(v) + case string: + return r.MatchString(v) + default: + return r.MatchString(fmt.Sprint(v)) + } } @@ -1872,7 +1919,7 @@ var spewConfigStringerEnabled = spew.ConfigState{ MaxDepth: 10, } -type tHelper interface { +type tHelper = interface { Helper() } @@ -1911,6 +1958,9 @@ func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick t // CollectT implements the TestingT interface and collects all errors. type CollectT struct { + // A slice of errors. Non-nil slice denotes a failure. + // If it's non-nil but len(c.errors) == 0, this is also a failure + // obtained by direct c.FailNow() call. errors []error } @@ -1919,9 +1969,10 @@ func (c *CollectT) Errorf(format string, args ...interface{}) { c.errors = append(c.errors, fmt.Errorf(format, args...)) } -// FailNow panics. -func (*CollectT) FailNow() { - panic("Assertion failed") +// FailNow stops execution by calling runtime.Goexit. +func (c *CollectT) FailNow() { + c.fail() + runtime.Goexit() } // Deprecated: That was a method for internal usage that should not have been published. Now just panics. @@ -1934,6 +1985,16 @@ func (*CollectT) Copy(TestingT) { panic("Copy() is deprecated") } +func (c *CollectT) fail() { + if !c.failed() { + c.errors = []error{} // Make it non-nil to mark a failure. + } +} + +func (c *CollectT) failed() bool { + return c.errors != nil +} + // EventuallyWithT asserts that given condition will be met in waitFor time, // periodically checking target function each tick. In contrast to Eventually, // it supplies a CollectT to the condition function, so that the condition @@ -1951,14 +2012,14 @@ func (*CollectT) Copy(TestingT) { // assert.EventuallyWithT(t, func(c *assert.CollectT) { // // add assertions as needed; any assertion failure will fail the current tick // assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func EventuallyWithT(t TestingT, condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() } var lastFinishedTickErrs []error - ch := make(chan []error, 1) + ch := make(chan *CollectT, 1) timer := time.NewTimer(waitFor) defer timer.Stop() @@ -1978,16 +2039,16 @@ func EventuallyWithT(t TestingT, condition func(collect *CollectT), waitFor time go func() { collect := new(CollectT) defer func() { - ch <- collect.errors + ch <- collect }() condition(collect) }() - case errs := <-ch: - if len(errs) == 0 { + case collect := <-ch: + if !collect.failed() { return true } // Keep the errors from the last ended condition, so that they can be copied to t if timeout is reached. - lastFinishedTickErrs = errs + lastFinishedTickErrs = collect.errors tick = ticker.C } } @@ -2049,7 +2110,7 @@ func ErrorIs(t TestingT, err, target error, msgAndArgs ...interface{}) bool { ), msgAndArgs...) } -// NotErrorIs asserts that at none of the errors in err's chain matches target. +// NotErrorIs asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func NotErrorIs(t TestingT, err, target error, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { @@ -2090,6 +2151,24 @@ func ErrorAs(t TestingT, err error, target interface{}, msgAndArgs ...interface{ ), msgAndArgs...) } +// NotErrorAs asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func NotErrorAs(t TestingT, err error, target interface{}, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if !errors.As(err, target) { + return true + } + + chain := buildErrorChainString(err) + + return Fail(t, fmt.Sprintf("Target error should not be in err chain:\n"+ + "found: %q\n"+ + "in chain: %s", target, chain, + ), msgAndArgs...) +} + func buildErrorChainString(err error) string { if err == nil { return "" diff --git a/vendor/github.com/stretchr/testify/assert/yaml/yaml_custom.go b/vendor/github.com/stretchr/testify/assert/yaml/yaml_custom.go new file mode 100644 index 0000000000..baa0cc7d7f --- /dev/null +++ b/vendor/github.com/stretchr/testify/assert/yaml/yaml_custom.go @@ -0,0 +1,25 @@ +//go:build testify_yaml_custom && !testify_yaml_fail && !testify_yaml_default +// +build testify_yaml_custom,!testify_yaml_fail,!testify_yaml_default + +// Package yaml is an implementation of YAML functions that calls a pluggable implementation. +// +// This implementation is selected with the testify_yaml_custom build tag. +// +// go test -tags testify_yaml_custom +// +// This implementation can be used at build time to replace the default implementation +// to avoid linking with [gopkg.in/yaml.v3]. +// +// In your test package: +// +// import assertYaml "github.com/stretchr/testify/assert/yaml" +// +// func init() { +// assertYaml.Unmarshal = func (in []byte, out interface{}) error { +// // ... +// return nil +// } +// } +package yaml + +var Unmarshal func(in []byte, out interface{}) error diff --git a/vendor/github.com/stretchr/testify/assert/yaml/yaml_default.go b/vendor/github.com/stretchr/testify/assert/yaml/yaml_default.go new file mode 100644 index 0000000000..b83c6cf64c --- /dev/null +++ b/vendor/github.com/stretchr/testify/assert/yaml/yaml_default.go @@ -0,0 +1,37 @@ +//go:build !testify_yaml_fail && !testify_yaml_custom +// +build !testify_yaml_fail,!testify_yaml_custom + +// Package yaml is just an indirection to handle YAML deserialization. +// +// This package is just an indirection that allows the builder to override the +// indirection with an alternative implementation of this package that uses +// another implementation of YAML deserialization. This allows to not either not +// use YAML deserialization at all, or to use another implementation than +// [gopkg.in/yaml.v3] (for example for license compatibility reasons, see [PR #1120]). +// +// Alternative implementations are selected using build tags: +// +// - testify_yaml_fail: [Unmarshal] always fails with an error +// - testify_yaml_custom: [Unmarshal] is a variable. Caller must initialize it +// before calling any of [github.com/stretchr/testify/assert.YAMLEq] or +// [github.com/stretchr/testify/assert.YAMLEqf]. +// +// Usage: +// +// go test -tags testify_yaml_fail +// +// You can check with "go list" which implementation is linked: +// +// go list -f '{{.Imports}}' github.com/stretchr/testify/assert/yaml +// go list -tags testify_yaml_fail -f '{{.Imports}}' github.com/stretchr/testify/assert/yaml +// go list -tags testify_yaml_custom -f '{{.Imports}}' github.com/stretchr/testify/assert/yaml +// +// [PR #1120]: https://github.com/stretchr/testify/pull/1120 +package yaml + +import goyaml "gopkg.in/yaml.v3" + +// Unmarshal is just a wrapper of [gopkg.in/yaml.v3.Unmarshal]. +func Unmarshal(in []byte, out interface{}) error { + return goyaml.Unmarshal(in, out) +} diff --git a/vendor/github.com/stretchr/testify/assert/yaml/yaml_fail.go b/vendor/github.com/stretchr/testify/assert/yaml/yaml_fail.go new file mode 100644 index 0000000000..e78f7dfe69 --- /dev/null +++ b/vendor/github.com/stretchr/testify/assert/yaml/yaml_fail.go @@ -0,0 +1,18 @@ +//go:build testify_yaml_fail && !testify_yaml_custom && !testify_yaml_default +// +build testify_yaml_fail,!testify_yaml_custom,!testify_yaml_default + +// Package yaml is an implementation of YAML functions that always fail. +// +// This implementation can be used at build time to replace the default implementation +// to avoid linking with [gopkg.in/yaml.v3]: +// +// go test -tags testify_yaml_fail +package yaml + +import "errors" + +var errNotImplemented = errors.New("YAML functions are not available (see https://pkg.go.dev/github.com/stretchr/testify/assert/yaml)") + +func Unmarshal([]byte, interface{}) error { + return errNotImplemented +} diff --git a/vendor/github.com/stretchr/testify/mock/mock.go b/vendor/github.com/stretchr/testify/mock/mock.go index 213bde2ea6..eb5682df97 100644 --- a/vendor/github.com/stretchr/testify/mock/mock.go +++ b/vendor/github.com/stretchr/testify/mock/mock.go @@ -80,12 +80,12 @@ type Call struct { requires []*Call } -func newCall(parent *Mock, methodName string, callerInfo []string, methodArguments ...interface{}) *Call { +func newCall(parent *Mock, methodName string, callerInfo []string, methodArguments Arguments, returnArguments Arguments) *Call { return &Call{ Parent: parent, Method: methodName, Arguments: methodArguments, - ReturnArguments: make([]interface{}, 0), + ReturnArguments: returnArguments, callerInfo: callerInfo, Repeatability: 0, WaitFor: nil, @@ -256,7 +256,7 @@ func (c *Call) Unset() *Call { // calls have been called as expected. The referenced calls may be from the // same mock instance and/or other mock instances. // -// Mock.On("Do").Return(nil).Notbefore( +// Mock.On("Do").Return(nil).NotBefore( // Mock.On("Init").Return(nil) // ) func (c *Call) NotBefore(calls ...*Call) *Call { @@ -273,6 +273,20 @@ func (c *Call) NotBefore(calls ...*Call) *Call { return c } +// InOrder defines the order in which the calls should be made +// +// For example: +// +// InOrder( +// Mock.On("init").Return(nil), +// Mock.On("Do").Return(nil), +// ) +func InOrder(calls ...*Call) { + for i := 1; i < len(calls); i++ { + calls[i].NotBefore(calls[i-1]) + } +} + // Mock is the workhorse used to track activity on another object. // For an example of its usage, refer to the "Example Usage" section at the top // of this document. @@ -351,7 +365,8 @@ func (m *Mock) On(methodName string, arguments ...interface{}) *Call { m.mutex.Lock() defer m.mutex.Unlock() - c := newCall(m, methodName, assert.CallerInfo(), arguments...) + + c := newCall(m, methodName, assert.CallerInfo(), arguments, make([]interface{}, 0)) m.ExpectedCalls = append(m.ExpectedCalls, c) return c } @@ -491,11 +506,12 @@ func (m *Mock) MethodCalled(methodName string, arguments ...interface{}) Argumen m.mutex.Unlock() if closestCall != nil { - m.fail("\n\nmock: Unexpected Method Call\n-----------------------------\n\n%s\n\nThe closest call I have is: \n\n%s\n\n%s\nDiff: %s", + m.fail("\n\nmock: Unexpected Method Call\n-----------------------------\n\n%s\n\nThe closest call I have is: \n\n%s\n\n%s\nDiff: %s\nat: %s\n", callString(methodName, arguments, true), callString(methodName, closestCall.Arguments, true), diffArguments(closestCall.Arguments, arguments), strings.TrimSpace(mismatch), + assert.CallerInfo(), ) } else { m.fail("\nassert: mock: I don't know what to return because the method call was unexpected.\n\tEither do Mock.On(\"%s\").Return(...) first, or remove the %s() call.\n\tThis method was unexpected:\n\t\t%s\n\tat: %s", methodName, methodName, callString(methodName, arguments, true), assert.CallerInfo()) @@ -529,7 +545,7 @@ func (m *Mock) MethodCalled(methodName string, arguments ...interface{}) Argumen call.totalCalls++ // add the call - m.Calls = append(m.Calls, *newCall(m, methodName, assert.CallerInfo(), arguments...)) + m.Calls = append(m.Calls, *newCall(m, methodName, assert.CallerInfo(), arguments, call.ReturnArguments)) m.mutex.Unlock() // block if specified @@ -764,9 +780,17 @@ const ( ) // AnythingOfTypeArgument contains the type of an argument -// for use when type checking. Used in Diff and Assert. +// for use when type checking. Used in [Arguments.Diff] and [Arguments.Assert]. // -// Deprecated: this is an implementation detail that must not be used. Use [AnythingOfType] instead. +// Deprecated: this is an implementation detail that must not be used. Use the [AnythingOfType] constructor instead, example: +// +// m.On("Do", mock.AnythingOfType("string")) +// +// All explicit type declarations can be replaced with interface{} as is expected by [Mock.On], example: +// +// func anyString interface{} { +// return mock.AnythingOfType("string") +// } type AnythingOfTypeArgument = anythingOfTypeArgument // anythingOfTypeArgument is a string that contains the type of an argument @@ -780,53 +804,54 @@ type anythingOfTypeArgument string // // For example: // -// Assert(t, AnythingOfType("string"), AnythingOfType("int")) +// args.Assert(t, AnythingOfType("string"), AnythingOfType("int")) func AnythingOfType(t string) AnythingOfTypeArgument { return anythingOfTypeArgument(t) } // IsTypeArgument is a struct that contains the type of an argument -// for use when type checking. This is an alternative to AnythingOfType. -// Used in Diff and Assert. +// for use when type checking. This is an alternative to [AnythingOfType]. +// Used in [Arguments.Diff] and [Arguments.Assert]. type IsTypeArgument struct { t reflect.Type } // IsType returns an IsTypeArgument object containing the type to check for. // You can provide a zero-value of the type to check. This is an -// alternative to AnythingOfType. Used in Diff and Assert. +// alternative to [AnythingOfType]. Used in [Arguments.Diff] and [Arguments.Assert]. // // For example: -// Assert(t, IsType(""), IsType(0)) +// +// args.Assert(t, IsType(""), IsType(0)) func IsType(t interface{}) *IsTypeArgument { return &IsTypeArgument{t: reflect.TypeOf(t)} } -// FunctionalOptionsArgument is a struct that contains the type and value of an functional option argument -// for use when type checking. +// FunctionalOptionsArgument contains a list of functional options arguments +// expected for use when matching a list of arguments. type FunctionalOptionsArgument struct { - value interface{} + values []interface{} } // String returns the string representation of FunctionalOptionsArgument func (f *FunctionalOptionsArgument) String() string { var name string - tValue := reflect.ValueOf(f.value) - if tValue.Len() > 0 { - name = "[]" + reflect.TypeOf(tValue.Index(0).Interface()).String() + if len(f.values) > 0 { + name = "[]" + reflect.TypeOf(f.values[0]).String() } - return strings.Replace(fmt.Sprintf("%#v", f.value), "[]interface {}", name, 1) + return strings.Replace(fmt.Sprintf("%#v", f.values), "[]interface {}", name, 1) } -// FunctionalOptions returns an FunctionalOptionsArgument object containing the functional option type -// and the values to check of +// FunctionalOptions returns an [FunctionalOptionsArgument] object containing +// the expected functional-options to check for. // // For example: -// Assert(t, FunctionalOptions("[]foo.FunctionalOption", foo.Opt1(), foo.Opt2())) -func FunctionalOptions(value ...interface{}) *FunctionalOptionsArgument { +// +// args.Assert(t, FunctionalOptions(foo.Opt1("strValue"), foo.Opt2(613))) +func FunctionalOptions(values ...interface{}) *FunctionalOptionsArgument { return &FunctionalOptionsArgument{ - value: value, + values: values, } } @@ -873,10 +898,11 @@ func (f argumentMatcher) String() string { // and false otherwise. // // Example: -// m.On("Do", MatchedBy(func(req *http.Request) bool { return req.Host == "example.com" })) // -// |fn|, must be a function accepting a single argument (of the expected type) -// which returns a bool. If |fn| doesn't match the required signature, +// m.On("Do", MatchedBy(func(req *http.Request) bool { return req.Host == "example.com" })) +// +// fn must be a function accepting a single argument (of the expected type) +// which returns a bool. If fn doesn't match the required signature, // MatchedBy() panics. func MatchedBy(fn interface{}) argumentMatcher { fnType := reflect.TypeOf(fn) @@ -979,20 +1005,17 @@ func (args Arguments) Diff(objects []interface{}) (string, int) { output = fmt.Sprintf("%s\t%d: FAIL: type %s != type %s - %s\n", output, i, expected.t.Name(), actualT.Name(), actualFmt) } case *FunctionalOptionsArgument: - t := expected.value - var name string - tValue := reflect.ValueOf(t) - if tValue.Len() > 0 { - name = "[]" + reflect.TypeOf(tValue.Index(0).Interface()).String() + if len(expected.values) > 0 { + name = "[]" + reflect.TypeOf(expected.values[0]).String() } - tName := reflect.TypeOf(t).Name() - if name != reflect.TypeOf(actual).String() && tValue.Len() != 0 { + const tName = "[]interface{}" + if name != reflect.TypeOf(actual).String() && len(expected.values) != 0 { differences++ output = fmt.Sprintf("%s\t%d: FAIL: type %s != type %s - %s\n", output, i, tName, reflect.TypeOf(actual).Name(), actualFmt) } else { - if ef, af := assertOpts(t, actual); ef == "" && af == "" { + if ef, af := assertOpts(expected.values, actual); ef == "" && af == "" { // match output = fmt.Sprintf("%s\t%d: PASS: %s == %s\n", output, i, tName, tName) } else { @@ -1092,7 +1115,7 @@ func (args Arguments) Error(index int) error { return nil } if s, ok = obj.(error); !ok { - panic(fmt.Sprintf("assert: arguments: Error(%d) failed because object wasn't correct type: %v", index, args.Get(index))) + panic(fmt.Sprintf("assert: arguments: Error(%d) failed because object wasn't correct type: %v", index, obj)) } return s } @@ -1181,32 +1204,38 @@ type tHelper interface { func assertOpts(expected, actual interface{}) (expectedFmt, actualFmt string) { expectedOpts := reflect.ValueOf(expected) actualOpts := reflect.ValueOf(actual) + + var expectedFuncs []*runtime.Func var expectedNames []string for i := 0; i < expectedOpts.Len(); i++ { - expectedNames = append(expectedNames, funcName(expectedOpts.Index(i).Interface())) + f := runtimeFunc(expectedOpts.Index(i).Interface()) + expectedFuncs = append(expectedFuncs, f) + expectedNames = append(expectedNames, funcName(f)) } + var actualFuncs []*runtime.Func var actualNames []string for i := 0; i < actualOpts.Len(); i++ { - actualNames = append(actualNames, funcName(actualOpts.Index(i).Interface())) + f := runtimeFunc(actualOpts.Index(i).Interface()) + actualFuncs = append(actualFuncs, f) + actualNames = append(actualNames, funcName(f)) } - if !assert.ObjectsAreEqual(expectedNames, actualNames) { + + if expectedOpts.Len() != actualOpts.Len() { expectedFmt = fmt.Sprintf("%v", expectedNames) actualFmt = fmt.Sprintf("%v", actualNames) return } for i := 0; i < expectedOpts.Len(); i++ { - expectedOpt := expectedOpts.Index(i).Interface() - actualOpt := actualOpts.Index(i).Interface() - - expectedFunc := expectedNames[i] - actualFunc := actualNames[i] - if expectedFunc != actualFunc { - expectedFmt = expectedFunc - actualFmt = actualFunc + if !isFuncSame(expectedFuncs[i], actualFuncs[i]) { + expectedFmt = expectedNames[i] + actualFmt = actualNames[i] return } + expectedOpt := expectedOpts.Index(i).Interface() + actualOpt := actualOpts.Index(i).Interface() + ot := reflect.TypeOf(expectedOpt) var expectedValues []reflect.Value var actualValues []reflect.Value @@ -1224,9 +1253,9 @@ func assertOpts(expected, actual interface{}) (expectedFmt, actualFmt string) { reflect.ValueOf(actualOpt).Call(actualValues) for i := 0; i < ot.NumIn(); i++ { - if !assert.ObjectsAreEqual(expectedValues[i].Interface(), actualValues[i].Interface()) { - expectedFmt = fmt.Sprintf("%s %+v", expectedNames[i], expectedValues[i].Interface()) - actualFmt = fmt.Sprintf("%s %+v", expectedNames[i], actualValues[i].Interface()) + if expectedArg, actualArg := expectedValues[i].Interface(), actualValues[i].Interface(); !assert.ObjectsAreEqual(expectedArg, actualArg) { + expectedFmt = fmt.Sprintf("%s(%T) -> %#v", expectedNames[i], expectedArg, expectedArg) + actualFmt = fmt.Sprintf("%s(%T) -> %#v", expectedNames[i], actualArg, actualArg) return } } @@ -1235,7 +1264,25 @@ func assertOpts(expected, actual interface{}) (expectedFmt, actualFmt string) { return "", "" } -func funcName(opt interface{}) string { - n := runtime.FuncForPC(reflect.ValueOf(opt).Pointer()).Name() - return strings.TrimSuffix(path.Base(n), path.Ext(n)) +func runtimeFunc(opt interface{}) *runtime.Func { + return runtime.FuncForPC(reflect.ValueOf(opt).Pointer()) +} + +func funcName(f *runtime.Func) string { + name := f.Name() + trimmed := strings.TrimSuffix(path.Base(name), path.Ext(name)) + splitted := strings.Split(trimmed, ".") + + if len(splitted) == 0 { + return trimmed + } + + return splitted[len(splitted)-1] +} + +func isFuncSame(f1, f2 *runtime.Func) bool { + f1File, f1Loc := f1.FileLine(f1.Entry()) + f2File, f2Loc := f2.FileLine(f2.Entry()) + + return f1File == f2File && f1Loc == f2Loc } diff --git a/vendor/github.com/stretchr/testify/require/require.go b/vendor/github.com/stretchr/testify/require/require.go index 506a82f807..d8921950d7 100644 --- a/vendor/github.com/stretchr/testify/require/require.go +++ b/vendor/github.com/stretchr/testify/require/require.go @@ -34,9 +34,9 @@ func Conditionf(t TestingT, comp assert.Comparison, msg string, args ...interfac // Contains asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Contains(t, "Hello World", "World") -// assert.Contains(t, ["Hello", "World"], "World") -// assert.Contains(t, {"Hello": "World"}, "Hello") +// require.Contains(t, "Hello World", "World") +// require.Contains(t, ["Hello", "World"], "World") +// require.Contains(t, {"Hello": "World"}, "Hello") func Contains(t TestingT, s interface{}, contains interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -50,9 +50,9 @@ func Contains(t TestingT, s interface{}, contains interface{}, msgAndArgs ...int // Containsf asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Containsf(t, "Hello World", "World", "error message %s", "formatted") -// assert.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") -// assert.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") +// require.Containsf(t, "Hello World", "World", "error message %s", "formatted") +// require.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") +// require.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") func Containsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -91,7 +91,7 @@ func DirExistsf(t TestingT, path string, msg string, args ...interface{}) { // listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, // the number of appearances of each of them in both lists should match. // -// assert.ElementsMatch(t, [1, 3, 2, 3], [1, 3, 3, 2]) +// require.ElementsMatch(t, [1, 3, 2, 3], [1, 3, 3, 2]) func ElementsMatch(t TestingT, listA interface{}, listB interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -106,7 +106,7 @@ func ElementsMatch(t TestingT, listA interface{}, listB interface{}, msgAndArgs // listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, // the number of appearances of each of them in both lists should match. // -// assert.ElementsMatchf(t, [1, 3, 2, 3], [1, 3, 3, 2], "error message %s", "formatted") +// require.ElementsMatchf(t, [1, 3, 2, 3], [1, 3, 3, 2], "error message %s", "formatted") func ElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -120,7 +120,7 @@ func ElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string // Empty asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Empty(t, obj) +// require.Empty(t, obj) func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -134,7 +134,7 @@ func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) { // Emptyf asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Emptyf(t, obj, "error message %s", "formatted") +// require.Emptyf(t, obj, "error message %s", "formatted") func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -147,7 +147,7 @@ func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) { // Equal asserts that two objects are equal. // -// assert.Equal(t, 123, 123) +// require.Equal(t, 123, 123) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -166,7 +166,7 @@ func Equal(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...i // and that it is equal to the provided error. // // actualObj, err := SomeFunction() -// assert.EqualError(t, err, expectedErrorString) +// require.EqualError(t, err, expectedErrorString) func EqualError(t TestingT, theError error, errString string, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -181,7 +181,7 @@ func EqualError(t TestingT, theError error, errString string, msgAndArgs ...inte // and that it is equal to the provided error. // // actualObj, err := SomeFunction() -// assert.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") +// require.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") func EqualErrorf(t TestingT, theError error, errString string, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -200,8 +200,8 @@ func EqualErrorf(t TestingT, theError error, errString string, msg string, args // Exported int // notExported int // } -// assert.EqualExportedValues(t, S{1, 2}, S{1, 3}) => true -// assert.EqualExportedValues(t, S{1, 2}, S{2, 3}) => false +// require.EqualExportedValues(t, S{1, 2}, S{1, 3}) => true +// require.EqualExportedValues(t, S{1, 2}, S{2, 3}) => false func EqualExportedValues(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -220,8 +220,8 @@ func EqualExportedValues(t TestingT, expected interface{}, actual interface{}, m // Exported int // notExported int // } -// assert.EqualExportedValuesf(t, S{1, 2}, S{1, 3}, "error message %s", "formatted") => true -// assert.EqualExportedValuesf(t, S{1, 2}, S{2, 3}, "error message %s", "formatted") => false +// require.EqualExportedValuesf(t, S{1, 2}, S{1, 3}, "error message %s", "formatted") => true +// require.EqualExportedValuesf(t, S{1, 2}, S{2, 3}, "error message %s", "formatted") => false func EqualExportedValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -232,10 +232,10 @@ func EqualExportedValuesf(t TestingT, expected interface{}, actual interface{}, t.FailNow() } -// EqualValues asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValues asserts that two objects are equal or convertible to the larger +// type and equal. // -// assert.EqualValues(t, uint32(123), int32(123)) +// require.EqualValues(t, uint32(123), int32(123)) func EqualValues(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -246,10 +246,10 @@ func EqualValues(t TestingT, expected interface{}, actual interface{}, msgAndArg t.FailNow() } -// EqualValuesf asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValuesf asserts that two objects are equal or convertible to the larger +// type and equal. // -// assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") +// require.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -262,7 +262,7 @@ func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg stri // Equalf asserts that two objects are equal. // -// assert.Equalf(t, 123, 123, "error message %s", "formatted") +// require.Equalf(t, 123, 123, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -280,8 +280,8 @@ func Equalf(t TestingT, expected interface{}, actual interface{}, msg string, ar // Error asserts that a function returned an error (i.e. not `nil`). // // actualObj, err := SomeFunction() -// if assert.Error(t, err) { -// assert.Equal(t, expectedError, err) +// if require.Error(t, err) { +// require.Equal(t, expectedError, err) // } func Error(t TestingT, err error, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { @@ -321,7 +321,7 @@ func ErrorAsf(t TestingT, err error, target interface{}, msg string, args ...int // and that the error contains the specified substring. // // actualObj, err := SomeFunction() -// assert.ErrorContains(t, err, expectedErrorSubString) +// require.ErrorContains(t, err, expectedErrorSubString) func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -336,7 +336,7 @@ func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...in // and that the error contains the specified substring. // // actualObj, err := SomeFunction() -// assert.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") +// require.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") func ErrorContainsf(t TestingT, theError error, contains string, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -374,8 +374,8 @@ func ErrorIsf(t TestingT, err error, target error, msg string, args ...interface // Errorf asserts that a function returned an error (i.e. not `nil`). // // actualObj, err := SomeFunction() -// if assert.Errorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedErrorf, err) +// if require.Errorf(t, err, "error message %s", "formatted") { +// require.Equal(t, expectedErrorf, err) // } func Errorf(t TestingT, err error, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { @@ -390,7 +390,7 @@ func Errorf(t TestingT, err error, msg string, args ...interface{}) { // Eventually asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) +// require.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -415,10 +415,10 @@ func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick t // time.Sleep(8*time.Second) // externalValue = true // }() -// assert.EventuallyWithT(t, func(c *assert.CollectT) { +// require.EventuallyWithT(t, func(c *require.CollectT) { // // add assertions as needed; any assertion failure will fail the current tick -// assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// require.True(c, externalValue, "expected 'externalValue' to be true") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func EventuallyWithT(t TestingT, condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -443,10 +443,10 @@ func EventuallyWithT(t TestingT, condition func(collect *assert.CollectT), waitF // time.Sleep(8*time.Second) // externalValue = true // }() -// assert.EventuallyWithTf(t, func(c *assert.CollectT, "error message %s", "formatted") { +// require.EventuallyWithTf(t, func(c *require.CollectT, "error message %s", "formatted") { // // add assertions as needed; any assertion failure will fail the current tick -// assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// require.True(c, externalValue, "expected 'externalValue' to be true") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func EventuallyWithTf(t TestingT, condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -460,7 +460,7 @@ func EventuallyWithTf(t TestingT, condition func(collect *assert.CollectT), wait // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// require.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -473,7 +473,7 @@ func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick // Exactly asserts that two objects are equal in value and type. // -// assert.Exactly(t, int32(123), int64(123)) +// require.Exactly(t, int32(123), int64(123)) func Exactly(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -486,7 +486,7 @@ func Exactly(t TestingT, expected interface{}, actual interface{}, msgAndArgs .. // Exactlyf asserts that two objects are equal in value and type. // -// assert.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") +// require.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") func Exactlyf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -543,7 +543,7 @@ func Failf(t TestingT, failureMessage string, msg string, args ...interface{}) { // False asserts that the specified value is false. // -// assert.False(t, myBool) +// require.False(t, myBool) func False(t TestingT, value bool, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -556,7 +556,7 @@ func False(t TestingT, value bool, msgAndArgs ...interface{}) { // Falsef asserts that the specified value is false. // -// assert.Falsef(t, myBool, "error message %s", "formatted") +// require.Falsef(t, myBool, "error message %s", "formatted") func Falsef(t TestingT, value bool, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -593,9 +593,9 @@ func FileExistsf(t TestingT, path string, msg string, args ...interface{}) { // Greater asserts that the first element is greater than the second // -// assert.Greater(t, 2, 1) -// assert.Greater(t, float64(2), float64(1)) -// assert.Greater(t, "b", "a") +// require.Greater(t, 2, 1) +// require.Greater(t, float64(2), float64(1)) +// require.Greater(t, "b", "a") func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -608,10 +608,10 @@ func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface // GreaterOrEqual asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqual(t, 2, 1) -// assert.GreaterOrEqual(t, 2, 2) -// assert.GreaterOrEqual(t, "b", "a") -// assert.GreaterOrEqual(t, "b", "b") +// require.GreaterOrEqual(t, 2, 1) +// require.GreaterOrEqual(t, 2, 2) +// require.GreaterOrEqual(t, "b", "a") +// require.GreaterOrEqual(t, "b", "b") func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -624,10 +624,10 @@ func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...in // GreaterOrEqualf asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") +// require.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") +// require.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") +// require.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") +// require.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -640,9 +640,9 @@ func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, arg // Greaterf asserts that the first element is greater than the second // -// assert.Greaterf(t, 2, 1, "error message %s", "formatted") -// assert.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") -// assert.Greaterf(t, "b", "a", "error message %s", "formatted") +// require.Greaterf(t, 2, 1, "error message %s", "formatted") +// require.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") +// require.Greaterf(t, "b", "a", "error message %s", "formatted") func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -656,7 +656,7 @@ func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...in // HTTPBodyContains asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// require.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) { @@ -672,7 +672,7 @@ func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method string, url s // HTTPBodyContainsf asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// require.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) { @@ -688,7 +688,7 @@ func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url // HTTPBodyNotContains asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// require.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContains(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) { @@ -704,7 +704,7 @@ func HTTPBodyNotContains(t TestingT, handler http.HandlerFunc, method string, ur // HTTPBodyNotContainsf asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// require.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) { @@ -719,7 +719,7 @@ func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, u // HTTPError asserts that a specified handler returns an error status code. // -// assert.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// require.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPError(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -734,7 +734,7 @@ func HTTPError(t TestingT, handler http.HandlerFunc, method string, url string, // HTTPErrorf asserts that a specified handler returns an error status code. // -// assert.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// require.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -749,7 +749,7 @@ func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, // HTTPRedirect asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// require.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirect(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -764,7 +764,7 @@ func HTTPRedirect(t TestingT, handler http.HandlerFunc, method string, url strin // HTTPRedirectf asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// require.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -779,7 +779,7 @@ func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url stri // HTTPStatusCode asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) +// require.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msgAndArgs ...interface{}) { @@ -794,7 +794,7 @@ func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method string, url str // HTTPStatusCodef asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") +// require.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msg string, args ...interface{}) { @@ -809,7 +809,7 @@ func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url st // HTTPSuccess asserts that a specified handler returns a success status code. // -// assert.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) +// require.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccess(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -824,7 +824,7 @@ func HTTPSuccess(t TestingT, handler http.HandlerFunc, method string, url string // HTTPSuccessf asserts that a specified handler returns a success status code. // -// assert.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") +// require.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -839,7 +839,7 @@ func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url strin // Implements asserts that an object is implemented by the specified interface. // -// assert.Implements(t, (*MyInterface)(nil), new(MyObject)) +// require.Implements(t, (*MyInterface)(nil), new(MyObject)) func Implements(t TestingT, interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -852,7 +852,7 @@ func Implements(t TestingT, interfaceObject interface{}, object interface{}, msg // Implementsf asserts that an object is implemented by the specified interface. // -// assert.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// require.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -865,7 +865,7 @@ func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, ms // InDelta asserts that the two numerals are within delta of each other. // -// assert.InDelta(t, math.Pi, 22/7.0, 0.01) +// require.InDelta(t, math.Pi, 22/7.0, 0.01) func InDelta(t TestingT, expected interface{}, actual interface{}, delta float64, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -922,7 +922,7 @@ func InDeltaSlicef(t TestingT, expected interface{}, actual interface{}, delta f // InDeltaf asserts that the two numerals are within delta of each other. // -// assert.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") +// require.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") func InDeltaf(t TestingT, expected interface{}, actual interface{}, delta float64, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -979,9 +979,9 @@ func InEpsilonf(t TestingT, expected interface{}, actual interface{}, epsilon fl // IsDecreasing asserts that the collection is decreasing // -// assert.IsDecreasing(t, []int{2, 1, 0}) -// assert.IsDecreasing(t, []float{2, 1}) -// assert.IsDecreasing(t, []string{"b", "a"}) +// require.IsDecreasing(t, []int{2, 1, 0}) +// require.IsDecreasing(t, []float{2, 1}) +// require.IsDecreasing(t, []string{"b", "a"}) func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -994,9 +994,9 @@ func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { // IsDecreasingf asserts that the collection is decreasing // -// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// require.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") +// require.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") +// require.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1009,9 +1009,9 @@ func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface // IsIncreasing asserts that the collection is increasing // -// assert.IsIncreasing(t, []int{1, 2, 3}) -// assert.IsIncreasing(t, []float{1, 2}) -// assert.IsIncreasing(t, []string{"a", "b"}) +// require.IsIncreasing(t, []int{1, 2, 3}) +// require.IsIncreasing(t, []float{1, 2}) +// require.IsIncreasing(t, []string{"a", "b"}) func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1024,9 +1024,9 @@ func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { // IsIncreasingf asserts that the collection is increasing // -// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// require.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") +// require.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") +// require.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1039,9 +1039,9 @@ func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface // IsNonDecreasing asserts that the collection is not decreasing // -// assert.IsNonDecreasing(t, []int{1, 1, 2}) -// assert.IsNonDecreasing(t, []float{1, 2}) -// assert.IsNonDecreasing(t, []string{"a", "b"}) +// require.IsNonDecreasing(t, []int{1, 1, 2}) +// require.IsNonDecreasing(t, []float{1, 2}) +// require.IsNonDecreasing(t, []string{"a", "b"}) func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1054,9 +1054,9 @@ func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) // IsNonDecreasingf asserts that the collection is not decreasing // -// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// require.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") +// require.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") +// require.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1069,9 +1069,9 @@ func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interf // IsNonIncreasing asserts that the collection is not increasing // -// assert.IsNonIncreasing(t, []int{2, 1, 1}) -// assert.IsNonIncreasing(t, []float{2, 1}) -// assert.IsNonIncreasing(t, []string{"b", "a"}) +// require.IsNonIncreasing(t, []int{2, 1, 1}) +// require.IsNonIncreasing(t, []float{2, 1}) +// require.IsNonIncreasing(t, []string{"b", "a"}) func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1084,9 +1084,9 @@ func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) // IsNonIncreasingf asserts that the collection is not increasing // -// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// require.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") +// require.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") +// require.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsNonIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1121,7 +1121,7 @@ func IsTypef(t TestingT, expectedType interface{}, object interface{}, msg strin // JSONEq asserts that two JSON strings are equivalent. // -// assert.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) +// require.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) func JSONEq(t TestingT, expected string, actual string, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1134,7 +1134,7 @@ func JSONEq(t TestingT, expected string, actual string, msgAndArgs ...interface{ // JSONEqf asserts that two JSON strings are equivalent. // -// assert.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") +// require.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") func JSONEqf(t TestingT, expected string, actual string, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1148,7 +1148,7 @@ func JSONEqf(t TestingT, expected string, actual string, msg string, args ...int // Len asserts that the specified object has specific length. // Len also fails if the object has a type that len() not accept. // -// assert.Len(t, mySlice, 3) +// require.Len(t, mySlice, 3) func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1162,7 +1162,7 @@ func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) // Lenf asserts that the specified object has specific length. // Lenf also fails if the object has a type that len() not accept. // -// assert.Lenf(t, mySlice, 3, "error message %s", "formatted") +// require.Lenf(t, mySlice, 3, "error message %s", "formatted") func Lenf(t TestingT, object interface{}, length int, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1175,9 +1175,9 @@ func Lenf(t TestingT, object interface{}, length int, msg string, args ...interf // Less asserts that the first element is less than the second // -// assert.Less(t, 1, 2) -// assert.Less(t, float64(1), float64(2)) -// assert.Less(t, "a", "b") +// require.Less(t, 1, 2) +// require.Less(t, float64(1), float64(2)) +// require.Less(t, "a", "b") func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1190,10 +1190,10 @@ func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) // LessOrEqual asserts that the first element is less than or equal to the second // -// assert.LessOrEqual(t, 1, 2) -// assert.LessOrEqual(t, 2, 2) -// assert.LessOrEqual(t, "a", "b") -// assert.LessOrEqual(t, "b", "b") +// require.LessOrEqual(t, 1, 2) +// require.LessOrEqual(t, 2, 2) +// require.LessOrEqual(t, "a", "b") +// require.LessOrEqual(t, "b", "b") func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1206,10 +1206,10 @@ func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...inter // LessOrEqualf asserts that the first element is less than or equal to the second // -// assert.LessOrEqualf(t, 1, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, "a", "b", "error message %s", "formatted") -// assert.LessOrEqualf(t, "b", "b", "error message %s", "formatted") +// require.LessOrEqualf(t, 1, 2, "error message %s", "formatted") +// require.LessOrEqualf(t, 2, 2, "error message %s", "formatted") +// require.LessOrEqualf(t, "a", "b", "error message %s", "formatted") +// require.LessOrEqualf(t, "b", "b", "error message %s", "formatted") func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1222,9 +1222,9 @@ func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args . // Lessf asserts that the first element is less than the second // -// assert.Lessf(t, 1, 2, "error message %s", "formatted") -// assert.Lessf(t, float64(1), float64(2), "error message %s", "formatted") -// assert.Lessf(t, "a", "b", "error message %s", "formatted") +// require.Lessf(t, 1, 2, "error message %s", "formatted") +// require.Lessf(t, float64(1), float64(2), "error message %s", "formatted") +// require.Lessf(t, "a", "b", "error message %s", "formatted") func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1237,8 +1237,8 @@ func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...inter // Negative asserts that the specified element is negative // -// assert.Negative(t, -1) -// assert.Negative(t, -1.23) +// require.Negative(t, -1) +// require.Negative(t, -1.23) func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1251,8 +1251,8 @@ func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) { // Negativef asserts that the specified element is negative // -// assert.Negativef(t, -1, "error message %s", "formatted") -// assert.Negativef(t, -1.23, "error message %s", "formatted") +// require.Negativef(t, -1, "error message %s", "formatted") +// require.Negativef(t, -1.23, "error message %s", "formatted") func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1266,7 +1266,7 @@ func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) { // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) +// require.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) func Never(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1280,7 +1280,7 @@ func Never(t TestingT, condition func() bool, waitFor time.Duration, tick time.D // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// require.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1293,7 +1293,7 @@ func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time. // Nil asserts that the specified object is nil. // -// assert.Nil(t, err) +// require.Nil(t, err) func Nil(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1306,7 +1306,7 @@ func Nil(t TestingT, object interface{}, msgAndArgs ...interface{}) { // Nilf asserts that the specified object is nil. // -// assert.Nilf(t, err, "error message %s", "formatted") +// require.Nilf(t, err, "error message %s", "formatted") func Nilf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1344,8 +1344,8 @@ func NoDirExistsf(t TestingT, path string, msg string, args ...interface{}) { // NoError asserts that a function returned no error (i.e. `nil`). // // actualObj, err := SomeFunction() -// if assert.NoError(t, err) { -// assert.Equal(t, expectedObj, actualObj) +// if require.NoError(t, err) { +// require.Equal(t, expectedObj, actualObj) // } func NoError(t TestingT, err error, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1360,8 +1360,8 @@ func NoError(t TestingT, err error, msgAndArgs ...interface{}) { // NoErrorf asserts that a function returned no error (i.e. `nil`). // // actualObj, err := SomeFunction() -// if assert.NoErrorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedObj, actualObj) +// if require.NoErrorf(t, err, "error message %s", "formatted") { +// require.Equal(t, expectedObj, actualObj) // } func NoErrorf(t TestingT, err error, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1400,9 +1400,9 @@ func NoFileExistsf(t TestingT, path string, msg string, args ...interface{}) { // NotContains asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContains(t, "Hello World", "Earth") -// assert.NotContains(t, ["Hello", "World"], "Earth") -// assert.NotContains(t, {"Hello": "World"}, "Earth") +// require.NotContains(t, "Hello World", "Earth") +// require.NotContains(t, ["Hello", "World"], "Earth") +// require.NotContains(t, {"Hello": "World"}, "Earth") func NotContains(t TestingT, s interface{}, contains interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1416,9 +1416,9 @@ func NotContains(t TestingT, s interface{}, contains interface{}, msgAndArgs ... // NotContainsf asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") +// require.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") +// require.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") +// require.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1429,11 +1429,51 @@ func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, a t.FailNow() } +// NotElementsMatch asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// require.NotElementsMatch(t, [1, 1, 2, 3], [1, 1, 2, 3]) -> false +// +// require.NotElementsMatch(t, [1, 1, 2, 3], [1, 2, 3]) -> true +// +// require.NotElementsMatch(t, [1, 2, 3], [1, 2, 4]) -> true +func NotElementsMatch(t TestingT, listA interface{}, listB interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotElementsMatch(t, listA, listB, msgAndArgs...) { + return + } + t.FailNow() +} + +// NotElementsMatchf asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// require.NotElementsMatchf(t, [1, 1, 2, 3], [1, 1, 2, 3], "error message %s", "formatted") -> false +// +// require.NotElementsMatchf(t, [1, 1, 2, 3], [1, 2, 3], "error message %s", "formatted") -> true +// +// require.NotElementsMatchf(t, [1, 2, 3], [1, 2, 4], "error message %s", "formatted") -> true +func NotElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotElementsMatchf(t, listA, listB, msg, args...) { + return + } + t.FailNow() +} + // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmpty(t, obj) { -// assert.Equal(t, "two", obj[1]) +// if require.NotEmpty(t, obj) { +// require.Equal(t, "two", obj[1]) // } func NotEmpty(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1448,8 +1488,8 @@ func NotEmpty(t TestingT, object interface{}, msgAndArgs ...interface{}) { // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmptyf(t, obj, "error message %s", "formatted") { -// assert.Equal(t, "two", obj[1]) +// if require.NotEmptyf(t, obj, "error message %s", "formatted") { +// require.Equal(t, "two", obj[1]) // } func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1463,7 +1503,7 @@ func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) // NotEqual asserts that the specified values are NOT equal. // -// assert.NotEqual(t, obj1, obj2) +// require.NotEqual(t, obj1, obj2) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1479,7 +1519,7 @@ func NotEqual(t TestingT, expected interface{}, actual interface{}, msgAndArgs . // NotEqualValues asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValues(t, obj1, obj2) +// require.NotEqualValues(t, obj1, obj2) func NotEqualValues(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1492,7 +1532,7 @@ func NotEqualValues(t TestingT, expected interface{}, actual interface{}, msgAnd // NotEqualValuesf asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") +// require.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1505,7 +1545,7 @@ func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg s // NotEqualf asserts that the specified values are NOT equal. // -// assert.NotEqualf(t, obj1, obj2, "error message %s", "formatted") +// require.NotEqualf(t, obj1, obj2, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1519,7 +1559,31 @@ func NotEqualf(t TestingT, expected interface{}, actual interface{}, msg string, t.FailNow() } -// NotErrorIs asserts that at none of the errors in err's chain matches target. +// NotErrorAs asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func NotErrorAs(t TestingT, err error, target interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotErrorAs(t, err, target, msgAndArgs...) { + return + } + t.FailNow() +} + +// NotErrorAsf asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func NotErrorAsf(t TestingT, err error, target interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotErrorAsf(t, err, target, msg, args...) { + return + } + t.FailNow() +} + +// NotErrorIs asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func NotErrorIs(t TestingT, err error, target error, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1531,7 +1595,7 @@ func NotErrorIs(t TestingT, err error, target error, msgAndArgs ...interface{}) t.FailNow() } -// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// NotErrorIsf asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1545,7 +1609,7 @@ func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interf // NotImplements asserts that an object does not implement the specified interface. // -// assert.NotImplements(t, (*MyInterface)(nil), new(MyObject)) +// require.NotImplements(t, (*MyInterface)(nil), new(MyObject)) func NotImplements(t TestingT, interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1558,7 +1622,7 @@ func NotImplements(t TestingT, interfaceObject interface{}, object interface{}, // NotImplementsf asserts that an object does not implement the specified interface. // -// assert.NotImplementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// require.NotImplementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func NotImplementsf(t TestingT, interfaceObject interface{}, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1571,7 +1635,7 @@ func NotImplementsf(t TestingT, interfaceObject interface{}, object interface{}, // NotNil asserts that the specified object is not nil. // -// assert.NotNil(t, err) +// require.NotNil(t, err) func NotNil(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1584,7 +1648,7 @@ func NotNil(t TestingT, object interface{}, msgAndArgs ...interface{}) { // NotNilf asserts that the specified object is not nil. // -// assert.NotNilf(t, err, "error message %s", "formatted") +// require.NotNilf(t, err, "error message %s", "formatted") func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1597,7 +1661,7 @@ func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) { // NotPanics asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanics(t, func(){ RemainCalm() }) +// require.NotPanics(t, func(){ RemainCalm() }) func NotPanics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1610,7 +1674,7 @@ func NotPanics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { // NotPanicsf asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") +// require.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") func NotPanicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1623,8 +1687,8 @@ func NotPanicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interfac // NotRegexp asserts that a specified regexp does not match a string. // -// assert.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") -// assert.NotRegexp(t, "^start", "it's not starting") +// require.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") +// require.NotRegexp(t, "^start", "it's not starting") func NotRegexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1637,8 +1701,8 @@ func NotRegexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interf // NotRegexpf asserts that a specified regexp does not match a string. // -// assert.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") -// assert.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") +// require.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") +// require.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1651,7 +1715,7 @@ func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args .. // NotSame asserts that two pointers do not reference the same object. // -// assert.NotSame(t, ptr1, ptr2) +// require.NotSame(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1667,7 +1731,7 @@ func NotSame(t TestingT, expected interface{}, actual interface{}, msgAndArgs .. // NotSamef asserts that two pointers do not reference the same object. // -// assert.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") +// require.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1685,8 +1749,8 @@ func NotSamef(t TestingT, expected interface{}, actual interface{}, msg string, // contain all elements given in the specified subset list(array, slice...) or // map. // -// assert.NotSubset(t, [1, 3, 4], [1, 2]) -// assert.NotSubset(t, {"x": 1, "y": 2}, {"z": 3}) +// require.NotSubset(t, [1, 3, 4], [1, 2]) +// require.NotSubset(t, {"x": 1, "y": 2}, {"z": 3}) func NotSubset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1701,8 +1765,8 @@ func NotSubset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...i // contain all elements given in the specified subset list(array, slice...) or // map. // -// assert.NotSubsetf(t, [1, 3, 4], [1, 2], "error message %s", "formatted") -// assert.NotSubsetf(t, {"x": 1, "y": 2}, {"z": 3}, "error message %s", "formatted") +// require.NotSubsetf(t, [1, 3, 4], [1, 2], "error message %s", "formatted") +// require.NotSubsetf(t, {"x": 1, "y": 2}, {"z": 3}, "error message %s", "formatted") func NotSubsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1737,7 +1801,7 @@ func NotZerof(t TestingT, i interface{}, msg string, args ...interface{}) { // Panics asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panics(t, func(){ GoCrazy() }) +// require.Panics(t, func(){ GoCrazy() }) func Panics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1752,7 +1816,7 @@ func Panics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) +// require.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) func PanicsWithError(t TestingT, errString string, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1767,7 +1831,7 @@ func PanicsWithError(t TestingT, errString string, f assert.PanicTestFunc, msgAn // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// require.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithErrorf(t TestingT, errString string, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1781,7 +1845,7 @@ func PanicsWithErrorf(t TestingT, errString string, f assert.PanicTestFunc, msg // PanicsWithValue asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) +// require.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) func PanicsWithValue(t TestingT, expected interface{}, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1795,7 +1859,7 @@ func PanicsWithValue(t TestingT, expected interface{}, f assert.PanicTestFunc, m // PanicsWithValuef asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// require.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithValuef(t TestingT, expected interface{}, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1808,7 +1872,7 @@ func PanicsWithValuef(t TestingT, expected interface{}, f assert.PanicTestFunc, // Panicsf asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") +// require.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") func Panicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1821,8 +1885,8 @@ func Panicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{} // Positive asserts that the specified element is positive // -// assert.Positive(t, 1) -// assert.Positive(t, 1.23) +// require.Positive(t, 1) +// require.Positive(t, 1.23) func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1835,8 +1899,8 @@ func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) { // Positivef asserts that the specified element is positive // -// assert.Positivef(t, 1, "error message %s", "formatted") -// assert.Positivef(t, 1.23, "error message %s", "formatted") +// require.Positivef(t, 1, "error message %s", "formatted") +// require.Positivef(t, 1.23, "error message %s", "formatted") func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1849,8 +1913,8 @@ func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) { // Regexp asserts that a specified regexp matches a string. // -// assert.Regexp(t, regexp.MustCompile("start"), "it's starting") -// assert.Regexp(t, "start...$", "it's not starting") +// require.Regexp(t, regexp.MustCompile("start"), "it's starting") +// require.Regexp(t, "start...$", "it's not starting") func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1863,8 +1927,8 @@ func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface // Regexpf asserts that a specified regexp matches a string. // -// assert.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") -// assert.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") +// require.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") +// require.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1877,7 +1941,7 @@ func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...in // Same asserts that two pointers reference the same object. // -// assert.Same(t, ptr1, ptr2) +// require.Same(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1893,7 +1957,7 @@ func Same(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...in // Samef asserts that two pointers reference the same object. // -// assert.Samef(t, ptr1, ptr2, "error message %s", "formatted") +// require.Samef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1910,8 +1974,8 @@ func Samef(t TestingT, expected interface{}, actual interface{}, msg string, arg // Subset asserts that the specified list(array, slice...) or map contains all // elements given in the specified subset list(array, slice...) or map. // -// assert.Subset(t, [1, 2, 3], [1, 2]) -// assert.Subset(t, {"x": 1, "y": 2}, {"x": 1}) +// require.Subset(t, [1, 2, 3], [1, 2]) +// require.Subset(t, {"x": 1, "y": 2}, {"x": 1}) func Subset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1925,8 +1989,8 @@ func Subset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...inte // Subsetf asserts that the specified list(array, slice...) or map contains all // elements given in the specified subset list(array, slice...) or map. // -// assert.Subsetf(t, [1, 2, 3], [1, 2], "error message %s", "formatted") -// assert.Subsetf(t, {"x": 1, "y": 2}, {"x": 1}, "error message %s", "formatted") +// require.Subsetf(t, [1, 2, 3], [1, 2], "error message %s", "formatted") +// require.Subsetf(t, {"x": 1, "y": 2}, {"x": 1}, "error message %s", "formatted") func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1939,7 +2003,7 @@ func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args // True asserts that the specified value is true. // -// assert.True(t, myBool) +// require.True(t, myBool) func True(t TestingT, value bool, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1952,7 +2016,7 @@ func True(t TestingT, value bool, msgAndArgs ...interface{}) { // Truef asserts that the specified value is true. // -// assert.Truef(t, myBool, "error message %s", "formatted") +// require.Truef(t, myBool, "error message %s", "formatted") func Truef(t TestingT, value bool, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1965,7 +2029,7 @@ func Truef(t TestingT, value bool, msg string, args ...interface{}) { // WithinDuration asserts that the two times are within duration delta of each other. // -// assert.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) +// require.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) func WithinDuration(t TestingT, expected time.Time, actual time.Time, delta time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1978,7 +2042,7 @@ func WithinDuration(t TestingT, expected time.Time, actual time.Time, delta time // WithinDurationf asserts that the two times are within duration delta of each other. // -// assert.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") +// require.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1991,7 +2055,7 @@ func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta tim // WithinRange asserts that a time is within a time range (inclusive). // -// assert.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) +// require.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) func WithinRange(t TestingT, actual time.Time, start time.Time, end time.Time, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -2004,7 +2068,7 @@ func WithinRange(t TestingT, actual time.Time, start time.Time, end time.Time, m // WithinRangef asserts that a time is within a time range (inclusive). // -// assert.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") +// require.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") func WithinRangef(t TestingT, actual time.Time, start time.Time, end time.Time, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/require/require.go.tmpl b/vendor/github.com/stretchr/testify/require/require.go.tmpl index 55e42ddebd..8b32836850 100644 --- a/vendor/github.com/stretchr/testify/require/require.go.tmpl +++ b/vendor/github.com/stretchr/testify/require/require.go.tmpl @@ -1,4 +1,4 @@ -{{.Comment}} +{{ replace .Comment "assert." "require."}} func {{.DocInfo.Name}}(t TestingT, {{.Params}}) { if h, ok := t.(tHelper); ok { h.Helper() } if assert.{{.DocInfo.Name}}(t, {{.ForwardedParams}}) { return } diff --git a/vendor/github.com/stretchr/testify/require/require_forward.go b/vendor/github.com/stretchr/testify/require/require_forward.go index eee8310a5f..1bd87304f4 100644 --- a/vendor/github.com/stretchr/testify/require/require_forward.go +++ b/vendor/github.com/stretchr/testify/require/require_forward.go @@ -187,8 +187,8 @@ func (a *Assertions) EqualExportedValuesf(expected interface{}, actual interface EqualExportedValuesf(a.t, expected, actual, msg, args...) } -// EqualValues asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValues asserts that two objects are equal or convertible to the larger +// type and equal. // // a.EqualValues(uint32(123), int32(123)) func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) { @@ -198,8 +198,8 @@ func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAn EqualValues(a.t, expected, actual, msgAndArgs...) } -// EqualValuesf asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValuesf asserts that two objects are equal or convertible to the larger +// type and equal. // // a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) { @@ -337,7 +337,7 @@ func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, ti // a.EventuallyWithT(func(c *assert.CollectT) { // // add assertions as needed; any assertion failure will fail the current tick // assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func (a *Assertions) EventuallyWithT(condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -362,7 +362,7 @@ func (a *Assertions) EventuallyWithT(condition func(collect *assert.CollectT), w // a.EventuallyWithTf(func(c *assert.CollectT, "error message %s", "formatted") { // // add assertions as needed; any assertion failure will fail the current tick // assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func (a *Assertions) EventuallyWithTf(condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1129,6 +1129,40 @@ func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg strin NotContainsf(a.t, s, contains, msg, args...) } +// NotElementsMatch asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// a.NotElementsMatch([1, 1, 2, 3], [1, 1, 2, 3]) -> false +// +// a.NotElementsMatch([1, 1, 2, 3], [1, 2, 3]) -> true +// +// a.NotElementsMatch([1, 2, 3], [1, 2, 4]) -> true +func (a *Assertions) NotElementsMatch(listA interface{}, listB interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotElementsMatch(a.t, listA, listB, msgAndArgs...) +} + +// NotElementsMatchf asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// a.NotElementsMatchf([1, 1, 2, 3], [1, 1, 2, 3], "error message %s", "formatted") -> false +// +// a.NotElementsMatchf([1, 1, 2, 3], [1, 2, 3], "error message %s", "formatted") -> true +// +// a.NotElementsMatchf([1, 2, 3], [1, 2, 4], "error message %s", "formatted") -> true +func (a *Assertions) NotElementsMatchf(listA interface{}, listB interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotElementsMatchf(a.t, listA, listB, msg, args...) +} + // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // @@ -1201,7 +1235,25 @@ func (a *Assertions) NotEqualf(expected interface{}, actual interface{}, msg str NotEqualf(a.t, expected, actual, msg, args...) } -// NotErrorIs asserts that at none of the errors in err's chain matches target. +// NotErrorAs asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func (a *Assertions) NotErrorAs(err error, target interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotErrorAs(a.t, err, target, msgAndArgs...) +} + +// NotErrorAsf asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func (a *Assertions) NotErrorAsf(err error, target interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotErrorAsf(a.t, err, target, msg, args...) +} + +// NotErrorIs asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { @@ -1210,7 +1262,7 @@ func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface NotErrorIs(a.t, err, target, msgAndArgs...) } -// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// NotErrorIsf asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { diff --git a/vendor/github.com/stretchr/testify/require/requirements.go b/vendor/github.com/stretchr/testify/require/requirements.go index 91772dfeb9..6b7ce929eb 100644 --- a/vendor/github.com/stretchr/testify/require/requirements.go +++ b/vendor/github.com/stretchr/testify/require/requirements.go @@ -6,7 +6,7 @@ type TestingT interface { FailNow() } -type tHelper interface { +type tHelper = interface { Helper() } diff --git a/vendor/golang.org/x/crypto/chacha20/chacha_noasm.go b/vendor/golang.org/x/crypto/chacha20/chacha_noasm.go index db42e6676a..c709b72847 100644 --- a/vendor/golang.org/x/crypto/chacha20/chacha_noasm.go +++ b/vendor/golang.org/x/crypto/chacha20/chacha_noasm.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build (!arm64 && !s390x && !ppc64le) || !gc || purego +//go:build (!arm64 && !s390x && !ppc64 && !ppc64le) || !gc || purego package chacha20 diff --git a/vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.go b/vendor/golang.org/x/crypto/chacha20/chacha_ppc64x.go similarity index 89% rename from vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.go rename to vendor/golang.org/x/crypto/chacha20/chacha_ppc64x.go index 3a4287f990..bd183d9ba1 100644 --- a/vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.go +++ b/vendor/golang.org/x/crypto/chacha20/chacha_ppc64x.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build gc && !purego +//go:build gc && !purego && (ppc64 || ppc64le) package chacha20 diff --git a/vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.s b/vendor/golang.org/x/crypto/chacha20/chacha_ppc64x.s similarity index 76% rename from vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.s rename to vendor/golang.org/x/crypto/chacha20/chacha_ppc64x.s index c672ccf698..a660b4112f 100644 --- a/vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.s +++ b/vendor/golang.org/x/crypto/chacha20/chacha_ppc64x.s @@ -19,7 +19,7 @@ // The differences in this and the original implementation are // due to the calling conventions and initialization of constants. -//go:build gc && !purego +//go:build gc && !purego && (ppc64 || ppc64le) #include "textflag.h" @@ -36,32 +36,68 @@ // for VPERMXOR #define MASK R18 -DATA consts<>+0x00(SB)/8, $0x3320646e61707865 -DATA consts<>+0x08(SB)/8, $0x6b20657479622d32 -DATA consts<>+0x10(SB)/8, $0x0000000000000001 -DATA consts<>+0x18(SB)/8, $0x0000000000000000 -DATA consts<>+0x20(SB)/8, $0x0000000000000004 -DATA consts<>+0x28(SB)/8, $0x0000000000000000 -DATA consts<>+0x30(SB)/8, $0x0a0b08090e0f0c0d -DATA consts<>+0x38(SB)/8, $0x0203000106070405 -DATA consts<>+0x40(SB)/8, $0x090a0b080d0e0f0c -DATA consts<>+0x48(SB)/8, $0x0102030005060704 -DATA consts<>+0x50(SB)/8, $0x6170786561707865 -DATA consts<>+0x58(SB)/8, $0x6170786561707865 -DATA consts<>+0x60(SB)/8, $0x3320646e3320646e -DATA consts<>+0x68(SB)/8, $0x3320646e3320646e -DATA consts<>+0x70(SB)/8, $0x79622d3279622d32 -DATA consts<>+0x78(SB)/8, $0x79622d3279622d32 -DATA consts<>+0x80(SB)/8, $0x6b2065746b206574 -DATA consts<>+0x88(SB)/8, $0x6b2065746b206574 -DATA consts<>+0x90(SB)/8, $0x0000000100000000 -DATA consts<>+0x98(SB)/8, $0x0000000300000002 -DATA consts<>+0xa0(SB)/8, $0x5566774411223300 -DATA consts<>+0xa8(SB)/8, $0xddeeffcc99aabb88 -DATA consts<>+0xb0(SB)/8, $0x6677445522330011 -DATA consts<>+0xb8(SB)/8, $0xeeffccddaabb8899 +DATA consts<>+0x00(SB)/4, $0x61707865 +DATA consts<>+0x04(SB)/4, $0x3320646e +DATA consts<>+0x08(SB)/4, $0x79622d32 +DATA consts<>+0x0c(SB)/4, $0x6b206574 +DATA consts<>+0x10(SB)/4, $0x00000001 +DATA consts<>+0x14(SB)/4, $0x00000000 +DATA consts<>+0x18(SB)/4, $0x00000000 +DATA consts<>+0x1c(SB)/4, $0x00000000 +DATA consts<>+0x20(SB)/4, $0x00000004 +DATA consts<>+0x24(SB)/4, $0x00000000 +DATA consts<>+0x28(SB)/4, $0x00000000 +DATA consts<>+0x2c(SB)/4, $0x00000000 +DATA consts<>+0x30(SB)/4, $0x0e0f0c0d +DATA consts<>+0x34(SB)/4, $0x0a0b0809 +DATA consts<>+0x38(SB)/4, $0x06070405 +DATA consts<>+0x3c(SB)/4, $0x02030001 +DATA consts<>+0x40(SB)/4, $0x0d0e0f0c +DATA consts<>+0x44(SB)/4, $0x090a0b08 +DATA consts<>+0x48(SB)/4, $0x05060704 +DATA consts<>+0x4c(SB)/4, $0x01020300 +DATA consts<>+0x50(SB)/4, $0x61707865 +DATA consts<>+0x54(SB)/4, $0x61707865 +DATA consts<>+0x58(SB)/4, $0x61707865 +DATA consts<>+0x5c(SB)/4, $0x61707865 +DATA consts<>+0x60(SB)/4, $0x3320646e +DATA consts<>+0x64(SB)/4, $0x3320646e +DATA consts<>+0x68(SB)/4, $0x3320646e +DATA consts<>+0x6c(SB)/4, $0x3320646e +DATA consts<>+0x70(SB)/4, $0x79622d32 +DATA consts<>+0x74(SB)/4, $0x79622d32 +DATA consts<>+0x78(SB)/4, $0x79622d32 +DATA consts<>+0x7c(SB)/4, $0x79622d32 +DATA consts<>+0x80(SB)/4, $0x6b206574 +DATA consts<>+0x84(SB)/4, $0x6b206574 +DATA consts<>+0x88(SB)/4, $0x6b206574 +DATA consts<>+0x8c(SB)/4, $0x6b206574 +DATA consts<>+0x90(SB)/4, $0x00000000 +DATA consts<>+0x94(SB)/4, $0x00000001 +DATA consts<>+0x98(SB)/4, $0x00000002 +DATA consts<>+0x9c(SB)/4, $0x00000003 +DATA consts<>+0xa0(SB)/4, $0x11223300 +DATA consts<>+0xa4(SB)/4, $0x55667744 +DATA consts<>+0xa8(SB)/4, $0x99aabb88 +DATA consts<>+0xac(SB)/4, $0xddeeffcc +DATA consts<>+0xb0(SB)/4, $0x22330011 +DATA consts<>+0xb4(SB)/4, $0x66774455 +DATA consts<>+0xb8(SB)/4, $0xaabb8899 +DATA consts<>+0xbc(SB)/4, $0xeeffccdd GLOBL consts<>(SB), RODATA, $0xc0 +#ifdef GOARCH_ppc64 +#define BE_XXBRW_INIT() \ + LVSL (R0)(R0), V24 \ + VSPLTISB $3, V25 \ + VXOR V24, V25, V24 \ + +#define BE_XXBRW(vr) VPERM vr, vr, V24, vr +#else +#define BE_XXBRW_INIT() +#define BE_XXBRW(vr) +#endif + //func chaCha20_ctr32_vsx(out, inp *byte, len int, key *[8]uint32, counter *uint32) TEXT ·chaCha20_ctr32_vsx(SB),NOSPLIT,$64-40 MOVD out+0(FP), OUT @@ -94,6 +130,8 @@ TEXT ·chaCha20_ctr32_vsx(SB),NOSPLIT,$64-40 // Clear V27 VXOR V27, V27, V27 + BE_XXBRW_INIT() + // V28 LXVW4X (CONSTBASE)(R11), VS60 @@ -299,6 +337,11 @@ loop_vsx: VADDUWM V8, V18, V8 VADDUWM V12, V19, V12 + BE_XXBRW(V0) + BE_XXBRW(V4) + BE_XXBRW(V8) + BE_XXBRW(V12) + CMPU LEN, $64 BLT tail_vsx @@ -327,6 +370,11 @@ loop_vsx: VADDUWM V9, V18, V8 VADDUWM V13, V19, V12 + BE_XXBRW(V0) + BE_XXBRW(V4) + BE_XXBRW(V8) + BE_XXBRW(V12) + CMPU LEN, $64 BLT tail_vsx @@ -334,8 +382,8 @@ loop_vsx: LXVW4X (INP)(R8), VS60 LXVW4X (INP)(R9), VS61 LXVW4X (INP)(R10), VS62 - VXOR V27, V0, V27 + VXOR V27, V0, V27 VXOR V28, V4, V28 VXOR V29, V8, V29 VXOR V30, V12, V30 @@ -354,6 +402,11 @@ loop_vsx: VADDUWM V10, V18, V8 VADDUWM V14, V19, V12 + BE_XXBRW(V0) + BE_XXBRW(V4) + BE_XXBRW(V8) + BE_XXBRW(V12) + CMPU LEN, $64 BLT tail_vsx @@ -381,6 +434,11 @@ loop_vsx: VADDUWM V11, V18, V8 VADDUWM V15, V19, V12 + BE_XXBRW(V0) + BE_XXBRW(V4) + BE_XXBRW(V8) + BE_XXBRW(V12) + CMPU LEN, $64 BLT tail_vsx @@ -408,9 +466,9 @@ loop_vsx: done_vsx: // Increment counter by number of 64 byte blocks - MOVD (CNT), R14 + MOVWZ (CNT), R14 ADD BLOCKS, R14 - MOVD R14, (CNT) + MOVWZ R14, (CNT) RET tail_vsx: diff --git a/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go b/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go index 333da285b3..bd896bdc76 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go +++ b/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build (!amd64 && !ppc64le && !s390x) || !gc || purego +//go:build (!amd64 && !ppc64le && !ppc64 && !s390x) || !gc || purego package poly1305 diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.go b/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64x.go similarity index 95% rename from vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.go rename to vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64x.go index 4aec4874b5..1a1679aaad 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.go +++ b/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64x.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build gc && !purego +//go:build gc && !purego && (ppc64 || ppc64le) package poly1305 diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.s b/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64x.s similarity index 89% rename from vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.s rename to vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64x.s index b3c1699bff..6899a1dabc 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.s +++ b/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64x.s @@ -2,15 +2,25 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build gc && !purego +//go:build gc && !purego && (ppc64 || ppc64le) #include "textflag.h" // This was ported from the amd64 implementation. +#ifdef GOARCH_ppc64le +#define LE_MOVD MOVD +#define LE_MOVWZ MOVWZ +#define LE_MOVHZ MOVHZ +#else +#define LE_MOVD MOVDBR +#define LE_MOVWZ MOVWBR +#define LE_MOVHZ MOVHBR +#endif + #define POLY1305_ADD(msg, h0, h1, h2, t0, t1, t2) \ - MOVD (msg), t0; \ - MOVD 8(msg), t1; \ + LE_MOVD (msg)( R0), t0; \ + LE_MOVD (msg)(R24), t1; \ MOVD $1, t2; \ ADDC t0, h0, h0; \ ADDE t1, h1, h1; \ @@ -50,10 +60,6 @@ ADDE t3, h1, h1; \ ADDZE h2 -DATA ·poly1305Mask<>+0x00(SB)/8, $0x0FFFFFFC0FFFFFFF -DATA ·poly1305Mask<>+0x08(SB)/8, $0x0FFFFFFC0FFFFFFC -GLOBL ·poly1305Mask<>(SB), RODATA, $16 - // func update(state *[7]uint64, msg []byte) TEXT ·update(SB), $0-32 MOVD state+0(FP), R3 @@ -66,6 +72,8 @@ TEXT ·update(SB), $0-32 MOVD 24(R3), R11 // r0 MOVD 32(R3), R12 // r1 + MOVD $8, R24 + CMP R5, $16 BLT bytes_between_0_and_15 @@ -94,7 +102,7 @@ flush_buffer: // Greater than 8 -- load the rightmost remaining bytes in msg // and put into R17 (h1) - MOVD (R4)(R21), R17 + LE_MOVD (R4)(R21), R17 MOVD $16, R22 // Find the offset to those bytes @@ -118,7 +126,7 @@ just1: BLT less8 // Exactly 8 - MOVD (R4), R16 + LE_MOVD (R4), R16 CMP R17, $0 @@ -133,7 +141,7 @@ less8: MOVD $0, R22 // shift count CMP R5, $4 BLT less4 - MOVWZ (R4), R16 + LE_MOVWZ (R4), R16 ADD $4, R4 ADD $-4, R5 MOVD $32, R22 @@ -141,7 +149,7 @@ less8: less4: CMP R5, $2 BLT less2 - MOVHZ (R4), R21 + LE_MOVHZ (R4), R21 SLD R22, R21, R21 OR R16, R21, R16 ADD $16, R22 diff --git a/vendor/golang.org/x/crypto/sha3/doc.go b/vendor/golang.org/x/crypto/sha3/doc.go index 7e02309070..bbf391fe6e 100644 --- a/vendor/golang.org/x/crypto/sha3/doc.go +++ b/vendor/golang.org/x/crypto/sha3/doc.go @@ -5,6 +5,10 @@ // Package sha3 implements the SHA-3 fixed-output-length hash functions and // the SHAKE variable-output-length hash functions defined by FIPS-202. // +// All types in this package also implement [encoding.BinaryMarshaler], +// [encoding.BinaryAppender] and [encoding.BinaryUnmarshaler] to marshal and +// unmarshal the internal state of the hash. +// // Both types of hash function use the "sponge" construction and the Keccak // permutation. For a detailed specification see http://keccak.noekeon.org/ // diff --git a/vendor/golang.org/x/crypto/sha3/hashes.go b/vendor/golang.org/x/crypto/sha3/hashes.go index c544b29e5f..31fffbe044 100644 --- a/vendor/golang.org/x/crypto/sha3/hashes.go +++ b/vendor/golang.org/x/crypto/sha3/hashes.go @@ -48,33 +48,52 @@ func init() { crypto.RegisterHash(crypto.SHA3_512, New512) } +const ( + dsbyteSHA3 = 0b00000110 + dsbyteKeccak = 0b00000001 + dsbyteShake = 0b00011111 + dsbyteCShake = 0b00000100 + + // rateK[c] is the rate in bytes for Keccak[c] where c is the capacity in + // bits. Given the sponge size is 1600 bits, the rate is 1600 - c bits. + rateK256 = (1600 - 256) / 8 + rateK448 = (1600 - 448) / 8 + rateK512 = (1600 - 512) / 8 + rateK768 = (1600 - 768) / 8 + rateK1024 = (1600 - 1024) / 8 +) + func new224Generic() *state { - return &state{rate: 144, outputLen: 28, dsbyte: 0x06} + return &state{rate: rateK448, outputLen: 28, dsbyte: dsbyteSHA3} } func new256Generic() *state { - return &state{rate: 136, outputLen: 32, dsbyte: 0x06} + return &state{rate: rateK512, outputLen: 32, dsbyte: dsbyteSHA3} } func new384Generic() *state { - return &state{rate: 104, outputLen: 48, dsbyte: 0x06} + return &state{rate: rateK768, outputLen: 48, dsbyte: dsbyteSHA3} } func new512Generic() *state { - return &state{rate: 72, outputLen: 64, dsbyte: 0x06} + return &state{rate: rateK1024, outputLen: 64, dsbyte: dsbyteSHA3} } // NewLegacyKeccak256 creates a new Keccak-256 hash. // // Only use this function if you require compatibility with an existing cryptosystem // that uses non-standard padding. All other users should use New256 instead. -func NewLegacyKeccak256() hash.Hash { return &state{rate: 136, outputLen: 32, dsbyte: 0x01} } +func NewLegacyKeccak256() hash.Hash { + return &state{rate: rateK512, outputLen: 32, dsbyte: dsbyteKeccak} +} // NewLegacyKeccak512 creates a new Keccak-512 hash. // // Only use this function if you require compatibility with an existing cryptosystem // that uses non-standard padding. All other users should use New512 instead. -func NewLegacyKeccak512() hash.Hash { return &state{rate: 72, outputLen: 64, dsbyte: 0x01} } +func NewLegacyKeccak512() hash.Hash { + return &state{rate: rateK1024, outputLen: 64, dsbyte: dsbyteKeccak} +} // Sum224 returns the SHA3-224 digest of the data. func Sum224(data []byte) (digest [28]byte) { diff --git a/vendor/golang.org/x/crypto/sha3/sha3.go b/vendor/golang.org/x/crypto/sha3/sha3.go index afedde5abf..6658c44479 100644 --- a/vendor/golang.org/x/crypto/sha3/sha3.go +++ b/vendor/golang.org/x/crypto/sha3/sha3.go @@ -4,6 +4,15 @@ package sha3 +import ( + "crypto/subtle" + "encoding/binary" + "errors" + "unsafe" + + "golang.org/x/sys/cpu" +) + // spongeDirection indicates the direction bytes are flowing through the sponge. type spongeDirection int @@ -14,16 +23,13 @@ const ( spongeSqueezing ) -const ( - // maxRate is the maximum size of the internal buffer. SHAKE-256 - // currently needs the largest buffer. - maxRate = 168 -) - type state struct { - // Generic sponge components. - a [25]uint64 // main state of the hash - rate int // the number of bytes of state to use + a [1600 / 8]byte // main state of the hash + + // a[n:rate] is the buffer. If absorbing, it's the remaining space to XOR + // into before running the permutation. If squeezing, it's the remaining + // output to produce before running the permutation. + n, rate int // dsbyte contains the "domain separation" bits and the first bit of // the padding. Sections 6.1 and 6.2 of [1] separate the outputs of the @@ -39,10 +45,6 @@ type state struct { // Extendable-Output Functions (May 2014)" dsbyte byte - i, n int // storage[i:n] is the buffer, i is only used while squeezing - storage [maxRate]byte - - // Specific to SHA-3 and SHAKE. outputLen int // the default output size in bytes state spongeDirection // whether the sponge is absorbing or squeezing } @@ -61,7 +63,7 @@ func (d *state) Reset() { d.a[i] = 0 } d.state = spongeAbsorbing - d.i, d.n = 0, 0 + d.n = 0 } func (d *state) clone() *state { @@ -69,22 +71,25 @@ func (d *state) clone() *state { return &ret } -// permute applies the KeccakF-1600 permutation. It handles -// any input-output buffering. +// permute applies the KeccakF-1600 permutation. func (d *state) permute() { - switch d.state { - case spongeAbsorbing: - // If we're absorbing, we need to xor the input into the state - // before applying the permutation. - xorIn(d, d.storage[:d.rate]) - d.n = 0 - keccakF1600(&d.a) - case spongeSqueezing: - // If we're squeezing, we need to apply the permutation before - // copying more output. - keccakF1600(&d.a) - d.i = 0 - copyOut(d, d.storage[:d.rate]) + var a *[25]uint64 + if cpu.IsBigEndian { + a = new([25]uint64) + for i := range a { + a[i] = binary.LittleEndian.Uint64(d.a[i*8:]) + } + } else { + a = (*[25]uint64)(unsafe.Pointer(&d.a)) + } + + keccakF1600(a) + d.n = 0 + + if cpu.IsBigEndian { + for i := range a { + binary.LittleEndian.PutUint64(d.a[i*8:], a[i]) + } } } @@ -92,53 +97,36 @@ func (d *state) permute() { // the multi-bitrate 10..1 padding rule, and permutes the state. func (d *state) padAndPermute() { // Pad with this instance's domain-separator bits. We know that there's - // at least one byte of space in d.buf because, if it were full, + // at least one byte of space in the sponge because, if it were full, // permute would have been called to empty it. dsbyte also contains the // first one bit for the padding. See the comment in the state struct. - d.storage[d.n] = d.dsbyte - d.n++ - for d.n < d.rate { - d.storage[d.n] = 0 - d.n++ - } + d.a[d.n] ^= d.dsbyte // This adds the final one bit for the padding. Because of the way that // bits are numbered from the LSB upwards, the final bit is the MSB of // the last byte. - d.storage[d.rate-1] ^= 0x80 + d.a[d.rate-1] ^= 0x80 // Apply the permutation d.permute() d.state = spongeSqueezing - d.n = d.rate - copyOut(d, d.storage[:d.rate]) } // Write absorbs more data into the hash's state. It panics if any // output has already been read. -func (d *state) Write(p []byte) (written int, err error) { +func (d *state) Write(p []byte) (n int, err error) { if d.state != spongeAbsorbing { panic("sha3: Write after Read") } - written = len(p) + + n = len(p) for len(p) > 0 { - if d.n == 0 && len(p) >= d.rate { - // The fast path; absorb a full "rate" bytes of input and apply the permutation. - xorIn(d, p[:d.rate]) - p = p[d.rate:] - keccakF1600(&d.a) - } else { - // The slow path; buffer the input until we can fill the sponge, and then xor it in. - todo := d.rate - d.n - if todo > len(p) { - todo = len(p) - } - d.n += copy(d.storage[d.n:], p[:todo]) - p = p[todo:] - - // If the sponge is full, apply the permutation. - if d.n == d.rate { - d.permute() - } + x := subtle.XORBytes(d.a[d.n:d.rate], d.a[d.n:d.rate], p) + d.n += x + p = p[x:] + + // If the sponge is full, apply the permutation. + if d.n == d.rate { + d.permute() } } @@ -156,14 +144,14 @@ func (d *state) Read(out []byte) (n int, err error) { // Now, do the squeezing. for len(out) > 0 { - n := copy(out, d.storage[d.i:d.n]) - d.i += n - out = out[n:] - // Apply the permutation if we've squeezed the sponge dry. - if d.i == d.rate { + if d.n == d.rate { d.permute() } + + x := copy(out, d.a[d.n:d.rate]) + d.n += x + out = out[x:] } return @@ -183,3 +171,74 @@ func (d *state) Sum(in []byte) []byte { dup.Read(hash) return append(in, hash...) } + +const ( + magicSHA3 = "sha\x08" + magicShake = "sha\x09" + magicCShake = "sha\x0a" + magicKeccak = "sha\x0b" + // magic || rate || main state || n || sponge direction + marshaledSize = len(magicSHA3) + 1 + 200 + 1 + 1 +) + +func (d *state) MarshalBinary() ([]byte, error) { + return d.AppendBinary(make([]byte, 0, marshaledSize)) +} + +func (d *state) AppendBinary(b []byte) ([]byte, error) { + switch d.dsbyte { + case dsbyteSHA3: + b = append(b, magicSHA3...) + case dsbyteShake: + b = append(b, magicShake...) + case dsbyteCShake: + b = append(b, magicCShake...) + case dsbyteKeccak: + b = append(b, magicKeccak...) + default: + panic("unknown dsbyte") + } + // rate is at most 168, and n is at most rate. + b = append(b, byte(d.rate)) + b = append(b, d.a[:]...) + b = append(b, byte(d.n), byte(d.state)) + return b, nil +} + +func (d *state) UnmarshalBinary(b []byte) error { + if len(b) != marshaledSize { + return errors.New("sha3: invalid hash state") + } + + magic := string(b[:len(magicSHA3)]) + b = b[len(magicSHA3):] + switch { + case magic == magicSHA3 && d.dsbyte == dsbyteSHA3: + case magic == magicShake && d.dsbyte == dsbyteShake: + case magic == magicCShake && d.dsbyte == dsbyteCShake: + case magic == magicKeccak && d.dsbyte == dsbyteKeccak: + default: + return errors.New("sha3: invalid hash state identifier") + } + + rate := int(b[0]) + b = b[1:] + if rate != d.rate { + return errors.New("sha3: invalid hash state function") + } + + copy(d.a[:], b) + b = b[len(d.a):] + + n, state := int(b[0]), spongeDirection(b[1]) + if n > d.rate { + return errors.New("sha3: invalid hash state") + } + d.n = n + if state != spongeAbsorbing && state != spongeSqueezing { + return errors.New("sha3: invalid hash state") + } + d.state = state + + return nil +} diff --git a/vendor/golang.org/x/crypto/sha3/shake.go b/vendor/golang.org/x/crypto/sha3/shake.go index a01ef43577..a6b3a4281f 100644 --- a/vendor/golang.org/x/crypto/sha3/shake.go +++ b/vendor/golang.org/x/crypto/sha3/shake.go @@ -16,9 +16,12 @@ package sha3 // [2] https://doi.org/10.6028/NIST.SP.800-185 import ( + "bytes" "encoding/binary" + "errors" "hash" "io" + "math/bits" ) // ShakeHash defines the interface to hash functions that support @@ -50,41 +53,33 @@ type cshakeState struct { initBlock []byte } -// Consts for configuring initial SHA-3 state -const ( - dsbyteShake = 0x1f - dsbyteCShake = 0x04 - rate128 = 168 - rate256 = 136 -) +func bytepad(data []byte, rate int) []byte { + out := make([]byte, 0, 9+len(data)+rate-1) + out = append(out, leftEncode(uint64(rate))...) + out = append(out, data...) + if padlen := rate - len(out)%rate; padlen < rate { + out = append(out, make([]byte, padlen)...) + } + return out +} -func bytepad(input []byte, w int) []byte { - // leftEncode always returns max 9 bytes - buf := make([]byte, 0, 9+len(input)+w) - buf = append(buf, leftEncode(uint64(w))...) - buf = append(buf, input...) - padlen := w - (len(buf) % w) - return append(buf, make([]byte, padlen)...) -} - -func leftEncode(value uint64) []byte { - var b [9]byte - binary.BigEndian.PutUint64(b[1:], value) - // Trim all but last leading zero bytes - i := byte(1) - for i < 8 && b[i] == 0 { - i++ +func leftEncode(x uint64) []byte { + // Let n be the smallest positive integer for which 2^(8n) > x. + n := (bits.Len64(x) + 7) / 8 + if n == 0 { + n = 1 } - // Prepend number of encoded bytes - b[i-1] = 9 - i - return b[i-1:] + // Return n || x with n as a byte and x an n bytes in big-endian order. + b := make([]byte, 9) + binary.BigEndian.PutUint64(b[1:], x) + b = b[9-n-1:] + b[0] = byte(n) + return b } func newCShake(N, S []byte, rate, outputLen int, dsbyte byte) ShakeHash { c := cshakeState{state: &state{rate: rate, outputLen: outputLen, dsbyte: dsbyte}} - - // leftEncode returns max 9 bytes - c.initBlock = make([]byte, 0, 9*2+len(N)+len(S)) + c.initBlock = make([]byte, 0, 9+len(N)+9+len(S)) // leftEncode returns max 9 bytes c.initBlock = append(c.initBlock, leftEncode(uint64(len(N))*8)...) c.initBlock = append(c.initBlock, N...) c.initBlock = append(c.initBlock, leftEncode(uint64(len(S))*8)...) @@ -111,6 +106,30 @@ func (c *state) Clone() ShakeHash { return c.clone() } +func (c *cshakeState) MarshalBinary() ([]byte, error) { + return c.AppendBinary(make([]byte, 0, marshaledSize+len(c.initBlock))) +} + +func (c *cshakeState) AppendBinary(b []byte) ([]byte, error) { + b, err := c.state.AppendBinary(b) + if err != nil { + return nil, err + } + b = append(b, c.initBlock...) + return b, nil +} + +func (c *cshakeState) UnmarshalBinary(b []byte) error { + if len(b) <= marshaledSize { + return errors.New("sha3: invalid hash state") + } + if err := c.state.UnmarshalBinary(b[:marshaledSize]); err != nil { + return err + } + c.initBlock = bytes.Clone(b[marshaledSize:]) + return nil +} + // NewShake128 creates a new SHAKE128 variable-output-length ShakeHash. // Its generic security strength is 128 bits against all attacks if at // least 32 bytes of its output are used. @@ -126,11 +145,11 @@ func NewShake256() ShakeHash { } func newShake128Generic() *state { - return &state{rate: rate128, outputLen: 32, dsbyte: dsbyteShake} + return &state{rate: rateK256, outputLen: 32, dsbyte: dsbyteShake} } func newShake256Generic() *state { - return &state{rate: rate256, outputLen: 64, dsbyte: dsbyteShake} + return &state{rate: rateK512, outputLen: 64, dsbyte: dsbyteShake} } // NewCShake128 creates a new instance of cSHAKE128 variable-output-length ShakeHash, @@ -143,7 +162,7 @@ func NewCShake128(N, S []byte) ShakeHash { if len(N) == 0 && len(S) == 0 { return NewShake128() } - return newCShake(N, S, rate128, 32, dsbyteCShake) + return newCShake(N, S, rateK256, 32, dsbyteCShake) } // NewCShake256 creates a new instance of cSHAKE256 variable-output-length ShakeHash, @@ -156,7 +175,7 @@ func NewCShake256(N, S []byte) ShakeHash { if len(N) == 0 && len(S) == 0 { return NewShake256() } - return newCShake(N, S, rate256, 64, dsbyteCShake) + return newCShake(N, S, rateK512, 64, dsbyteCShake) } // ShakeSum128 writes an arbitrary-length digest of data into hash. diff --git a/vendor/golang.org/x/crypto/sha3/xor.go b/vendor/golang.org/x/crypto/sha3/xor.go deleted file mode 100644 index 6ada5c9574..0000000000 --- a/vendor/golang.org/x/crypto/sha3/xor.go +++ /dev/null @@ -1,40 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package sha3 - -import ( - "crypto/subtle" - "encoding/binary" - "unsafe" - - "golang.org/x/sys/cpu" -) - -// xorIn xors the bytes in buf into the state. -func xorIn(d *state, buf []byte) { - if cpu.IsBigEndian { - for i := 0; len(buf) >= 8; i++ { - a := binary.LittleEndian.Uint64(buf) - d.a[i] ^= a - buf = buf[8:] - } - } else { - ab := (*[25 * 64 / 8]byte)(unsafe.Pointer(&d.a)) - subtle.XORBytes(ab[:], ab[:], buf) - } -} - -// copyOut copies uint64s to a byte buffer. -func copyOut(d *state, b []byte) { - if cpu.IsBigEndian { - for i := 0; len(b) >= 8; i++ { - binary.LittleEndian.PutUint64(b, d.a[i]) - b = b[8:] - } - } else { - ab := (*[25 * 64 / 8]byte)(unsafe.Pointer(&d.a)) - copy(b, ab[:]) - } -} diff --git a/vendor/golang.org/x/exp/constraints/constraints.go b/vendor/golang.org/x/exp/constraints/constraints.go deleted file mode 100644 index 2c033dff47..0000000000 --- a/vendor/golang.org/x/exp/constraints/constraints.go +++ /dev/null @@ -1,50 +0,0 @@ -// Copyright 2021 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package constraints defines a set of useful constraints to be used -// with type parameters. -package constraints - -// Signed is a constraint that permits any signed integer type. -// If future releases of Go add new predeclared signed integer types, -// this constraint will be modified to include them. -type Signed interface { - ~int | ~int8 | ~int16 | ~int32 | ~int64 -} - -// Unsigned is a constraint that permits any unsigned integer type. -// If future releases of Go add new predeclared unsigned integer types, -// this constraint will be modified to include them. -type Unsigned interface { - ~uint | ~uint8 | ~uint16 | ~uint32 | ~uint64 | ~uintptr -} - -// Integer is a constraint that permits any integer type. -// If future releases of Go add new predeclared integer types, -// this constraint will be modified to include them. -type Integer interface { - Signed | Unsigned -} - -// Float is a constraint that permits any floating-point type. -// If future releases of Go add new predeclared floating-point types, -// this constraint will be modified to include them. -type Float interface { - ~float32 | ~float64 -} - -// Complex is a constraint that permits any complex numeric type. -// If future releases of Go add new predeclared complex numeric types, -// this constraint will be modified to include them. -type Complex interface { - ~complex64 | ~complex128 -} - -// Ordered is a constraint that permits any ordered type: any type -// that supports the operators < <= >= >. -// If future releases of Go add new ordered types, -// this constraint will be modified to include them. -type Ordered interface { - Integer | Float | ~string -} diff --git a/vendor/golang.org/x/exp/slices/cmp.go b/vendor/golang.org/x/exp/slices/cmp.go deleted file mode 100644 index fbf1934a06..0000000000 --- a/vendor/golang.org/x/exp/slices/cmp.go +++ /dev/null @@ -1,44 +0,0 @@ -// Copyright 2023 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package slices - -import "golang.org/x/exp/constraints" - -// min is a version of the predeclared function from the Go 1.21 release. -func min[T constraints.Ordered](a, b T) T { - if a < b || isNaN(a) { - return a - } - return b -} - -// max is a version of the predeclared function from the Go 1.21 release. -func max[T constraints.Ordered](a, b T) T { - if a > b || isNaN(a) { - return a - } - return b -} - -// cmpLess is a copy of cmp.Less from the Go 1.21 release. -func cmpLess[T constraints.Ordered](x, y T) bool { - return (isNaN(x) && !isNaN(y)) || x < y -} - -// cmpCompare is a copy of cmp.Compare from the Go 1.21 release. -func cmpCompare[T constraints.Ordered](x, y T) int { - xNaN := isNaN(x) - yNaN := isNaN(y) - if xNaN && yNaN { - return 0 - } - if xNaN || x < y { - return -1 - } - if yNaN || x > y { - return +1 - } - return 0 -} diff --git a/vendor/golang.org/x/exp/slices/slices.go b/vendor/golang.org/x/exp/slices/slices.go index 46ceac3439..757383ea1c 100644 --- a/vendor/golang.org/x/exp/slices/slices.go +++ b/vendor/golang.org/x/exp/slices/slices.go @@ -6,26 +6,22 @@ package slices import ( - "unsafe" - - "golang.org/x/exp/constraints" + "cmp" + "slices" ) +// TODO(adonovan): when https://go.dev/issue/32816 is accepted, all of +// these functions should be annotated (provisionally with "//go:fix +// inline") so that tools can safely and automatically replace calls +// to exp/slices with calls to std slices by inlining them. + // Equal reports whether two slices are equal: the same length and all // elements equal. If the lengths are different, Equal returns false. // Otherwise, the elements are compared in increasing index order, and the // comparison stops at the first unequal pair. // Floating point NaNs are not considered equal. func Equal[S ~[]E, E comparable](s1, s2 S) bool { - if len(s1) != len(s2) { - return false - } - for i := range s1 { - if s1[i] != s2[i] { - return false - } - } - return true + return slices.Equal(s1, s2) } // EqualFunc reports whether two slices are equal using an equality @@ -34,16 +30,7 @@ func Equal[S ~[]E, E comparable](s1, s2 S) bool { // increasing index order, and the comparison stops at the first index // for which eq returns false. func EqualFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, eq func(E1, E2) bool) bool { - if len(s1) != len(s2) { - return false - } - for i, v1 := range s1 { - v2 := s2[i] - if !eq(v1, v2) { - return false - } - } - return true + return slices.EqualFunc(s1, s2, eq) } // Compare compares the elements of s1 and s2, using [cmp.Compare] on each pair @@ -53,20 +40,8 @@ func EqualFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, eq func(E1, E2) boo // If both slices are equal until one of them ends, the shorter slice is // considered less than the longer one. // The result is 0 if s1 == s2, -1 if s1 < s2, and +1 if s1 > s2. -func Compare[S ~[]E, E constraints.Ordered](s1, s2 S) int { - for i, v1 := range s1 { - if i >= len(s2) { - return +1 - } - v2 := s2[i] - if c := cmpCompare(v1, v2); c != 0 { - return c - } - } - if len(s1) < len(s2) { - return -1 - } - return 0 +func Compare[S ~[]E, E cmp.Ordered](s1, s2 S) int { + return slices.Compare(s1, s2) } // CompareFunc is like [Compare] but uses a custom comparison function on each @@ -75,52 +50,30 @@ func Compare[S ~[]E, E constraints.Ordered](s1, s2 S) int { // returns 0 the result is 0 if len(s1) == len(s2), -1 if len(s1) < len(s2), // and +1 if len(s1) > len(s2). func CompareFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, cmp func(E1, E2) int) int { - for i, v1 := range s1 { - if i >= len(s2) { - return +1 - } - v2 := s2[i] - if c := cmp(v1, v2); c != 0 { - return c - } - } - if len(s1) < len(s2) { - return -1 - } - return 0 + return slices.CompareFunc(s1, s2, cmp) } // Index returns the index of the first occurrence of v in s, // or -1 if not present. func Index[S ~[]E, E comparable](s S, v E) int { - for i := range s { - if v == s[i] { - return i - } - } - return -1 + return slices.Index(s, v) } // IndexFunc returns the first index i satisfying f(s[i]), // or -1 if none do. func IndexFunc[S ~[]E, E any](s S, f func(E) bool) int { - for i := range s { - if f(s[i]) { - return i - } - } - return -1 + return slices.IndexFunc(s, f) } // Contains reports whether v is present in s. func Contains[S ~[]E, E comparable](s S, v E) bool { - return Index(s, v) >= 0 + return slices.Contains(s, v) } // ContainsFunc reports whether at least one // element e of s satisfies f(e). func ContainsFunc[S ~[]E, E any](s S, f func(E) bool) bool { - return IndexFunc(s, f) >= 0 + return slices.ContainsFunc(s, f) } // Insert inserts the values v... into s at index i, @@ -131,92 +84,7 @@ func ContainsFunc[S ~[]E, E any](s S, f func(E) bool) bool { // Insert panics if i is out of range. // This function is O(len(s) + len(v)). func Insert[S ~[]E, E any](s S, i int, v ...E) S { - m := len(v) - if m == 0 { - return s - } - n := len(s) - if i == n { - return append(s, v...) - } - if n+m > cap(s) { - // Use append rather than make so that we bump the size of - // the slice up to the next storage class. - // This is what Grow does but we don't call Grow because - // that might copy the values twice. - s2 := append(s[:i], make(S, n+m-i)...) - copy(s2[i:], v) - copy(s2[i+m:], s[i:]) - return s2 - } - s = s[:n+m] - - // before: - // s: aaaaaaaabbbbccccccccdddd - // ^ ^ ^ ^ - // i i+m n n+m - // after: - // s: aaaaaaaavvvvbbbbcccccccc - // ^ ^ ^ ^ - // i i+m n n+m - // - // a are the values that don't move in s. - // v are the values copied in from v. - // b and c are the values from s that are shifted up in index. - // d are the values that get overwritten, never to be seen again. - - if !overlaps(v, s[i+m:]) { - // Easy case - v does not overlap either the c or d regions. - // (It might be in some of a or b, or elsewhere entirely.) - // The data we copy up doesn't write to v at all, so just do it. - - copy(s[i+m:], s[i:]) - - // Now we have - // s: aaaaaaaabbbbbbbbcccccccc - // ^ ^ ^ ^ - // i i+m n n+m - // Note the b values are duplicated. - - copy(s[i:], v) - - // Now we have - // s: aaaaaaaavvvvbbbbcccccccc - // ^ ^ ^ ^ - // i i+m n n+m - // That's the result we want. - return s - } - - // The hard case - v overlaps c or d. We can't just shift up - // the data because we'd move or clobber the values we're trying - // to insert. - // So instead, write v on top of d, then rotate. - copy(s[n:], v) - - // Now we have - // s: aaaaaaaabbbbccccccccvvvv - // ^ ^ ^ ^ - // i i+m n n+m - - rotateRight(s[i:], m) - - // Now we have - // s: aaaaaaaavvvvbbbbcccccccc - // ^ ^ ^ ^ - // i i+m n n+m - // That's the result we want. - return s -} - -// clearSlice sets all elements up to the length of s to the zero value of E. -// We may use the builtin clear func instead, and remove clearSlice, when upgrading -// to Go 1.21+. -func clearSlice[S ~[]E, E any](s S) { - var zero E - for i := range s { - s[i] = zero - } + return slices.Insert(s, i, v...) } // Delete removes the elements s[i:j] from s, returning the modified slice. @@ -225,135 +93,27 @@ func clearSlice[S ~[]E, E any](s S) { // make a single call deleting them all together than to delete one at a time. // Delete zeroes the elements s[len(s)-(j-i):len(s)]. func Delete[S ~[]E, E any](s S, i, j int) S { - _ = s[i:j:len(s)] // bounds check - - if i == j { - return s - } - - oldlen := len(s) - s = append(s[:i], s[j:]...) - clearSlice(s[len(s):oldlen]) // zero/nil out the obsolete elements, for GC - return s + return slices.Delete(s, i, j) } // DeleteFunc removes any elements from s for which del returns true, // returning the modified slice. // DeleteFunc zeroes the elements between the new length and the original length. func DeleteFunc[S ~[]E, E any](s S, del func(E) bool) S { - i := IndexFunc(s, del) - if i == -1 { - return s - } - // Don't start copying elements until we find one to delete. - for j := i + 1; j < len(s); j++ { - if v := s[j]; !del(v) { - s[i] = v - i++ - } - } - clearSlice(s[i:]) // zero/nil out the obsolete elements, for GC - return s[:i] + return slices.DeleteFunc(s, del) } // Replace replaces the elements s[i:j] by the given v, and returns the // modified slice. Replace panics if s[i:j] is not a valid slice of s. // When len(v) < (j-i), Replace zeroes the elements between the new length and the original length. func Replace[S ~[]E, E any](s S, i, j int, v ...E) S { - _ = s[i:j] // verify that i:j is a valid subslice - - if i == j { - return Insert(s, i, v...) - } - if j == len(s) { - return append(s[:i], v...) - } - - tot := len(s[:i]) + len(v) + len(s[j:]) - if tot > cap(s) { - // Too big to fit, allocate and copy over. - s2 := append(s[:i], make(S, tot-i)...) // See Insert - copy(s2[i:], v) - copy(s2[i+len(v):], s[j:]) - return s2 - } - - r := s[:tot] - - if i+len(v) <= j { - // Easy, as v fits in the deleted portion. - copy(r[i:], v) - if i+len(v) != j { - copy(r[i+len(v):], s[j:]) - } - clearSlice(s[tot:]) // zero/nil out the obsolete elements, for GC - return r - } - - // We are expanding (v is bigger than j-i). - // The situation is something like this: - // (example has i=4,j=8,len(s)=16,len(v)=6) - // s: aaaaxxxxbbbbbbbbyy - // ^ ^ ^ ^ - // i j len(s) tot - // a: prefix of s - // x: deleted range - // b: more of s - // y: area to expand into - - if !overlaps(r[i+len(v):], v) { - // Easy, as v is not clobbered by the first copy. - copy(r[i+len(v):], s[j:]) - copy(r[i:], v) - return r - } - - // This is a situation where we don't have a single place to which - // we can copy v. Parts of it need to go to two different places. - // We want to copy the prefix of v into y and the suffix into x, then - // rotate |y| spots to the right. - // - // v[2:] v[:2] - // | | - // s: aaaavvvvbbbbbbbbvv - // ^ ^ ^ ^ - // i j len(s) tot - // - // If either of those two destinations don't alias v, then we're good. - y := len(v) - (j - i) // length of y portion - - if !overlaps(r[i:j], v) { - copy(r[i:j], v[y:]) - copy(r[len(s):], v[:y]) - rotateRight(r[i:], y) - return r - } - if !overlaps(r[len(s):], v) { - copy(r[len(s):], v[:y]) - copy(r[i:j], v[y:]) - rotateRight(r[i:], y) - return r - } - - // Now we know that v overlaps both x and y. - // That means that the entirety of b is *inside* v. - // So we don't need to preserve b at all; instead we - // can copy v first, then copy the b part of v out of - // v to the right destination. - k := startIdx(v, s[j:]) - copy(r[i:], v) - copy(r[i+len(v):], r[i+k:]) - return r + return slices.Replace(s, i, j, v...) } // Clone returns a copy of the slice. // The elements are copied using assignment, so this is a shallow clone. func Clone[S ~[]E, E any](s S) S { - // Preserve nil in case it matters. - if s == nil { - return nil - } - return append(S([]E{}), s...) + return slices.Clone(s) } // Compact replaces consecutive runs of equal elements with a single copy. @@ -362,40 +122,14 @@ func Clone[S ~[]E, E any](s S) S { // which may have a smaller length. // Compact zeroes the elements between the new length and the original length. func Compact[S ~[]E, E comparable](s S) S { - if len(s) < 2 { - return s - } - i := 1 - for k := 1; k < len(s); k++ { - if s[k] != s[k-1] { - if i != k { - s[i] = s[k] - } - i++ - } - } - clearSlice(s[i:]) // zero/nil out the obsolete elements, for GC - return s[:i] + return slices.Compact(s) } // CompactFunc is like [Compact] but uses an equality function to compare elements. // For runs of elements that compare equal, CompactFunc keeps the first one. // CompactFunc zeroes the elements between the new length and the original length. func CompactFunc[S ~[]E, E any](s S, eq func(E, E) bool) S { - if len(s) < 2 { - return s - } - i := 1 - for k := 1; k < len(s); k++ { - if !eq(s[k], s[k-1]) { - if i != k { - s[i] = s[k] - } - i++ - } - } - clearSlice(s[i:]) // zero/nil out the obsolete elements, for GC - return s[:i] + return slices.CompactFunc(s, eq) } // Grow increases the slice's capacity, if necessary, to guarantee space for @@ -403,113 +137,15 @@ func CompactFunc[S ~[]E, E any](s S, eq func(E, E) bool) S { // to the slice without another allocation. If n is negative or too large to // allocate the memory, Grow panics. func Grow[S ~[]E, E any](s S, n int) S { - if n < 0 { - panic("cannot be negative") - } - if n -= cap(s) - len(s); n > 0 { - // TODO(https://go.dev/issue/53888): Make using []E instead of S - // to workaround a compiler bug where the runtime.growslice optimization - // does not take effect. Revert when the compiler is fixed. - s = append([]E(s)[:cap(s)], make([]E, n)...)[:len(s)] - } - return s + return slices.Grow(s, n) } // Clip removes unused capacity from the slice, returning s[:len(s):len(s)]. func Clip[S ~[]E, E any](s S) S { - return s[:len(s):len(s)] -} - -// Rotation algorithm explanation: -// -// rotate left by 2 -// start with -// 0123456789 -// split up like this -// 01 234567 89 -// swap first 2 and last 2 -// 89 234567 01 -// join first parts -// 89234567 01 -// recursively rotate first left part by 2 -// 23456789 01 -// join at the end -// 2345678901 -// -// rotate left by 8 -// start with -// 0123456789 -// split up like this -// 01 234567 89 -// swap first 2 and last 2 -// 89 234567 01 -// join last parts -// 89 23456701 -// recursively rotate second part left by 6 -// 89 01234567 -// join at the end -// 8901234567 - -// TODO: There are other rotate algorithms. -// This algorithm has the desirable property that it moves each element exactly twice. -// The triple-reverse algorithm is simpler and more cache friendly, but takes more writes. -// The follow-cycles algorithm can be 1-write but it is not very cache friendly. - -// rotateLeft rotates b left by n spaces. -// s_final[i] = s_orig[i+r], wrapping around. -func rotateLeft[E any](s []E, r int) { - for r != 0 && r != len(s) { - if r*2 <= len(s) { - swap(s[:r], s[len(s)-r:]) - s = s[:len(s)-r] - } else { - swap(s[:len(s)-r], s[r:]) - s, r = s[len(s)-r:], r*2-len(s) - } - } -} -func rotateRight[E any](s []E, r int) { - rotateLeft(s, len(s)-r) -} - -// swap swaps the contents of x and y. x and y must be equal length and disjoint. -func swap[E any](x, y []E) { - for i := 0; i < len(x); i++ { - x[i], y[i] = y[i], x[i] - } -} - -// overlaps reports whether the memory ranges a[0:len(a)] and b[0:len(b)] overlap. -func overlaps[E any](a, b []E) bool { - if len(a) == 0 || len(b) == 0 { - return false - } - elemSize := unsafe.Sizeof(a[0]) - if elemSize == 0 { - return false - } - // TODO: use a runtime/unsafe facility once one becomes available. See issue 12445. - // Also see crypto/internal/alias/alias.go:AnyOverlap - return uintptr(unsafe.Pointer(&a[0])) <= uintptr(unsafe.Pointer(&b[len(b)-1]))+(elemSize-1) && - uintptr(unsafe.Pointer(&b[0])) <= uintptr(unsafe.Pointer(&a[len(a)-1]))+(elemSize-1) -} - -// startIdx returns the index in haystack where the needle starts. -// prerequisite: the needle must be aliased entirely inside the haystack. -func startIdx[E any](haystack, needle []E) int { - p := &needle[0] - for i := range haystack { - if p == &haystack[i] { - return i - } - } - // TODO: what if the overlap is by a non-integral number of Es? - panic("needle not found") + return slices.Clip(s) } // Reverse reverses the elements of the slice in place. func Reverse[S ~[]E, E any](s S) { - for i, j := 0, len(s)-1; i < j; i, j = i+1, j-1 { - s[i], s[j] = s[j], s[i] - } + slices.Reverse(s) } diff --git a/vendor/golang.org/x/exp/slices/sort.go b/vendor/golang.org/x/exp/slices/sort.go index f58bbc7ba4..e270a74652 100644 --- a/vendor/golang.org/x/exp/slices/sort.go +++ b/vendor/golang.org/x/exp/slices/sort.go @@ -2,21 +2,20 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:generate go run $GOROOT/src/sort/gen_sort_variants.go -exp - package slices import ( - "math/bits" - - "golang.org/x/exp/constraints" + "cmp" + "slices" ) +// TODO(adonovan): add a "//go:fix inline" annotation to each function +// in this file; see https://go.dev/issue/32816. + // Sort sorts a slice of any ordered type in ascending order. // When sorting floating-point numbers, NaNs are ordered before other values. -func Sort[S ~[]E, E constraints.Ordered](x S) { - n := len(x) - pdqsortOrdered(x, 0, n, bits.Len(uint(n))) +func Sort[S ~[]E, E cmp.Ordered](x S) { + slices.Sort(x) } // SortFunc sorts the slice x in ascending order as determined by the cmp @@ -29,118 +28,60 @@ func Sort[S ~[]E, E constraints.Ordered](x S) { // See https://en.wikipedia.org/wiki/Weak_ordering#Strict_weak_orderings. // To indicate 'uncomparable', return 0 from the function. func SortFunc[S ~[]E, E any](x S, cmp func(a, b E) int) { - n := len(x) - pdqsortCmpFunc(x, 0, n, bits.Len(uint(n)), cmp) + slices.SortFunc(x, cmp) } // SortStableFunc sorts the slice x while keeping the original order of equal // elements, using cmp to compare elements in the same way as [SortFunc]. func SortStableFunc[S ~[]E, E any](x S, cmp func(a, b E) int) { - stableCmpFunc(x, len(x), cmp) + slices.SortStableFunc(x, cmp) } // IsSorted reports whether x is sorted in ascending order. -func IsSorted[S ~[]E, E constraints.Ordered](x S) bool { - for i := len(x) - 1; i > 0; i-- { - if cmpLess(x[i], x[i-1]) { - return false - } - } - return true +func IsSorted[S ~[]E, E cmp.Ordered](x S) bool { + return slices.IsSorted(x) } // IsSortedFunc reports whether x is sorted in ascending order, with cmp as the // comparison function as defined by [SortFunc]. func IsSortedFunc[S ~[]E, E any](x S, cmp func(a, b E) int) bool { - for i := len(x) - 1; i > 0; i-- { - if cmp(x[i], x[i-1]) < 0 { - return false - } - } - return true + return slices.IsSortedFunc(x, cmp) } // Min returns the minimal value in x. It panics if x is empty. // For floating-point numbers, Min propagates NaNs (any NaN value in x // forces the output to be NaN). -func Min[S ~[]E, E constraints.Ordered](x S) E { - if len(x) < 1 { - panic("slices.Min: empty list") - } - m := x[0] - for i := 1; i < len(x); i++ { - m = min(m, x[i]) - } - return m +func Min[S ~[]E, E cmp.Ordered](x S) E { + return slices.Min(x) } // MinFunc returns the minimal value in x, using cmp to compare elements. // It panics if x is empty. If there is more than one minimal element // according to the cmp function, MinFunc returns the first one. func MinFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { - if len(x) < 1 { - panic("slices.MinFunc: empty list") - } - m := x[0] - for i := 1; i < len(x); i++ { - if cmp(x[i], m) < 0 { - m = x[i] - } - } - return m + return slices.MinFunc(x, cmp) } // Max returns the maximal value in x. It panics if x is empty. // For floating-point E, Max propagates NaNs (any NaN value in x // forces the output to be NaN). -func Max[S ~[]E, E constraints.Ordered](x S) E { - if len(x) < 1 { - panic("slices.Max: empty list") - } - m := x[0] - for i := 1; i < len(x); i++ { - m = max(m, x[i]) - } - return m +func Max[S ~[]E, E cmp.Ordered](x S) E { + return slices.Max(x) } // MaxFunc returns the maximal value in x, using cmp to compare elements. // It panics if x is empty. If there is more than one maximal element // according to the cmp function, MaxFunc returns the first one. func MaxFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { - if len(x) < 1 { - panic("slices.MaxFunc: empty list") - } - m := x[0] - for i := 1; i < len(x); i++ { - if cmp(x[i], m) > 0 { - m = x[i] - } - } - return m + return slices.MaxFunc(x, cmp) } // BinarySearch searches for target in a sorted slice and returns the position // where target is found, or the position where target would appear in the // sort order; it also returns a bool saying whether the target is really found // in the slice. The slice must be sorted in increasing order. -func BinarySearch[S ~[]E, E constraints.Ordered](x S, target E) (int, bool) { - // Inlining is faster than calling BinarySearchFunc with a lambda. - n := len(x) - // Define x[-1] < target and x[n] >= target. - // Invariant: x[i-1] < target, x[j] >= target. - i, j := 0, n - for i < j { - h := int(uint(i+j) >> 1) // avoid overflow when computing h - // i ≤ h < j - if cmpLess(x[h], target) { - i = h + 1 // preserves x[i-1] < target - } else { - j = h // preserves x[j] >= target - } - } - // i == j, x[i-1] < target, and x[j] (= x[i]) >= target => answer is i. - return i, i < n && (x[i] == target || (isNaN(x[i]) && isNaN(target))) +func BinarySearch[S ~[]E, E cmp.Ordered](x S, target E) (int, bool) { + return slices.BinarySearch(x, target) } // BinarySearchFunc works like [BinarySearch], but uses a custom comparison @@ -151,47 +92,5 @@ func BinarySearch[S ~[]E, E constraints.Ordered](x S, target E) (int, bool) { // cmp must implement the same ordering as the slice, such that if // cmp(a, t) < 0 and cmp(b, t) >= 0, then a must precede b in the slice. func BinarySearchFunc[S ~[]E, E, T any](x S, target T, cmp func(E, T) int) (int, bool) { - n := len(x) - // Define cmp(x[-1], target) < 0 and cmp(x[n], target) >= 0 . - // Invariant: cmp(x[i - 1], target) < 0, cmp(x[j], target) >= 0. - i, j := 0, n - for i < j { - h := int(uint(i+j) >> 1) // avoid overflow when computing h - // i ≤ h < j - if cmp(x[h], target) < 0 { - i = h + 1 // preserves cmp(x[i - 1], target) < 0 - } else { - j = h // preserves cmp(x[j], target) >= 0 - } - } - // i == j, cmp(x[i-1], target) < 0, and cmp(x[j], target) (= cmp(x[i], target)) >= 0 => answer is i. - return i, i < n && cmp(x[i], target) == 0 -} - -type sortedHint int // hint for pdqsort when choosing the pivot - -const ( - unknownHint sortedHint = iota - increasingHint - decreasingHint -) - -// xorshift paper: https://www.jstatsoft.org/article/view/v008i14/xorshift.pdf -type xorshift uint64 - -func (r *xorshift) Next() uint64 { - *r ^= *r << 13 - *r ^= *r >> 17 - *r ^= *r << 5 - return uint64(*r) -} - -func nextPowerOfTwo(length int) uint { - return 1 << bits.Len(uint(length)) -} - -// isNaN reports whether x is a NaN without requiring the math package. -// This will always return false if T is not floating-point. -func isNaN[T constraints.Ordered](x T) bool { - return x != x + return slices.BinarySearchFunc(x, target, cmp) } diff --git a/vendor/golang.org/x/exp/slices/zsortanyfunc.go b/vendor/golang.org/x/exp/slices/zsortanyfunc.go deleted file mode 100644 index 06f2c7a248..0000000000 --- a/vendor/golang.org/x/exp/slices/zsortanyfunc.go +++ /dev/null @@ -1,479 +0,0 @@ -// Code generated by gen_sort_variants.go; DO NOT EDIT. - -// Copyright 2022 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package slices - -// insertionSortCmpFunc sorts data[a:b] using insertion sort. -func insertionSortCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) { - for i := a + 1; i < b; i++ { - for j := i; j > a && (cmp(data[j], data[j-1]) < 0); j-- { - data[j], data[j-1] = data[j-1], data[j] - } - } -} - -// siftDownCmpFunc implements the heap property on data[lo:hi]. -// first is an offset into the array where the root of the heap lies. -func siftDownCmpFunc[E any](data []E, lo, hi, first int, cmp func(a, b E) int) { - root := lo - for { - child := 2*root + 1 - if child >= hi { - break - } - if child+1 < hi && (cmp(data[first+child], data[first+child+1]) < 0) { - child++ - } - if !(cmp(data[first+root], data[first+child]) < 0) { - return - } - data[first+root], data[first+child] = data[first+child], data[first+root] - root = child - } -} - -func heapSortCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) { - first := a - lo := 0 - hi := b - a - - // Build heap with greatest element at top. - for i := (hi - 1) / 2; i >= 0; i-- { - siftDownCmpFunc(data, i, hi, first, cmp) - } - - // Pop elements, largest first, into end of data. - for i := hi - 1; i >= 0; i-- { - data[first], data[first+i] = data[first+i], data[first] - siftDownCmpFunc(data, lo, i, first, cmp) - } -} - -// pdqsortCmpFunc sorts data[a:b]. -// The algorithm based on pattern-defeating quicksort(pdqsort), but without the optimizations from BlockQuicksort. -// pdqsort paper: https://arxiv.org/pdf/2106.05123.pdf -// C++ implementation: https://github.com/orlp/pdqsort -// Rust implementation: https://docs.rs/pdqsort/latest/pdqsort/ -// limit is the number of allowed bad (very unbalanced) pivots before falling back to heapsort. -func pdqsortCmpFunc[E any](data []E, a, b, limit int, cmp func(a, b E) int) { - const maxInsertion = 12 - - var ( - wasBalanced = true // whether the last partitioning was reasonably balanced - wasPartitioned = true // whether the slice was already partitioned - ) - - for { - length := b - a - - if length <= maxInsertion { - insertionSortCmpFunc(data, a, b, cmp) - return - } - - // Fall back to heapsort if too many bad choices were made. - if limit == 0 { - heapSortCmpFunc(data, a, b, cmp) - return - } - - // If the last partitioning was imbalanced, we need to breaking patterns. - if !wasBalanced { - breakPatternsCmpFunc(data, a, b, cmp) - limit-- - } - - pivot, hint := choosePivotCmpFunc(data, a, b, cmp) - if hint == decreasingHint { - reverseRangeCmpFunc(data, a, b, cmp) - // The chosen pivot was pivot-a elements after the start of the array. - // After reversing it is pivot-a elements before the end of the array. - // The idea came from Rust's implementation. - pivot = (b - 1) - (pivot - a) - hint = increasingHint - } - - // The slice is likely already sorted. - if wasBalanced && wasPartitioned && hint == increasingHint { - if partialInsertionSortCmpFunc(data, a, b, cmp) { - return - } - } - - // Probably the slice contains many duplicate elements, partition the slice into - // elements equal to and elements greater than the pivot. - if a > 0 && !(cmp(data[a-1], data[pivot]) < 0) { - mid := partitionEqualCmpFunc(data, a, b, pivot, cmp) - a = mid - continue - } - - mid, alreadyPartitioned := partitionCmpFunc(data, a, b, pivot, cmp) - wasPartitioned = alreadyPartitioned - - leftLen, rightLen := mid-a, b-mid - balanceThreshold := length / 8 - if leftLen < rightLen { - wasBalanced = leftLen >= balanceThreshold - pdqsortCmpFunc(data, a, mid, limit, cmp) - a = mid + 1 - } else { - wasBalanced = rightLen >= balanceThreshold - pdqsortCmpFunc(data, mid+1, b, limit, cmp) - b = mid - } - } -} - -// partitionCmpFunc does one quicksort partition. -// Let p = data[pivot] -// Moves elements in data[a:b] around, so that data[i]

=p for inewpivot. -// On return, data[newpivot] = p -func partitionCmpFunc[E any](data []E, a, b, pivot int, cmp func(a, b E) int) (newpivot int, alreadyPartitioned bool) { - data[a], data[pivot] = data[pivot], data[a] - i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned - - for i <= j && (cmp(data[i], data[a]) < 0) { - i++ - } - for i <= j && !(cmp(data[j], data[a]) < 0) { - j-- - } - if i > j { - data[j], data[a] = data[a], data[j] - return j, true - } - data[i], data[j] = data[j], data[i] - i++ - j-- - - for { - for i <= j && (cmp(data[i], data[a]) < 0) { - i++ - } - for i <= j && !(cmp(data[j], data[a]) < 0) { - j-- - } - if i > j { - break - } - data[i], data[j] = data[j], data[i] - i++ - j-- - } - data[j], data[a] = data[a], data[j] - return j, false -} - -// partitionEqualCmpFunc partitions data[a:b] into elements equal to data[pivot] followed by elements greater than data[pivot]. -// It assumed that data[a:b] does not contain elements smaller than the data[pivot]. -func partitionEqualCmpFunc[E any](data []E, a, b, pivot int, cmp func(a, b E) int) (newpivot int) { - data[a], data[pivot] = data[pivot], data[a] - i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned - - for { - for i <= j && !(cmp(data[a], data[i]) < 0) { - i++ - } - for i <= j && (cmp(data[a], data[j]) < 0) { - j-- - } - if i > j { - break - } - data[i], data[j] = data[j], data[i] - i++ - j-- - } - return i -} - -// partialInsertionSortCmpFunc partially sorts a slice, returns true if the slice is sorted at the end. -func partialInsertionSortCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) bool { - const ( - maxSteps = 5 // maximum number of adjacent out-of-order pairs that will get shifted - shortestShifting = 50 // don't shift any elements on short arrays - ) - i := a + 1 - for j := 0; j < maxSteps; j++ { - for i < b && !(cmp(data[i], data[i-1]) < 0) { - i++ - } - - if i == b { - return true - } - - if b-a < shortestShifting { - return false - } - - data[i], data[i-1] = data[i-1], data[i] - - // Shift the smaller one to the left. - if i-a >= 2 { - for j := i - 1; j >= 1; j-- { - if !(cmp(data[j], data[j-1]) < 0) { - break - } - data[j], data[j-1] = data[j-1], data[j] - } - } - // Shift the greater one to the right. - if b-i >= 2 { - for j := i + 1; j < b; j++ { - if !(cmp(data[j], data[j-1]) < 0) { - break - } - data[j], data[j-1] = data[j-1], data[j] - } - } - } - return false -} - -// breakPatternsCmpFunc scatters some elements around in an attempt to break some patterns -// that might cause imbalanced partitions in quicksort. -func breakPatternsCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) { - length := b - a - if length >= 8 { - random := xorshift(length) - modulus := nextPowerOfTwo(length) - - for idx := a + (length/4)*2 - 1; idx <= a+(length/4)*2+1; idx++ { - other := int(uint(random.Next()) & (modulus - 1)) - if other >= length { - other -= length - } - data[idx], data[a+other] = data[a+other], data[idx] - } - } -} - -// choosePivotCmpFunc chooses a pivot in data[a:b]. -// -// [0,8): chooses a static pivot. -// [8,shortestNinther): uses the simple median-of-three method. -// [shortestNinther,∞): uses the Tukey ninther method. -func choosePivotCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) (pivot int, hint sortedHint) { - const ( - shortestNinther = 50 - maxSwaps = 4 * 3 - ) - - l := b - a - - var ( - swaps int - i = a + l/4*1 - j = a + l/4*2 - k = a + l/4*3 - ) - - if l >= 8 { - if l >= shortestNinther { - // Tukey ninther method, the idea came from Rust's implementation. - i = medianAdjacentCmpFunc(data, i, &swaps, cmp) - j = medianAdjacentCmpFunc(data, j, &swaps, cmp) - k = medianAdjacentCmpFunc(data, k, &swaps, cmp) - } - // Find the median among i, j, k and stores it into j. - j = medianCmpFunc(data, i, j, k, &swaps, cmp) - } - - switch swaps { - case 0: - return j, increasingHint - case maxSwaps: - return j, decreasingHint - default: - return j, unknownHint - } -} - -// order2CmpFunc returns x,y where data[x] <= data[y], where x,y=a,b or x,y=b,a. -func order2CmpFunc[E any](data []E, a, b int, swaps *int, cmp func(a, b E) int) (int, int) { - if cmp(data[b], data[a]) < 0 { - *swaps++ - return b, a - } - return a, b -} - -// medianCmpFunc returns x where data[x] is the median of data[a],data[b],data[c], where x is a, b, or c. -func medianCmpFunc[E any](data []E, a, b, c int, swaps *int, cmp func(a, b E) int) int { - a, b = order2CmpFunc(data, a, b, swaps, cmp) - b, c = order2CmpFunc(data, b, c, swaps, cmp) - a, b = order2CmpFunc(data, a, b, swaps, cmp) - return b -} - -// medianAdjacentCmpFunc finds the median of data[a - 1], data[a], data[a + 1] and stores the index into a. -func medianAdjacentCmpFunc[E any](data []E, a int, swaps *int, cmp func(a, b E) int) int { - return medianCmpFunc(data, a-1, a, a+1, swaps, cmp) -} - -func reverseRangeCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) { - i := a - j := b - 1 - for i < j { - data[i], data[j] = data[j], data[i] - i++ - j-- - } -} - -func swapRangeCmpFunc[E any](data []E, a, b, n int, cmp func(a, b E) int) { - for i := 0; i < n; i++ { - data[a+i], data[b+i] = data[b+i], data[a+i] - } -} - -func stableCmpFunc[E any](data []E, n int, cmp func(a, b E) int) { - blockSize := 20 // must be > 0 - a, b := 0, blockSize - for b <= n { - insertionSortCmpFunc(data, a, b, cmp) - a = b - b += blockSize - } - insertionSortCmpFunc(data, a, n, cmp) - - for blockSize < n { - a, b = 0, 2*blockSize - for b <= n { - symMergeCmpFunc(data, a, a+blockSize, b, cmp) - a = b - b += 2 * blockSize - } - if m := a + blockSize; m < n { - symMergeCmpFunc(data, a, m, n, cmp) - } - blockSize *= 2 - } -} - -// symMergeCmpFunc merges the two sorted subsequences data[a:m] and data[m:b] using -// the SymMerge algorithm from Pok-Son Kim and Arne Kutzner, "Stable Minimum -// Storage Merging by Symmetric Comparisons", in Susanne Albers and Tomasz -// Radzik, editors, Algorithms - ESA 2004, volume 3221 of Lecture Notes in -// Computer Science, pages 714-723. Springer, 2004. -// -// Let M = m-a and N = b-n. Wolog M < N. -// The recursion depth is bound by ceil(log(N+M)). -// The algorithm needs O(M*log(N/M + 1)) calls to data.Less. -// The algorithm needs O((M+N)*log(M)) calls to data.Swap. -// -// The paper gives O((M+N)*log(M)) as the number of assignments assuming a -// rotation algorithm which uses O(M+N+gcd(M+N)) assignments. The argumentation -// in the paper carries through for Swap operations, especially as the block -// swapping rotate uses only O(M+N) Swaps. -// -// symMerge assumes non-degenerate arguments: a < m && m < b. -// Having the caller check this condition eliminates many leaf recursion calls, -// which improves performance. -func symMergeCmpFunc[E any](data []E, a, m, b int, cmp func(a, b E) int) { - // Avoid unnecessary recursions of symMerge - // by direct insertion of data[a] into data[m:b] - // if data[a:m] only contains one element. - if m-a == 1 { - // Use binary search to find the lowest index i - // such that data[i] >= data[a] for m <= i < b. - // Exit the search loop with i == b in case no such index exists. - i := m - j := b - for i < j { - h := int(uint(i+j) >> 1) - if cmp(data[h], data[a]) < 0 { - i = h + 1 - } else { - j = h - } - } - // Swap values until data[a] reaches the position before i. - for k := a; k < i-1; k++ { - data[k], data[k+1] = data[k+1], data[k] - } - return - } - - // Avoid unnecessary recursions of symMerge - // by direct insertion of data[m] into data[a:m] - // if data[m:b] only contains one element. - if b-m == 1 { - // Use binary search to find the lowest index i - // such that data[i] > data[m] for a <= i < m. - // Exit the search loop with i == m in case no such index exists. - i := a - j := m - for i < j { - h := int(uint(i+j) >> 1) - if !(cmp(data[m], data[h]) < 0) { - i = h + 1 - } else { - j = h - } - } - // Swap values until data[m] reaches the position i. - for k := m; k > i; k-- { - data[k], data[k-1] = data[k-1], data[k] - } - return - } - - mid := int(uint(a+b) >> 1) - n := mid + m - var start, r int - if m > mid { - start = n - b - r = mid - } else { - start = a - r = m - } - p := n - 1 - - for start < r { - c := int(uint(start+r) >> 1) - if !(cmp(data[p-c], data[c]) < 0) { - start = c + 1 - } else { - r = c - } - } - - end := n - start - if start < m && m < end { - rotateCmpFunc(data, start, m, end, cmp) - } - if a < start && start < mid { - symMergeCmpFunc(data, a, start, mid, cmp) - } - if mid < end && end < b { - symMergeCmpFunc(data, mid, end, b, cmp) - } -} - -// rotateCmpFunc rotates two consecutive blocks u = data[a:m] and v = data[m:b] in data: -// Data of the form 'x u v y' is changed to 'x v u y'. -// rotate performs at most b-a many calls to data.Swap, -// and it assumes non-degenerate arguments: a < m && m < b. -func rotateCmpFunc[E any](data []E, a, m, b int, cmp func(a, b E) int) { - i := m - a - j := b - m - - for i != j { - if i > j { - swapRangeCmpFunc(data, m-i, m, j, cmp) - i -= j - } else { - swapRangeCmpFunc(data, m-i, m+j-i, i, cmp) - j -= i - } - } - // i == j - swapRangeCmpFunc(data, m-i, m, i, cmp) -} diff --git a/vendor/golang.org/x/exp/slices/zsortordered.go b/vendor/golang.org/x/exp/slices/zsortordered.go deleted file mode 100644 index 99b47c3986..0000000000 --- a/vendor/golang.org/x/exp/slices/zsortordered.go +++ /dev/null @@ -1,481 +0,0 @@ -// Code generated by gen_sort_variants.go; DO NOT EDIT. - -// Copyright 2022 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package slices - -import "golang.org/x/exp/constraints" - -// insertionSortOrdered sorts data[a:b] using insertion sort. -func insertionSortOrdered[E constraints.Ordered](data []E, a, b int) { - for i := a + 1; i < b; i++ { - for j := i; j > a && cmpLess(data[j], data[j-1]); j-- { - data[j], data[j-1] = data[j-1], data[j] - } - } -} - -// siftDownOrdered implements the heap property on data[lo:hi]. -// first is an offset into the array where the root of the heap lies. -func siftDownOrdered[E constraints.Ordered](data []E, lo, hi, first int) { - root := lo - for { - child := 2*root + 1 - if child >= hi { - break - } - if child+1 < hi && cmpLess(data[first+child], data[first+child+1]) { - child++ - } - if !cmpLess(data[first+root], data[first+child]) { - return - } - data[first+root], data[first+child] = data[first+child], data[first+root] - root = child - } -} - -func heapSortOrdered[E constraints.Ordered](data []E, a, b int) { - first := a - lo := 0 - hi := b - a - - // Build heap with greatest element at top. - for i := (hi - 1) / 2; i >= 0; i-- { - siftDownOrdered(data, i, hi, first) - } - - // Pop elements, largest first, into end of data. - for i := hi - 1; i >= 0; i-- { - data[first], data[first+i] = data[first+i], data[first] - siftDownOrdered(data, lo, i, first) - } -} - -// pdqsortOrdered sorts data[a:b]. -// The algorithm based on pattern-defeating quicksort(pdqsort), but without the optimizations from BlockQuicksort. -// pdqsort paper: https://arxiv.org/pdf/2106.05123.pdf -// C++ implementation: https://github.com/orlp/pdqsort -// Rust implementation: https://docs.rs/pdqsort/latest/pdqsort/ -// limit is the number of allowed bad (very unbalanced) pivots before falling back to heapsort. -func pdqsortOrdered[E constraints.Ordered](data []E, a, b, limit int) { - const maxInsertion = 12 - - var ( - wasBalanced = true // whether the last partitioning was reasonably balanced - wasPartitioned = true // whether the slice was already partitioned - ) - - for { - length := b - a - - if length <= maxInsertion { - insertionSortOrdered(data, a, b) - return - } - - // Fall back to heapsort if too many bad choices were made. - if limit == 0 { - heapSortOrdered(data, a, b) - return - } - - // If the last partitioning was imbalanced, we need to breaking patterns. - if !wasBalanced { - breakPatternsOrdered(data, a, b) - limit-- - } - - pivot, hint := choosePivotOrdered(data, a, b) - if hint == decreasingHint { - reverseRangeOrdered(data, a, b) - // The chosen pivot was pivot-a elements after the start of the array. - // After reversing it is pivot-a elements before the end of the array. - // The idea came from Rust's implementation. - pivot = (b - 1) - (pivot - a) - hint = increasingHint - } - - // The slice is likely already sorted. - if wasBalanced && wasPartitioned && hint == increasingHint { - if partialInsertionSortOrdered(data, a, b) { - return - } - } - - // Probably the slice contains many duplicate elements, partition the slice into - // elements equal to and elements greater than the pivot. - if a > 0 && !cmpLess(data[a-1], data[pivot]) { - mid := partitionEqualOrdered(data, a, b, pivot) - a = mid - continue - } - - mid, alreadyPartitioned := partitionOrdered(data, a, b, pivot) - wasPartitioned = alreadyPartitioned - - leftLen, rightLen := mid-a, b-mid - balanceThreshold := length / 8 - if leftLen < rightLen { - wasBalanced = leftLen >= balanceThreshold - pdqsortOrdered(data, a, mid, limit) - a = mid + 1 - } else { - wasBalanced = rightLen >= balanceThreshold - pdqsortOrdered(data, mid+1, b, limit) - b = mid - } - } -} - -// partitionOrdered does one quicksort partition. -// Let p = data[pivot] -// Moves elements in data[a:b] around, so that data[i]

=p for inewpivot. -// On return, data[newpivot] = p -func partitionOrdered[E constraints.Ordered](data []E, a, b, pivot int) (newpivot int, alreadyPartitioned bool) { - data[a], data[pivot] = data[pivot], data[a] - i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned - - for i <= j && cmpLess(data[i], data[a]) { - i++ - } - for i <= j && !cmpLess(data[j], data[a]) { - j-- - } - if i > j { - data[j], data[a] = data[a], data[j] - return j, true - } - data[i], data[j] = data[j], data[i] - i++ - j-- - - for { - for i <= j && cmpLess(data[i], data[a]) { - i++ - } - for i <= j && !cmpLess(data[j], data[a]) { - j-- - } - if i > j { - break - } - data[i], data[j] = data[j], data[i] - i++ - j-- - } - data[j], data[a] = data[a], data[j] - return j, false -} - -// partitionEqualOrdered partitions data[a:b] into elements equal to data[pivot] followed by elements greater than data[pivot]. -// It assumed that data[a:b] does not contain elements smaller than the data[pivot]. -func partitionEqualOrdered[E constraints.Ordered](data []E, a, b, pivot int) (newpivot int) { - data[a], data[pivot] = data[pivot], data[a] - i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned - - for { - for i <= j && !cmpLess(data[a], data[i]) { - i++ - } - for i <= j && cmpLess(data[a], data[j]) { - j-- - } - if i > j { - break - } - data[i], data[j] = data[j], data[i] - i++ - j-- - } - return i -} - -// partialInsertionSortOrdered partially sorts a slice, returns true if the slice is sorted at the end. -func partialInsertionSortOrdered[E constraints.Ordered](data []E, a, b int) bool { - const ( - maxSteps = 5 // maximum number of adjacent out-of-order pairs that will get shifted - shortestShifting = 50 // don't shift any elements on short arrays - ) - i := a + 1 - for j := 0; j < maxSteps; j++ { - for i < b && !cmpLess(data[i], data[i-1]) { - i++ - } - - if i == b { - return true - } - - if b-a < shortestShifting { - return false - } - - data[i], data[i-1] = data[i-1], data[i] - - // Shift the smaller one to the left. - if i-a >= 2 { - for j := i - 1; j >= 1; j-- { - if !cmpLess(data[j], data[j-1]) { - break - } - data[j], data[j-1] = data[j-1], data[j] - } - } - // Shift the greater one to the right. - if b-i >= 2 { - for j := i + 1; j < b; j++ { - if !cmpLess(data[j], data[j-1]) { - break - } - data[j], data[j-1] = data[j-1], data[j] - } - } - } - return false -} - -// breakPatternsOrdered scatters some elements around in an attempt to break some patterns -// that might cause imbalanced partitions in quicksort. -func breakPatternsOrdered[E constraints.Ordered](data []E, a, b int) { - length := b - a - if length >= 8 { - random := xorshift(length) - modulus := nextPowerOfTwo(length) - - for idx := a + (length/4)*2 - 1; idx <= a+(length/4)*2+1; idx++ { - other := int(uint(random.Next()) & (modulus - 1)) - if other >= length { - other -= length - } - data[idx], data[a+other] = data[a+other], data[idx] - } - } -} - -// choosePivotOrdered chooses a pivot in data[a:b]. -// -// [0,8): chooses a static pivot. -// [8,shortestNinther): uses the simple median-of-three method. -// [shortestNinther,∞): uses the Tukey ninther method. -func choosePivotOrdered[E constraints.Ordered](data []E, a, b int) (pivot int, hint sortedHint) { - const ( - shortestNinther = 50 - maxSwaps = 4 * 3 - ) - - l := b - a - - var ( - swaps int - i = a + l/4*1 - j = a + l/4*2 - k = a + l/4*3 - ) - - if l >= 8 { - if l >= shortestNinther { - // Tukey ninther method, the idea came from Rust's implementation. - i = medianAdjacentOrdered(data, i, &swaps) - j = medianAdjacentOrdered(data, j, &swaps) - k = medianAdjacentOrdered(data, k, &swaps) - } - // Find the median among i, j, k and stores it into j. - j = medianOrdered(data, i, j, k, &swaps) - } - - switch swaps { - case 0: - return j, increasingHint - case maxSwaps: - return j, decreasingHint - default: - return j, unknownHint - } -} - -// order2Ordered returns x,y where data[x] <= data[y], where x,y=a,b or x,y=b,a. -func order2Ordered[E constraints.Ordered](data []E, a, b int, swaps *int) (int, int) { - if cmpLess(data[b], data[a]) { - *swaps++ - return b, a - } - return a, b -} - -// medianOrdered returns x where data[x] is the median of data[a],data[b],data[c], where x is a, b, or c. -func medianOrdered[E constraints.Ordered](data []E, a, b, c int, swaps *int) int { - a, b = order2Ordered(data, a, b, swaps) - b, c = order2Ordered(data, b, c, swaps) - a, b = order2Ordered(data, a, b, swaps) - return b -} - -// medianAdjacentOrdered finds the median of data[a - 1], data[a], data[a + 1] and stores the index into a. -func medianAdjacentOrdered[E constraints.Ordered](data []E, a int, swaps *int) int { - return medianOrdered(data, a-1, a, a+1, swaps) -} - -func reverseRangeOrdered[E constraints.Ordered](data []E, a, b int) { - i := a - j := b - 1 - for i < j { - data[i], data[j] = data[j], data[i] - i++ - j-- - } -} - -func swapRangeOrdered[E constraints.Ordered](data []E, a, b, n int) { - for i := 0; i < n; i++ { - data[a+i], data[b+i] = data[b+i], data[a+i] - } -} - -func stableOrdered[E constraints.Ordered](data []E, n int) { - blockSize := 20 // must be > 0 - a, b := 0, blockSize - for b <= n { - insertionSortOrdered(data, a, b) - a = b - b += blockSize - } - insertionSortOrdered(data, a, n) - - for blockSize < n { - a, b = 0, 2*blockSize - for b <= n { - symMergeOrdered(data, a, a+blockSize, b) - a = b - b += 2 * blockSize - } - if m := a + blockSize; m < n { - symMergeOrdered(data, a, m, n) - } - blockSize *= 2 - } -} - -// symMergeOrdered merges the two sorted subsequences data[a:m] and data[m:b] using -// the SymMerge algorithm from Pok-Son Kim and Arne Kutzner, "Stable Minimum -// Storage Merging by Symmetric Comparisons", in Susanne Albers and Tomasz -// Radzik, editors, Algorithms - ESA 2004, volume 3221 of Lecture Notes in -// Computer Science, pages 714-723. Springer, 2004. -// -// Let M = m-a and N = b-n. Wolog M < N. -// The recursion depth is bound by ceil(log(N+M)). -// The algorithm needs O(M*log(N/M + 1)) calls to data.Less. -// The algorithm needs O((M+N)*log(M)) calls to data.Swap. -// -// The paper gives O((M+N)*log(M)) as the number of assignments assuming a -// rotation algorithm which uses O(M+N+gcd(M+N)) assignments. The argumentation -// in the paper carries through for Swap operations, especially as the block -// swapping rotate uses only O(M+N) Swaps. -// -// symMerge assumes non-degenerate arguments: a < m && m < b. -// Having the caller check this condition eliminates many leaf recursion calls, -// which improves performance. -func symMergeOrdered[E constraints.Ordered](data []E, a, m, b int) { - // Avoid unnecessary recursions of symMerge - // by direct insertion of data[a] into data[m:b] - // if data[a:m] only contains one element. - if m-a == 1 { - // Use binary search to find the lowest index i - // such that data[i] >= data[a] for m <= i < b. - // Exit the search loop with i == b in case no such index exists. - i := m - j := b - for i < j { - h := int(uint(i+j) >> 1) - if cmpLess(data[h], data[a]) { - i = h + 1 - } else { - j = h - } - } - // Swap values until data[a] reaches the position before i. - for k := a; k < i-1; k++ { - data[k], data[k+1] = data[k+1], data[k] - } - return - } - - // Avoid unnecessary recursions of symMerge - // by direct insertion of data[m] into data[a:m] - // if data[m:b] only contains one element. - if b-m == 1 { - // Use binary search to find the lowest index i - // such that data[i] > data[m] for a <= i < m. - // Exit the search loop with i == m in case no such index exists. - i := a - j := m - for i < j { - h := int(uint(i+j) >> 1) - if !cmpLess(data[m], data[h]) { - i = h + 1 - } else { - j = h - } - } - // Swap values until data[m] reaches the position i. - for k := m; k > i; k-- { - data[k], data[k-1] = data[k-1], data[k] - } - return - } - - mid := int(uint(a+b) >> 1) - n := mid + m - var start, r int - if m > mid { - start = n - b - r = mid - } else { - start = a - r = m - } - p := n - 1 - - for start < r { - c := int(uint(start+r) >> 1) - if !cmpLess(data[p-c], data[c]) { - start = c + 1 - } else { - r = c - } - } - - end := n - start - if start < m && m < end { - rotateOrdered(data, start, m, end) - } - if a < start && start < mid { - symMergeOrdered(data, a, start, mid) - } - if mid < end && end < b { - symMergeOrdered(data, mid, end, b) - } -} - -// rotateOrdered rotates two consecutive blocks u = data[a:m] and v = data[m:b] in data: -// Data of the form 'x u v y' is changed to 'x v u y'. -// rotate performs at most b-a many calls to data.Swap, -// and it assumes non-degenerate arguments: a < m && m < b. -func rotateOrdered[E constraints.Ordered](data []E, a, m, b int) { - i := m - a - j := b - m - - for i != j { - if i > j { - swapRangeOrdered(data, m-i, m, j) - i -= j - } else { - swapRangeOrdered(data, m-i, m+j-i, i) - j -= i - } - } - // i == j - swapRangeOrdered(data, m-i, m, i) -} diff --git a/vendor/golang.org/x/net/html/doc.go b/vendor/golang.org/x/net/html/doc.go index 3a7e5ab176..885c4c5936 100644 --- a/vendor/golang.org/x/net/html/doc.go +++ b/vendor/golang.org/x/net/html/doc.go @@ -78,16 +78,11 @@ example, to process each anchor node in depth-first order: if err != nil { // ... } - var f func(*html.Node) - f = func(n *html.Node) { + for n := range doc.Descendants() { if n.Type == html.ElementNode && n.Data == "a" { // Do something with n... } - for c := n.FirstChild; c != nil; c = c.NextSibling { - f(c) - } } - f(doc) The relevant specifications include: https://html.spec.whatwg.org/multipage/syntax.html and diff --git a/vendor/golang.org/x/net/html/iter.go b/vendor/golang.org/x/net/html/iter.go new file mode 100644 index 0000000000..54be8fd30f --- /dev/null +++ b/vendor/golang.org/x/net/html/iter.go @@ -0,0 +1,56 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.23 + +package html + +import "iter" + +// Ancestors returns an iterator over the ancestors of n, starting with n.Parent. +// +// Mutating a Node or its parents while iterating may have unexpected results. +func (n *Node) Ancestors() iter.Seq[*Node] { + _ = n.Parent // eager nil check + + return func(yield func(*Node) bool) { + for p := n.Parent; p != nil && yield(p); p = p.Parent { + } + } +} + +// ChildNodes returns an iterator over the immediate children of n, +// starting with n.FirstChild. +// +// Mutating a Node or its children while iterating may have unexpected results. +func (n *Node) ChildNodes() iter.Seq[*Node] { + _ = n.FirstChild // eager nil check + + return func(yield func(*Node) bool) { + for c := n.FirstChild; c != nil && yield(c); c = c.NextSibling { + } + } + +} + +// Descendants returns an iterator over all nodes recursively beneath +// n, excluding n itself. Nodes are visited in depth-first preorder. +// +// Mutating a Node or its descendants while iterating may have unexpected results. +func (n *Node) Descendants() iter.Seq[*Node] { + _ = n.FirstChild // eager nil check + + return func(yield func(*Node) bool) { + n.descendants(yield) + } +} + +func (n *Node) descendants(yield func(*Node) bool) bool { + for c := range n.ChildNodes() { + if !yield(c) || !c.descendants(yield) { + return false + } + } + return true +} diff --git a/vendor/golang.org/x/net/html/node.go b/vendor/golang.org/x/net/html/node.go index 1350eef22c..77741a1950 100644 --- a/vendor/golang.org/x/net/html/node.go +++ b/vendor/golang.org/x/net/html/node.go @@ -38,6 +38,10 @@ var scopeMarker = Node{Type: scopeMarkerNode} // that it looks like "a 1<<24-1 { return ConnectionError(ErrCodeProtocol) } + case SettingEnableConnectProtocol: + if s.Val != 1 && s.Val != 0 { + return ConnectionError(ErrCodeProtocol) + } } return nil } @@ -150,21 +158,23 @@ func (s Setting) Valid() error { type SettingID uint16 const ( - SettingHeaderTableSize SettingID = 0x1 - SettingEnablePush SettingID = 0x2 - SettingMaxConcurrentStreams SettingID = 0x3 - SettingInitialWindowSize SettingID = 0x4 - SettingMaxFrameSize SettingID = 0x5 - SettingMaxHeaderListSize SettingID = 0x6 + SettingHeaderTableSize SettingID = 0x1 + SettingEnablePush SettingID = 0x2 + SettingMaxConcurrentStreams SettingID = 0x3 + SettingInitialWindowSize SettingID = 0x4 + SettingMaxFrameSize SettingID = 0x5 + SettingMaxHeaderListSize SettingID = 0x6 + SettingEnableConnectProtocol SettingID = 0x8 ) var settingName = map[SettingID]string{ - SettingHeaderTableSize: "HEADER_TABLE_SIZE", - SettingEnablePush: "ENABLE_PUSH", - SettingMaxConcurrentStreams: "MAX_CONCURRENT_STREAMS", - SettingInitialWindowSize: "INITIAL_WINDOW_SIZE", - SettingMaxFrameSize: "MAX_FRAME_SIZE", - SettingMaxHeaderListSize: "MAX_HEADER_LIST_SIZE", + SettingHeaderTableSize: "HEADER_TABLE_SIZE", + SettingEnablePush: "ENABLE_PUSH", + SettingMaxConcurrentStreams: "MAX_CONCURRENT_STREAMS", + SettingInitialWindowSize: "INITIAL_WINDOW_SIZE", + SettingMaxFrameSize: "MAX_FRAME_SIZE", + SettingMaxHeaderListSize: "MAX_HEADER_LIST_SIZE", + SettingEnableConnectProtocol: "ENABLE_CONNECT_PROTOCOL", } func (s SettingID) String() string { diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go index 617b4a4762..b55547aec6 100644 --- a/vendor/golang.org/x/net/http2/server.go +++ b/vendor/golang.org/x/net/http2/server.go @@ -306,7 +306,7 @@ func ConfigureServer(s *http.Server, conf *Server) error { if s.TLSNextProto == nil { s.TLSNextProto = map[string]func(*http.Server, *tls.Conn, http.Handler){} } - protoHandler := func(hs *http.Server, c *tls.Conn, h http.Handler) { + protoHandler := func(hs *http.Server, c net.Conn, h http.Handler, sawClientPreface bool) { if testHookOnConn != nil { testHookOnConn() } @@ -323,12 +323,31 @@ func ConfigureServer(s *http.Server, conf *Server) error { ctx = bc.BaseContext() } conf.ServeConn(c, &ServeConnOpts{ - Context: ctx, - Handler: h, - BaseConfig: hs, + Context: ctx, + Handler: h, + BaseConfig: hs, + SawClientPreface: sawClientPreface, }) } - s.TLSNextProto[NextProtoTLS] = protoHandler + s.TLSNextProto[NextProtoTLS] = func(hs *http.Server, c *tls.Conn, h http.Handler) { + protoHandler(hs, c, h, false) + } + // The "unencrypted_http2" TLSNextProto key is used to pass off non-TLS HTTP/2 conns. + // + // A connection passed in this method has already had the HTTP/2 preface read from it. + s.TLSNextProto[nextProtoUnencryptedHTTP2] = func(hs *http.Server, c *tls.Conn, h http.Handler) { + nc, err := unencryptedNetConnFromTLSConn(c) + if err != nil { + if lg := hs.ErrorLog; lg != nil { + lg.Print(err) + } else { + log.Print(err) + } + go c.Close() + return + } + protoHandler(hs, nc, h, true) + } return nil } @@ -913,14 +932,18 @@ func (sc *serverConn) serve(conf http2Config) { sc.vlogf("http2: server connection from %v on %p", sc.conn.RemoteAddr(), sc.hs) } + settings := writeSettings{ + {SettingMaxFrameSize, conf.MaxReadFrameSize}, + {SettingMaxConcurrentStreams, sc.advMaxStreams}, + {SettingMaxHeaderListSize, sc.maxHeaderListSize()}, + {SettingHeaderTableSize, conf.MaxDecoderHeaderTableSize}, + {SettingInitialWindowSize, uint32(sc.initialStreamRecvWindowSize)}, + } + if !disableExtendedConnectProtocol { + settings = append(settings, Setting{SettingEnableConnectProtocol, 1}) + } sc.writeFrame(FrameWriteRequest{ - write: writeSettings{ - {SettingMaxFrameSize, conf.MaxReadFrameSize}, - {SettingMaxConcurrentStreams, sc.advMaxStreams}, - {SettingMaxHeaderListSize, sc.maxHeaderListSize()}, - {SettingHeaderTableSize, conf.MaxDecoderHeaderTableSize}, - {SettingInitialWindowSize, uint32(sc.initialStreamRecvWindowSize)}, - }, + write: settings, }) sc.unackedSettings++ @@ -1782,6 +1805,9 @@ func (sc *serverConn) processSetting(s Setting) error { sc.maxFrameSize = int32(s.Val) // the maximum valid s.Val is < 2^31 case SettingMaxHeaderListSize: sc.peerMaxHeaderListSize = s.Val + case SettingEnableConnectProtocol: + // Receipt of this parameter by a server does not + // have any impact default: // Unknown setting: "An endpoint that receives a SETTINGS // frame with any unknown or unsupported identifier MUST @@ -2212,11 +2238,17 @@ func (sc *serverConn) newWriterAndRequest(st *stream, f *MetaHeadersFrame) (*res scheme: f.PseudoValue("scheme"), authority: f.PseudoValue("authority"), path: f.PseudoValue("path"), + protocol: f.PseudoValue("protocol"), + } + + // extended connect is disabled, so we should not see :protocol + if disableExtendedConnectProtocol && rp.protocol != "" { + return nil, nil, sc.countError("bad_connect", streamError(f.StreamID, ErrCodeProtocol)) } isConnect := rp.method == "CONNECT" if isConnect { - if rp.path != "" || rp.scheme != "" || rp.authority == "" { + if rp.protocol == "" && (rp.path != "" || rp.scheme != "" || rp.authority == "") { return nil, nil, sc.countError("bad_connect", streamError(f.StreamID, ErrCodeProtocol)) } } else if rp.method == "" || rp.path == "" || (rp.scheme != "https" && rp.scheme != "http") { @@ -2240,6 +2272,9 @@ func (sc *serverConn) newWriterAndRequest(st *stream, f *MetaHeadersFrame) (*res if rp.authority == "" { rp.authority = rp.header.Get("Host") } + if rp.protocol != "" { + rp.header.Set(":protocol", rp.protocol) + } rw, req, err := sc.newWriterAndRequestNoBody(st, rp) if err != nil { @@ -2266,6 +2301,7 @@ func (sc *serverConn) newWriterAndRequest(st *stream, f *MetaHeadersFrame) (*res type requestParam struct { method string scheme, authority, path string + protocol string header http.Header } @@ -2307,7 +2343,7 @@ func (sc *serverConn) newWriterAndRequestNoBody(st *stream, rp requestParam) (*r var url_ *url.URL var requestURI string - if rp.method == "CONNECT" { + if rp.method == "CONNECT" && rp.protocol == "" { url_ = &url.URL{Host: rp.authority} requestURI = rp.authority // mimic HTTP/1 server behavior } else { @@ -2880,6 +2916,11 @@ func (w *responseWriter) SetWriteDeadline(deadline time.Time) error { return nil } +func (w *responseWriter) EnableFullDuplex() error { + // We always support full duplex responses, so this is a no-op. + return nil +} + func (w *responseWriter) Flush() { w.FlushError() } diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go index 0c5f64aa8b..090d0e1bdb 100644 --- a/vendor/golang.org/x/net/http2/transport.go +++ b/vendor/golang.org/x/net/http2/transport.go @@ -202,6 +202,20 @@ func (t *Transport) markNewGoroutine() { } } +func (t *Transport) now() time.Time { + if t != nil && t.transportTestHooks != nil { + return t.transportTestHooks.group.Now() + } + return time.Now() +} + +func (t *Transport) timeSince(when time.Time) time.Duration { + if t != nil && t.transportTestHooks != nil { + return t.now().Sub(when) + } + return time.Since(when) +} + // newTimer creates a new time.Timer, or a synthetic timer in tests. func (t *Transport) newTimer(d time.Duration) timer { if t.transportTestHooks != nil { @@ -281,8 +295,8 @@ func configureTransports(t1 *http.Transport) (*Transport, error) { if !strSliceContains(t1.TLSClientConfig.NextProtos, "http/1.1") { t1.TLSClientConfig.NextProtos = append(t1.TLSClientConfig.NextProtos, "http/1.1") } - upgradeFn := func(authority string, c *tls.Conn) http.RoundTripper { - addr := authorityAddr("https", authority) + upgradeFn := func(scheme, authority string, c net.Conn) http.RoundTripper { + addr := authorityAddr(scheme, authority) if used, err := connPool.addConnIfNeeded(addr, t2, c); err != nil { go c.Close() return erringRoundTripper{err} @@ -293,18 +307,37 @@ func configureTransports(t1 *http.Transport) (*Transport, error) { // was unknown) go c.Close() } + if scheme == "http" { + return (*unencryptedTransport)(t2) + } return t2 } - if m := t1.TLSNextProto; len(m) == 0 { - t1.TLSNextProto = map[string]func(string, *tls.Conn) http.RoundTripper{ - "h2": upgradeFn, + if t1.TLSNextProto == nil { + t1.TLSNextProto = make(map[string]func(string, *tls.Conn) http.RoundTripper) + } + t1.TLSNextProto[NextProtoTLS] = func(authority string, c *tls.Conn) http.RoundTripper { + return upgradeFn("https", authority, c) + } + // The "unencrypted_http2" TLSNextProto key is used to pass off non-TLS HTTP/2 conns. + t1.TLSNextProto[nextProtoUnencryptedHTTP2] = func(authority string, c *tls.Conn) http.RoundTripper { + nc, err := unencryptedNetConnFromTLSConn(c) + if err != nil { + go c.Close() + return erringRoundTripper{err} } - } else { - m["h2"] = upgradeFn + return upgradeFn("http", authority, nc) } return t2, nil } +// unencryptedTransport is a Transport with a RoundTrip method that +// always permits http:// URLs. +type unencryptedTransport Transport + +func (t *unencryptedTransport) RoundTrip(req *http.Request) (*http.Response, error) { + return (*Transport)(t).RoundTripOpt(req, RoundTripOpt{allowHTTP: true}) +} + func (t *Transport) connPool() ClientConnPool { t.connPoolOnce.Do(t.initConnPool) return t.connPoolOrDef @@ -324,7 +357,7 @@ type ClientConn struct { t *Transport tconn net.Conn // usually *tls.Conn, except specialized impls tlsState *tls.ConnectionState // nil only for specialized impls - reused uint32 // whether conn is being reused; atomic + atomicReused uint32 // whether conn is being reused; atomic singleUse bool // whether being used for a single http.Request getConnCalled bool // used by clientConnPool @@ -335,25 +368,26 @@ type ClientConn struct { idleTimeout time.Duration // or 0 for never idleTimer timer - mu sync.Mutex // guards following - cond *sync.Cond // hold mu; broadcast on flow/closed changes - flow outflow // our conn-level flow control quota (cs.outflow is per stream) - inflow inflow // peer's conn-level flow control - doNotReuse bool // whether conn is marked to not be reused for any future requests - closing bool - closed bool - seenSettings bool // true if we've seen a settings frame, false otherwise - wantSettingsAck bool // we sent a SETTINGS frame and haven't heard back - goAway *GoAwayFrame // if non-nil, the GoAwayFrame we received - goAwayDebug string // goAway frame's debug data, retained as a string - streams map[uint32]*clientStream // client-initiated - streamsReserved int // incr by ReserveNewRequest; decr on RoundTrip - nextStreamID uint32 - pendingRequests int // requests blocked and waiting to be sent because len(streams) == maxConcurrentStreams - pings map[[8]byte]chan struct{} // in flight ping data to notification channel - br *bufio.Reader - lastActive time.Time - lastIdle time.Time // time last idle + mu sync.Mutex // guards following + cond *sync.Cond // hold mu; broadcast on flow/closed changes + flow outflow // our conn-level flow control quota (cs.outflow is per stream) + inflow inflow // peer's conn-level flow control + doNotReuse bool // whether conn is marked to not be reused for any future requests + closing bool + closed bool + seenSettings bool // true if we've seen a settings frame, false otherwise + seenSettingsChan chan struct{} // closed when seenSettings is true or frame reading fails + wantSettingsAck bool // we sent a SETTINGS frame and haven't heard back + goAway *GoAwayFrame // if non-nil, the GoAwayFrame we received + goAwayDebug string // goAway frame's debug data, retained as a string + streams map[uint32]*clientStream // client-initiated + streamsReserved int // incr by ReserveNewRequest; decr on RoundTrip + nextStreamID uint32 + pendingRequests int // requests blocked and waiting to be sent because len(streams) == maxConcurrentStreams + pings map[[8]byte]chan struct{} // in flight ping data to notification channel + br *bufio.Reader + lastActive time.Time + lastIdle time.Time // time last idle // Settings from peer: (also guarded by wmu) maxFrameSize uint32 maxConcurrentStreams uint32 @@ -363,6 +397,25 @@ type ClientConn struct { initialStreamRecvWindowSize int32 readIdleTimeout time.Duration pingTimeout time.Duration + extendedConnectAllowed bool + + // rstStreamPingsBlocked works around an unfortunate gRPC behavior. + // gRPC strictly limits the number of PING frames that it will receive. + // The default is two pings per two hours, but the limit resets every time + // the gRPC endpoint sends a HEADERS or DATA frame. See golang/go#70575. + // + // rstStreamPingsBlocked is set after receiving a response to a PING frame + // bundled with an RST_STREAM (see pendingResets below), and cleared after + // receiving a HEADERS or DATA frame. + rstStreamPingsBlocked bool + + // pendingResets is the number of RST_STREAM frames we have sent to the peer, + // without confirming that the peer has received them. When we send a RST_STREAM, + // we bundle it with a PING frame, unless a PING is already in flight. We count + // the reset stream against the connection's concurrency limit until we get + // a PING response. This limits the number of requests we'll try to send to a + // completely unresponsive connection. + pendingResets int // reqHeaderMu is a 1-element semaphore channel controlling access to sending new requests. // Write to reqHeaderMu to lock it, read from it to unlock. @@ -420,12 +473,12 @@ type clientStream struct { sentHeaders bool // owned by clientConnReadLoop: - firstByte bool // got the first response byte - pastHeaders bool // got first MetaHeadersFrame (actual headers) - pastTrailers bool // got optional second MetaHeadersFrame (trailers) - num1xx uint8 // number of 1xx responses seen - readClosed bool // peer sent an END_STREAM flag - readAborted bool // read loop reset the stream + firstByte bool // got the first response byte + pastHeaders bool // got first MetaHeadersFrame (actual headers) + pastTrailers bool // got optional second MetaHeadersFrame (trailers) + readClosed bool // peer sent an END_STREAM flag + readAborted bool // read loop reset the stream + totalHeaderSize int64 // total size of 1xx headers seen trailer http.Header // accumulated trailers resTrailer *http.Header // client's Response.Trailer @@ -530,6 +583,8 @@ type RoundTripOpt struct { // no cached connection is available, RoundTripOpt // will return ErrNoCachedConn. OnlyCachedConn bool + + allowHTTP bool // allow http:// URLs } func (t *Transport) RoundTrip(req *http.Request) (*http.Response, error) { @@ -562,7 +617,14 @@ func authorityAddr(scheme string, authority string) (addr string) { // RoundTripOpt is like RoundTrip, but takes options. func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Response, error) { - if !(req.URL.Scheme == "https" || (req.URL.Scheme == "http" && t.AllowHTTP)) { + switch req.URL.Scheme { + case "https": + // Always okay. + case "http": + if !t.AllowHTTP && !opt.allowHTTP { + return nil, errors.New("http2: unencrypted HTTP/2 not enabled") + } + default: return nil, errors.New("http2: unsupported scheme") } @@ -573,7 +635,7 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res t.vlogf("http2: Transport failed to get client conn for %s: %v", addr, err) return nil, err } - reused := !atomic.CompareAndSwapUint32(&cc.reused, 0, 1) + reused := !atomic.CompareAndSwapUint32(&cc.atomicReused, 0, 1) traceGotConn(req, cc, reused) res, err := cc.RoundTrip(req) if err != nil && retry <= 6 { @@ -598,6 +660,22 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res } } } + if err == errClientConnNotEstablished { + // This ClientConn was created recently, + // this is the first request to use it, + // and the connection is closed and not usable. + // + // In this state, cc.idleTimer will remove the conn from the pool + // when it fires. Stop the timer and remove it here so future requests + // won't try to use this connection. + // + // If the timer has already fired and we're racing it, the redundant + // call to MarkDead is harmless. + if cc.idleTimer != nil { + cc.idleTimer.Stop() + } + t.connPool().MarkDead(cc) + } if err != nil { t.vlogf("RoundTrip failure: %v", err) return nil, err @@ -616,9 +694,10 @@ func (t *Transport) CloseIdleConnections() { } var ( - errClientConnClosed = errors.New("http2: client conn is closed") - errClientConnUnusable = errors.New("http2: client conn not usable") - errClientConnGotGoAway = errors.New("http2: Transport received Server's graceful shutdown GOAWAY") + errClientConnClosed = errors.New("http2: client conn is closed") + errClientConnUnusable = errors.New("http2: client conn not usable") + errClientConnNotEstablished = errors.New("http2: client conn could not be established") + errClientConnGotGoAway = errors.New("http2: Transport received Server's graceful shutdown GOAWAY") ) // shouldRetryRequest is called by RoundTrip when a request fails to get @@ -752,11 +831,13 @@ func (t *Transport) newClientConn(c net.Conn, singleUse bool) (*ClientConn, erro peerMaxHeaderListSize: 0xffffffffffffffff, // "infinite", per spec. Use 2^64-1 instead. streams: make(map[uint32]*clientStream), singleUse: singleUse, + seenSettingsChan: make(chan struct{}), wantSettingsAck: true, readIdleTimeout: conf.SendPingTimeout, pingTimeout: conf.PingTimeout, pings: make(map[[8]byte]chan struct{}), reqHeaderMu: make(chan struct{}, 1), + lastActive: t.now(), } var group synctestGroupInterface if t.transportTestHooks != nil { @@ -960,7 +1041,7 @@ func (cc *ClientConn) State() ClientConnState { return ClientConnState{ Closed: cc.closed, Closing: cc.closing || cc.singleUse || cc.doNotReuse || cc.goAway != nil, - StreamsActive: len(cc.streams), + StreamsActive: len(cc.streams) + cc.pendingResets, StreamsReserved: cc.streamsReserved, StreamsPending: cc.pendingRequests, LastIdle: cc.lastIdle, @@ -992,16 +1073,38 @@ func (cc *ClientConn) idleStateLocked() (st clientConnIdleState) { // writing it. maxConcurrentOkay = true } else { - maxConcurrentOkay = int64(len(cc.streams)+cc.streamsReserved+1) <= int64(cc.maxConcurrentStreams) + // We can take a new request if the total of + // - active streams; + // - reservation slots for new streams; and + // - streams for which we have sent a RST_STREAM and a PING, + // but received no subsequent frame + // is less than the concurrency limit. + maxConcurrentOkay = cc.currentRequestCountLocked() < int(cc.maxConcurrentStreams) } st.canTakeNewRequest = cc.goAway == nil && !cc.closed && !cc.closing && maxConcurrentOkay && !cc.doNotReuse && int64(cc.nextStreamID)+2*int64(cc.pendingRequests) < math.MaxInt32 && !cc.tooIdleLocked() + + // If this connection has never been used for a request and is closed, + // then let it take a request (which will fail). + // + // This avoids a situation where an error early in a connection's lifetime + // goes unreported. + if cc.nextStreamID == 1 && cc.streamsReserved == 0 && cc.closed { + st.canTakeNewRequest = true + } + return } +// currentRequestCountLocked reports the number of concurrency slots currently in use, +// including active streams, reserved slots, and reset streams waiting for acknowledgement. +func (cc *ClientConn) currentRequestCountLocked() int { + return len(cc.streams) + cc.streamsReserved + cc.pendingResets +} + func (cc *ClientConn) canTakeNewRequestLocked() bool { st := cc.idleStateLocked() return st.canTakeNewRequest @@ -1014,7 +1117,7 @@ func (cc *ClientConn) tooIdleLocked() bool { // times are compared based on their wall time. We don't want // to reuse a connection that's been sitting idle during // VM/laptop suspend if monotonic time was also frozen. - return cc.idleTimeout != 0 && !cc.lastIdle.IsZero() && time.Since(cc.lastIdle.Round(0)) > cc.idleTimeout + return cc.idleTimeout != 0 && !cc.lastIdle.IsZero() && cc.t.timeSince(cc.lastIdle.Round(0)) > cc.idleTimeout } // onIdleTimeout is called from a time.AfterFunc goroutine. It will @@ -1376,6 +1479,8 @@ func (cs *clientStream) doRequest(req *http.Request, streamf func(*clientStream) cs.cleanupWriteRequest(err) } +var errExtendedConnectNotSupported = errors.New("net/http: extended connect not supported by peer") + // writeRequest sends a request. // // It returns nil after the request is written, the response read, @@ -1391,12 +1496,31 @@ func (cs *clientStream) writeRequest(req *http.Request, streamf func(*clientStre return err } + // wait for setting frames to be received, a server can change this value later, + // but we just wait for the first settings frame + var isExtendedConnect bool + if req.Method == "CONNECT" && req.Header.Get(":protocol") != "" { + isExtendedConnect = true + } + // Acquire the new-request lock by writing to reqHeaderMu. // This lock guards the critical section covering allocating a new stream ID // (requires mu) and creating the stream (requires wmu). if cc.reqHeaderMu == nil { panic("RoundTrip on uninitialized ClientConn") // for tests } + if isExtendedConnect { + select { + case <-cs.reqCancel: + return errRequestCanceled + case <-ctx.Done(): + return ctx.Err() + case <-cc.seenSettingsChan: + if !cc.extendedConnectAllowed { + return errExtendedConnectNotSupported + } + } + } select { case cc.reqHeaderMu <- struct{}{}: case <-cs.reqCancel: @@ -1578,6 +1702,7 @@ func (cs *clientStream) cleanupWriteRequest(err error) { cs.reqBodyClosed = make(chan struct{}) } bodyClosed := cs.reqBodyClosed + closeOnIdle := cc.singleUse || cc.doNotReuse || cc.t.disableKeepAlives() || cc.goAway != nil cc.mu.Unlock() if mustCloseBody { cs.reqBody.Close() @@ -1602,16 +1727,44 @@ func (cs *clientStream) cleanupWriteRequest(err error) { if cs.sentHeaders { if se, ok := err.(StreamError); ok { if se.Cause != errFromPeer { - cc.writeStreamReset(cs.ID, se.Code, err) + cc.writeStreamReset(cs.ID, se.Code, false, err) } } else { - cc.writeStreamReset(cs.ID, ErrCodeCancel, err) + // We're cancelling an in-flight request. + // + // This could be due to the server becoming unresponsive. + // To avoid sending too many requests on a dead connection, + // we let the request continue to consume a concurrency slot + // until we can confirm the server is still responding. + // We do this by sending a PING frame along with the RST_STREAM + // (unless a ping is already in flight). + // + // For simplicity, we don't bother tracking the PING payload: + // We reset cc.pendingResets any time we receive a PING ACK. + // + // We skip this if the conn is going to be closed on idle, + // because it's short lived and will probably be closed before + // we get the ping response. + ping := false + if !closeOnIdle { + cc.mu.Lock() + // rstStreamPingsBlocked works around a gRPC behavior: + // see comment on the field for details. + if !cc.rstStreamPingsBlocked { + if cc.pendingResets == 0 { + ping = true + } + cc.pendingResets++ + } + cc.mu.Unlock() + } + cc.writeStreamReset(cs.ID, ErrCodeCancel, ping, err) } } cs.bufPipe.CloseWithError(err) // no-op if already closed } else { if cs.sentHeaders && !cs.sentEndStream { - cc.writeStreamReset(cs.ID, ErrCodeNo, nil) + cc.writeStreamReset(cs.ID, ErrCodeNo, false, nil) } cs.bufPipe.CloseWithError(errRequestCanceled) } @@ -1633,12 +1786,17 @@ func (cs *clientStream) cleanupWriteRequest(err error) { // Must hold cc.mu. func (cc *ClientConn) awaitOpenSlotForStreamLocked(cs *clientStream) error { for { - cc.lastActive = time.Now() + if cc.closed && cc.nextStreamID == 1 && cc.streamsReserved == 0 { + // This is the very first request sent to this connection. + // Return a fatal error which aborts the retry loop. + return errClientConnNotEstablished + } + cc.lastActive = cc.t.now() if cc.closed || !cc.canTakeNewRequestLocked() { return errClientConnUnusable } cc.lastIdle = time.Time{} - if int64(len(cc.streams)) < int64(cc.maxConcurrentStreams) { + if cc.currentRequestCountLocked() < int(cc.maxConcurrentStreams) { return nil } cc.pendingRequests++ @@ -1910,7 +2068,7 @@ func (cs *clientStream) awaitFlowControl(maxBytes int) (taken int32, err error) func validateHeaders(hdrs http.Header) string { for k, vv := range hdrs { - if !httpguts.ValidHeaderFieldName(k) { + if !httpguts.ValidHeaderFieldName(k) && k != ":protocol" { return fmt.Sprintf("name %q", k) } for _, v := range vv { @@ -1926,6 +2084,10 @@ func validateHeaders(hdrs http.Header) string { var errNilRequestURL = errors.New("http2: Request.URI is nil") +func isNormalConnect(req *http.Request) bool { + return req.Method == "CONNECT" && req.Header.Get(":protocol") == "" +} + // requires cc.wmu be held. func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trailers string, contentLength int64) ([]byte, error) { cc.hbuf.Reset() @@ -1946,7 +2108,7 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail } var path string - if req.Method != "CONNECT" { + if !isNormalConnect(req) { path = req.URL.RequestURI() if !validPseudoPath(path) { orig := path @@ -1983,7 +2145,7 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail m = http.MethodGet } f(":method", m) - if req.Method != "CONNECT" { + if !isNormalConnect(req) { f(":path", path) f(":scheme", req.URL.Scheme) } @@ -2180,10 +2342,10 @@ func (cc *ClientConn) forgetStreamID(id uint32) { if len(cc.streams) != slen-1 { panic("forgetting unknown stream id") } - cc.lastActive = time.Now() + cc.lastActive = cc.t.now() if len(cc.streams) == 0 && cc.idleTimer != nil { cc.idleTimer.Reset(cc.idleTimeout) - cc.lastIdle = time.Now() + cc.lastIdle = cc.t.now() } // Wake up writeRequestBody via clientStream.awaitFlowControl and // wake up RoundTrip if there is a pending request. @@ -2243,7 +2405,6 @@ func isEOFOrNetReadError(err error) bool { func (rl *clientConnReadLoop) cleanup() { cc := rl.cc - cc.t.connPool().MarkDead(cc) defer cc.closeConn() defer close(cc.readerDone) @@ -2267,6 +2428,24 @@ func (rl *clientConnReadLoop) cleanup() { } cc.closed = true + // If the connection has never been used, and has been open for only a short time, + // leave it in the connection pool for a little while. + // + // This avoids a situation where new connections are constantly created, + // added to the pool, fail, and are removed from the pool, without any error + // being surfaced to the user. + const unusedWaitTime = 5 * time.Second + idleTime := cc.t.now().Sub(cc.lastActive) + if atomic.LoadUint32(&cc.atomicReused) == 0 && idleTime < unusedWaitTime { + cc.idleTimer = cc.t.afterFunc(unusedWaitTime-idleTime, func() { + cc.t.connPool().MarkDead(cc) + }) + } else { + cc.mu.Unlock() // avoid any deadlocks in MarkDead + cc.t.connPool().MarkDead(cc) + cc.mu.Lock() + } + for _, cs := range cc.streams { select { case <-cs.peerClosed: @@ -2324,7 +2503,7 @@ func (rl *clientConnReadLoop) run() error { cc.vlogf("http2: Transport readFrame error on conn %p: (%T) %v", cc, err, err) } if se, ok := err.(StreamError); ok { - if cs := rl.streamByID(se.StreamID); cs != nil { + if cs := rl.streamByID(se.StreamID, notHeaderOrDataFrame); cs != nil { if se.Cause == nil { se.Cause = cc.fr.errDetail } @@ -2370,13 +2549,16 @@ func (rl *clientConnReadLoop) run() error { if VerboseLogs { cc.vlogf("http2: Transport conn %p received error from processing frame %v: %v", cc, summarizeFrame(f), err) } + if !cc.seenSettings { + close(cc.seenSettingsChan) + } return err } } } func (rl *clientConnReadLoop) processHeaders(f *MetaHeadersFrame) error { - cs := rl.streamByID(f.StreamID) + cs := rl.streamByID(f.StreamID, headerOrDataFrame) if cs == nil { // We'd get here if we canceled a request while the // server had its response still in flight. So if this @@ -2494,15 +2676,34 @@ func (rl *clientConnReadLoop) handleResponse(cs *clientStream, f *MetaHeadersFra if f.StreamEnded() { return nil, errors.New("1xx informational response with END_STREAM flag") } - cs.num1xx++ - const max1xxResponses = 5 // arbitrary bound on number of informational responses, same as net/http - if cs.num1xx > max1xxResponses { - return nil, errors.New("http2: too many 1xx informational responses") - } if fn := cs.get1xxTraceFunc(); fn != nil { + // If the 1xx response is being delivered to the user, + // then they're responsible for limiting the number + // of responses. if err := fn(statusCode, textproto.MIMEHeader(header)); err != nil { return nil, err } + } else { + // If the user didn't examine the 1xx response, then we + // limit the size of all 1xx headers. + // + // This differs a bit from the HTTP/1 implementation, which + // limits the size of all 1xx headers plus the final response. + // Use the larger limit of MaxHeaderListSize and + // net/http.Transport.MaxResponseHeaderBytes. + limit := int64(cs.cc.t.maxHeaderListSize()) + if t1 := cs.cc.t.t1; t1 != nil && t1.MaxResponseHeaderBytes > limit { + limit = t1.MaxResponseHeaderBytes + } + for _, h := range f.Fields { + cs.totalHeaderSize += int64(h.Size()) + } + if cs.totalHeaderSize > limit { + if VerboseLogs { + log.Printf("http2: 1xx informational responses too large") + } + return nil, errors.New("header list too large") + } } if statusCode == 100 { traceGot100Continue(cs.trace) @@ -2686,7 +2887,7 @@ func (b transportResponseBody) Close() error { func (rl *clientConnReadLoop) processData(f *DataFrame) error { cc := rl.cc - cs := rl.streamByID(f.StreamID) + cs := rl.streamByID(f.StreamID, headerOrDataFrame) data := f.Data() if cs == nil { cc.mu.Lock() @@ -2821,9 +3022,22 @@ func (rl *clientConnReadLoop) endStreamError(cs *clientStream, err error) { cs.abortStream(err) } -func (rl *clientConnReadLoop) streamByID(id uint32) *clientStream { +// Constants passed to streamByID for documentation purposes. +const ( + headerOrDataFrame = true + notHeaderOrDataFrame = false +) + +// streamByID returns the stream with the given id, or nil if no stream has that id. +// If headerOrData is true, it clears rst.StreamPingsBlocked. +func (rl *clientConnReadLoop) streamByID(id uint32, headerOrData bool) *clientStream { rl.cc.mu.Lock() defer rl.cc.mu.Unlock() + if headerOrData { + // Work around an unfortunate gRPC behavior. + // See comment on ClientConn.rstStreamPingsBlocked for details. + rl.cc.rstStreamPingsBlocked = false + } cs := rl.cc.streams[id] if cs != nil && !cs.readAborted { return cs @@ -2917,6 +3131,21 @@ func (rl *clientConnReadLoop) processSettingsNoWrite(f *SettingsFrame) error { case SettingHeaderTableSize: cc.henc.SetMaxDynamicTableSize(s.Val) cc.peerMaxHeaderTableSize = s.Val + case SettingEnableConnectProtocol: + if err := s.Valid(); err != nil { + return err + } + // If the peer wants to send us SETTINGS_ENABLE_CONNECT_PROTOCOL, + // we require that it do so in the first SETTINGS frame. + // + // When we attempt to use extended CONNECT, we wait for the first + // SETTINGS frame to see if the server supports it. If we let the + // server enable the feature with a later SETTINGS frame, then + // users will see inconsistent results depending on whether we've + // seen that frame or not. + if !cc.seenSettings { + cc.extendedConnectAllowed = s.Val == 1 + } default: cc.vlogf("Unhandled Setting: %v", s) } @@ -2934,6 +3163,7 @@ func (rl *clientConnReadLoop) processSettingsNoWrite(f *SettingsFrame) error { // connection can establish to our default. cc.maxConcurrentStreams = defaultMaxConcurrentStreams } + close(cc.seenSettingsChan) cc.seenSettings = true } @@ -2942,7 +3172,7 @@ func (rl *clientConnReadLoop) processSettingsNoWrite(f *SettingsFrame) error { func (rl *clientConnReadLoop) processWindowUpdate(f *WindowUpdateFrame) error { cc := rl.cc - cs := rl.streamByID(f.StreamID) + cs := rl.streamByID(f.StreamID, notHeaderOrDataFrame) if f.StreamID != 0 && cs == nil { return nil } @@ -2971,7 +3201,7 @@ func (rl *clientConnReadLoop) processWindowUpdate(f *WindowUpdateFrame) error { } func (rl *clientConnReadLoop) processResetStream(f *RSTStreamFrame) error { - cs := rl.streamByID(f.StreamID) + cs := rl.streamByID(f.StreamID, notHeaderOrDataFrame) if cs == nil { // TODO: return error if server tries to RST_STREAM an idle stream return nil @@ -3046,6 +3276,12 @@ func (rl *clientConnReadLoop) processPing(f *PingFrame) error { close(c) delete(cc.pings, f.Data) } + if cc.pendingResets > 0 { + // See clientStream.cleanupWriteRequest. + cc.pendingResets = 0 + cc.rstStreamPingsBlocked = true + cc.cond.Broadcast() + } return nil } cc := rl.cc @@ -3068,13 +3304,20 @@ func (rl *clientConnReadLoop) processPushPromise(f *PushPromiseFrame) error { return ConnectionError(ErrCodeProtocol) } -func (cc *ClientConn) writeStreamReset(streamID uint32, code ErrCode, err error) { +// writeStreamReset sends a RST_STREAM frame. +// When ping is true, it also sends a PING frame with a random payload. +func (cc *ClientConn) writeStreamReset(streamID uint32, code ErrCode, ping bool, err error) { // TODO: map err to more interesting error codes, once the // HTTP community comes up with some. But currently for // RST_STREAM there's no equivalent to GOAWAY frame's debug // data, and the error codes are all pretty vague ("cancel"). cc.wmu.Lock() cc.fr.WriteRSTStream(streamID, code) + if ping { + var payload [8]byte + rand.Read(payload[:]) + cc.fr.WritePing(false, payload) + } cc.bw.Flush() cc.wmu.Unlock() } @@ -3228,7 +3471,7 @@ func traceGotConn(req *http.Request, cc *ClientConn, reused bool) { cc.mu.Lock() ci.WasIdle = len(cc.streams) == 0 && reused if ci.WasIdle && !cc.lastActive.IsZero() { - ci.IdleTime = time.Since(cc.lastActive) + ci.IdleTime = cc.t.timeSince(cc.lastActive) } cc.mu.Unlock() diff --git a/vendor/golang.org/x/net/http2/unencrypted.go b/vendor/golang.org/x/net/http2/unencrypted.go new file mode 100644 index 0000000000..b2de211613 --- /dev/null +++ b/vendor/golang.org/x/net/http2/unencrypted.go @@ -0,0 +1,32 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package http2 + +import ( + "crypto/tls" + "errors" + "net" +) + +const nextProtoUnencryptedHTTP2 = "unencrypted_http2" + +// unencryptedNetConnFromTLSConn retrieves a net.Conn wrapped in a *tls.Conn. +// +// TLSNextProto functions accept a *tls.Conn. +// +// When passing an unencrypted HTTP/2 connection to a TLSNextProto function, +// we pass a *tls.Conn with an underlying net.Conn containing the unencrypted connection. +// To be extra careful about mistakes (accidentally dropping TLS encryption in a place +// where we want it), the tls.Conn contains a net.Conn with an UnencryptedNetConn method +// that returns the actual connection we want to use. +func unencryptedNetConnFromTLSConn(tc *tls.Conn) (net.Conn, error) { + conner, ok := tc.NetConn().(interface { + UnencryptedNetConn() net.Conn + }) + if !ok { + return nil, errors.New("http2: TLS conn unexpectedly found in unencrypted handoff") + } + return conner.UnencryptedNetConn(), nil +} diff --git a/vendor/golang.org/x/net/internal/socket/zsys_openbsd_ppc64.go b/vendor/golang.org/x/net/internal/socket/zsys_openbsd_ppc64.go index cebde7634f..3c9576e2d8 100644 --- a/vendor/golang.org/x/net/internal/socket/zsys_openbsd_ppc64.go +++ b/vendor/golang.org/x/net/internal/socket/zsys_openbsd_ppc64.go @@ -4,27 +4,27 @@ package socket type iovec struct { - Base *byte - Len uint64 + Base *byte + Len uint64 } type msghdr struct { - Name *byte - Namelen uint32 - Iov *iovec - Iovlen uint32 - Control *byte - Controllen uint32 - Flags int32 + Name *byte + Namelen uint32 + Iov *iovec + Iovlen uint32 + Control *byte + Controllen uint32 + Flags int32 } type cmsghdr struct { - Len uint32 - Level int32 - Type int32 + Len uint32 + Level int32 + Type int32 } const ( - sizeofIovec = 0x10 - sizeofMsghdr = 0x30 + sizeofIovec = 0x10 + sizeofMsghdr = 0x30 ) diff --git a/vendor/golang.org/x/net/internal/socket/zsys_openbsd_riscv64.go b/vendor/golang.org/x/net/internal/socket/zsys_openbsd_riscv64.go index cebde7634f..3c9576e2d8 100644 --- a/vendor/golang.org/x/net/internal/socket/zsys_openbsd_riscv64.go +++ b/vendor/golang.org/x/net/internal/socket/zsys_openbsd_riscv64.go @@ -4,27 +4,27 @@ package socket type iovec struct { - Base *byte - Len uint64 + Base *byte + Len uint64 } type msghdr struct { - Name *byte - Namelen uint32 - Iov *iovec - Iovlen uint32 - Control *byte - Controllen uint32 - Flags int32 + Name *byte + Namelen uint32 + Iov *iovec + Iovlen uint32 + Control *byte + Controllen uint32 + Flags int32 } type cmsghdr struct { - Len uint32 - Level int32 - Type int32 + Len uint32 + Level int32 + Type int32 } const ( - sizeofIovec = 0x10 - sizeofMsghdr = 0x30 + sizeofIovec = 0x10 + sizeofMsghdr = 0x30 ) diff --git a/vendor/golang.org/x/sys/cpu/asm_darwin_x86_gc.s b/vendor/golang.org/x/sys/cpu/asm_darwin_x86_gc.s new file mode 100644 index 0000000000..ec2acfe540 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/asm_darwin_x86_gc.s @@ -0,0 +1,17 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build darwin && amd64 && gc + +#include "textflag.h" + +TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sysctl(SB) +GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) + +TEXT libc_sysctlbyname_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sysctlbyname(SB) +GLOBL ·libc_sysctlbyname_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sysctlbyname_trampoline_addr(SB)/8, $libc_sysctlbyname_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/cpu/cpu_darwin_x86.go b/vendor/golang.org/x/sys/cpu/cpu_darwin_x86.go new file mode 100644 index 0000000000..b838cb9e95 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_darwin_x86.go @@ -0,0 +1,61 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build darwin && amd64 && gc + +package cpu + +// darwinSupportsAVX512 checks Darwin kernel for AVX512 support via sysctl +// call (see issue 43089). It also restricts AVX512 support for Darwin to +// kernel version 21.3.0 (MacOS 12.2.0) or later (see issue 49233). +// +// Background: +// Darwin implements a special mechanism to economize on thread state when +// AVX512 specific registers are not in use. This scheme minimizes state when +// preempting threads that haven't yet used any AVX512 instructions, but adds +// special requirements to check for AVX512 hardware support at runtime (e.g. +// via sysctl call or commpage inspection). See issue 43089 and link below for +// full background: +// https://github.com/apple-oss-distributions/xnu/blob/xnu-11215.1.10/osfmk/i386/fpu.c#L214-L240 +// +// Additionally, all versions of the Darwin kernel from 19.6.0 through 21.2.0 +// (corresponding to MacOS 10.15.6 - 12.1) have a bug that can cause corruption +// of the AVX512 mask registers (K0-K7) upon signal return. For this reason +// AVX512 is considered unsafe to use on Darwin for kernel versions prior to +// 21.3.0, where a fix has been confirmed. See issue 49233 for full background. +func darwinSupportsAVX512() bool { + return darwinSysctlEnabled([]byte("hw.optional.avx512f\x00")) && darwinKernelVersionCheck(21, 3, 0) +} + +// Ensure Darwin kernel version is at least major.minor.patch, avoiding dependencies +func darwinKernelVersionCheck(major, minor, patch int) bool { + var release [256]byte + err := darwinOSRelease(&release) + if err != nil { + return false + } + + var mmp [3]int + c := 0 +Loop: + for _, b := range release[:] { + switch { + case b >= '0' && b <= '9': + mmp[c] = 10*mmp[c] + int(b-'0') + case b == '.': + c++ + if c > 2 { + return false + } + case b == 0: + break Loop + default: + return false + } + } + if c != 2 { + return false + } + return mmp[0] > major || mmp[0] == major && (mmp[1] > minor || mmp[1] == minor && mmp[2] >= patch) +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go index 910728fb16..32a44514e2 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go +++ b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go @@ -6,10 +6,10 @@ package cpu -// cpuid is implemented in cpu_x86.s for gc compiler +// cpuid is implemented in cpu_gc_x86.s for gc compiler // and in cpu_gccgo.c for gccgo. func cpuid(eaxArg, ecxArg uint32) (eax, ebx, ecx, edx uint32) -// xgetbv with ecx = 0 is implemented in cpu_x86.s for gc compiler +// xgetbv with ecx = 0 is implemented in cpu_gc_x86.s for gc compiler // and in cpu_gccgo.c for gccgo. func xgetbv() (eax, edx uint32) diff --git a/vendor/golang.org/x/sys/cpu/cpu_x86.s b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.s similarity index 94% rename from vendor/golang.org/x/sys/cpu/cpu_x86.s rename to vendor/golang.org/x/sys/cpu/cpu_gc_x86.s index 7d7ba33efb..ce208ce6d6 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_x86.s +++ b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.s @@ -18,7 +18,7 @@ TEXT ·cpuid(SB), NOSPLIT, $0-24 RET // func xgetbv() (eax, edx uint32) -TEXT ·xgetbv(SB),NOSPLIT,$0-8 +TEXT ·xgetbv(SB), NOSPLIT, $0-8 MOVL $0, CX XGETBV MOVL AX, eax+0(FP) diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go index 99c60fe9f9..170d21ddfd 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go +++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go @@ -23,9 +23,3 @@ func xgetbv() (eax, edx uint32) { gccgoXgetbv(&a, &d) return a, d } - -// gccgo doesn't build on Darwin, per: -// https://github.com/Homebrew/homebrew-core/blob/HEAD/Formula/gcc.rb#L76 -func darwinSupportsAVX512() bool { - return false -} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_linux_arm64.go index 08f35ea177..f1caf0f78e 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_linux_arm64.go +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_arm64.go @@ -110,7 +110,6 @@ func doinit() { ARM64.HasASIMDFHM = isSet(hwCap, hwcap_ASIMDFHM) ARM64.HasDIT = isSet(hwCap, hwcap_DIT) - // HWCAP2 feature bits ARM64.HasSVE2 = isSet(hwCap2, hwcap2_SVE2) ARM64.HasI8MM = isSet(hwCap2, hwcap2_I8MM) diff --git a/vendor/golang.org/x/tools/internal/versions/constraint_go121.go b/vendor/golang.org/x/sys/cpu/cpu_other_x86.go similarity index 50% rename from vendor/golang.org/x/tools/internal/versions/constraint_go121.go rename to vendor/golang.org/x/sys/cpu/cpu_other_x86.go index 38011407d5..a0fd7e2f75 100644 --- a/vendor/golang.org/x/tools/internal/versions/constraint_go121.go +++ b/vendor/golang.org/x/sys/cpu/cpu_other_x86.go @@ -2,13 +2,10 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build go1.21 -// +build go1.21 +//go:build 386 || amd64p32 || (amd64 && (!darwin || !gc)) -package versions +package cpu -import "go/build/constraint" - -func init() { - ConstraintGoVersion = constraint.GoVersion +func darwinSupportsAVX512() bool { + panic("only implemented for gc && amd64 && darwin") } diff --git a/vendor/golang.org/x/sys/cpu/cpu_x86.go b/vendor/golang.org/x/sys/cpu/cpu_x86.go index c29f5e4c5a..600a680786 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_x86.go +++ b/vendor/golang.org/x/sys/cpu/cpu_x86.go @@ -92,10 +92,8 @@ func archInit() { osSupportsAVX = isSet(1, eax) && isSet(2, eax) if runtime.GOOS == "darwin" { - // Darwin doesn't save/restore AVX-512 mask registers correctly across signal handlers. - // Since users can't rely on mask register contents, let's not advertise AVX-512 support. - // See issue 49233. - osSupportsAVX512 = false + // Darwin requires special AVX512 checks, see cpu_darwin_x86.go + osSupportsAVX512 = osSupportsAVX && darwinSupportsAVX512() } else { // Check if OPMASK and ZMM registers have OS support. osSupportsAVX512 = osSupportsAVX && isSet(5, eax) && isSet(6, eax) && isSet(7, eax) diff --git a/vendor/golang.org/x/sys/cpu/syscall_darwin_x86_gc.go b/vendor/golang.org/x/sys/cpu/syscall_darwin_x86_gc.go new file mode 100644 index 0000000000..4d0888b0c0 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/syscall_darwin_x86_gc.go @@ -0,0 +1,98 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Minimal copy of x/sys/unix so the cpu package can make a +// system call on Darwin without depending on x/sys/unix. + +//go:build darwin && amd64 && gc + +package cpu + +import ( + "syscall" + "unsafe" +) + +type _C_int int32 + +// adapted from unix.Uname() at x/sys/unix/syscall_darwin.go L419 +func darwinOSRelease(release *[256]byte) error { + // from x/sys/unix/zerrors_openbsd_amd64.go + const ( + CTL_KERN = 0x1 + KERN_OSRELEASE = 0x2 + ) + + mib := []_C_int{CTL_KERN, KERN_OSRELEASE} + n := unsafe.Sizeof(*release) + + return sysctl(mib, &release[0], &n, nil, 0) +} + +type Errno = syscall.Errno + +var _zero uintptr // Single-word zero for use when we need a valid pointer to 0 bytes. + +// from x/sys/unix/zsyscall_darwin_amd64.go L791-807 +func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) error { + var _p0 unsafe.Pointer + if len(mib) > 0 { + _p0 = unsafe.Pointer(&mib[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + if _, _, err := syscall_syscall6( + libc_sysctl_trampoline_addr, + uintptr(_p0), + uintptr(len(mib)), + uintptr(unsafe.Pointer(old)), + uintptr(unsafe.Pointer(oldlen)), + uintptr(unsafe.Pointer(new)), + uintptr(newlen), + ); err != 0 { + return err + } + + return nil +} + +var libc_sysctl_trampoline_addr uintptr + +// adapted from internal/cpu/cpu_arm64_darwin.go +func darwinSysctlEnabled(name []byte) bool { + out := int32(0) + nout := unsafe.Sizeof(out) + if ret := sysctlbyname(&name[0], (*byte)(unsafe.Pointer(&out)), &nout, nil, 0); ret != nil { + return false + } + return out > 0 +} + +//go:cgo_import_dynamic libc_sysctl sysctl "/usr/lib/libSystem.B.dylib" + +var libc_sysctlbyname_trampoline_addr uintptr + +// adapted from runtime/sys_darwin.go in the pattern of sysctl() above, as defined in x/sys/unix +func sysctlbyname(name *byte, old *byte, oldlen *uintptr, new *byte, newlen uintptr) error { + if _, _, err := syscall_syscall6( + libc_sysctlbyname_trampoline_addr, + uintptr(unsafe.Pointer(name)), + uintptr(unsafe.Pointer(old)), + uintptr(unsafe.Pointer(oldlen)), + uintptr(unsafe.Pointer(new)), + uintptr(newlen), + 0, + ); err != 0 { + return err + } + + return nil +} + +//go:cgo_import_dynamic libc_sysctlbyname sysctlbyname "/usr/lib/libSystem.B.dylib" + +// Implemented in the runtime package (runtime/sys_darwin.go) +func syscall_syscall6(fn, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2 uintptr, err Errno) + +//go:linkname syscall_syscall6 syscall.syscall6 diff --git a/vendor/golang.org/x/sys/unix/ioctl_linux.go b/vendor/golang.org/x/sys/unix/ioctl_linux.go index dbe680eab8..7ca4fa12aa 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_linux.go +++ b/vendor/golang.org/x/sys/unix/ioctl_linux.go @@ -58,6 +58,102 @@ func IoctlGetEthtoolDrvinfo(fd int, ifname string) (*EthtoolDrvinfo, error) { return &value, err } +// IoctlGetEthtoolTsInfo fetches ethtool timestamping and PHC +// association for the network device specified by ifname. +func IoctlGetEthtoolTsInfo(fd int, ifname string) (*EthtoolTsInfo, error) { + ifr, err := NewIfreq(ifname) + if err != nil { + return nil, err + } + + value := EthtoolTsInfo{Cmd: ETHTOOL_GET_TS_INFO} + ifrd := ifr.withData(unsafe.Pointer(&value)) + + err = ioctlIfreqData(fd, SIOCETHTOOL, &ifrd) + return &value, err +} + +// IoctlGetHwTstamp retrieves the hardware timestamping configuration +// for the network device specified by ifname. +func IoctlGetHwTstamp(fd int, ifname string) (*HwTstampConfig, error) { + ifr, err := NewIfreq(ifname) + if err != nil { + return nil, err + } + + value := HwTstampConfig{} + ifrd := ifr.withData(unsafe.Pointer(&value)) + + err = ioctlIfreqData(fd, SIOCGHWTSTAMP, &ifrd) + return &value, err +} + +// IoctlSetHwTstamp updates the hardware timestamping configuration for +// the network device specified by ifname. +func IoctlSetHwTstamp(fd int, ifname string, cfg *HwTstampConfig) error { + ifr, err := NewIfreq(ifname) + if err != nil { + return err + } + ifrd := ifr.withData(unsafe.Pointer(cfg)) + return ioctlIfreqData(fd, SIOCSHWTSTAMP, &ifrd) +} + +// FdToClockID derives the clock ID from the file descriptor number +// - see clock_gettime(3), FD_TO_CLOCKID macros. The resulting ID is +// suitable for system calls like ClockGettime. +func FdToClockID(fd int) int32 { return int32((int(^fd) << 3) | 3) } + +// IoctlPtpClockGetcaps returns the description of a given PTP device. +func IoctlPtpClockGetcaps(fd int) (*PtpClockCaps, error) { + var value PtpClockCaps + err := ioctlPtr(fd, PTP_CLOCK_GETCAPS2, unsafe.Pointer(&value)) + return &value, err +} + +// IoctlPtpSysOffsetPrecise returns a description of the clock +// offset compared to the system clock. +func IoctlPtpSysOffsetPrecise(fd int) (*PtpSysOffsetPrecise, error) { + var value PtpSysOffsetPrecise + err := ioctlPtr(fd, PTP_SYS_OFFSET_PRECISE2, unsafe.Pointer(&value)) + return &value, err +} + +// IoctlPtpSysOffsetExtended returns an extended description of the +// clock offset compared to the system clock. The samples parameter +// specifies the desired number of measurements. +func IoctlPtpSysOffsetExtended(fd int, samples uint) (*PtpSysOffsetExtended, error) { + value := PtpSysOffsetExtended{Samples: uint32(samples)} + err := ioctlPtr(fd, PTP_SYS_OFFSET_EXTENDED2, unsafe.Pointer(&value)) + return &value, err +} + +// IoctlPtpPinGetfunc returns the configuration of the specified +// I/O pin on given PTP device. +func IoctlPtpPinGetfunc(fd int, index uint) (*PtpPinDesc, error) { + value := PtpPinDesc{Index: uint32(index)} + err := ioctlPtr(fd, PTP_PIN_GETFUNC2, unsafe.Pointer(&value)) + return &value, err +} + +// IoctlPtpPinSetfunc updates configuration of the specified PTP +// I/O pin. +func IoctlPtpPinSetfunc(fd int, pd *PtpPinDesc) error { + return ioctlPtr(fd, PTP_PIN_SETFUNC2, unsafe.Pointer(pd)) +} + +// IoctlPtpPeroutRequest configures the periodic output mode of the +// PTP I/O pins. +func IoctlPtpPeroutRequest(fd int, r *PtpPeroutRequest) error { + return ioctlPtr(fd, PTP_PEROUT_REQUEST2, unsafe.Pointer(r)) +} + +// IoctlPtpExttsRequest configures the external timestamping mode +// of the PTP I/O pins. +func IoctlPtpExttsRequest(fd int, r *PtpExttsRequest) error { + return ioctlPtr(fd, PTP_EXTTS_REQUEST2, unsafe.Pointer(r)) +} + // IoctlGetWatchdogInfo fetches information about a watchdog device from the // Linux watchdog API. For more information, see: // https://www.kernel.org/doc/html/latest/watchdog/watchdog-api.html. diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index ac54ecaba0..6ab02b6c31 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -158,6 +158,16 @@ includes_Linux=' #endif #define _GNU_SOURCE +// See the description in unix/linux/types.go +#if defined(__ARM_EABI__) || \ + (defined(__mips__) && (_MIPS_SIM == _ABIO32)) || \ + (defined(__powerpc__) && (!defined(__powerpc64__))) +# ifdef _TIME_BITS +# undef _TIME_BITS +# endif +# define _TIME_BITS 32 +#endif + // is broken on powerpc64, as it fails to include definitions of // these structures. We just include them copied from . #if defined(__powerpc__) @@ -256,6 +266,7 @@ struct ltchars { #include #include #include +#include #include #include #include @@ -527,6 +538,7 @@ ccflags="$@" $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MREMAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || $2 ~ /^NFC_(GENL|PROTO|COMM|RF|SE|DIRECTION|LLCP|SOCKPROTO)_/ || $2 ~ /^NFC_.*_(MAX)?SIZE$/ || + $2 ~ /^PTP_/ || $2 ~ /^RAW_PAYLOAD_/ || $2 ~ /^[US]F_/ || $2 ~ /^TP_STATUS_/ || diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index f08abd434f..230a94549a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -1860,6 +1860,7 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys ClockAdjtime(clockid int32, buf *Timex) (state int, err error) //sys ClockGetres(clockid int32, res *Timespec) (err error) //sys ClockGettime(clockid int32, time *Timespec) (err error) +//sys ClockSettime(clockid int32, time *Timespec) (err error) //sys ClockNanosleep(clockid int32, flags int, request *Timespec, remain *Timespec) (err error) //sys Close(fd int) (err error) //sys CloseRange(first uint, last uint, flags uint) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go index 312ae6ac1d..7bf5c04bb0 100644 --- a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go @@ -768,6 +768,15 @@ func Munmap(b []byte) (err error) { return mapper.Munmap(b) } +func MmapPtr(fd int, offset int64, addr unsafe.Pointer, length uintptr, prot int, flags int) (ret unsafe.Pointer, err error) { + xaddr, err := mapper.mmap(uintptr(addr), length, prot, flags, fd, offset) + return unsafe.Pointer(xaddr), err +} + +func MunmapPtr(addr unsafe.Pointer, length uintptr) (err error) { + return mapper.munmap(uintptr(addr), length) +} + //sys Gethostname(buf []byte) (err error) = SYS___GETHOSTNAME_A //sysnb Getgid() (gid int) //sysnb Getpid() (pid int) @@ -816,10 +825,10 @@ func Lstat(path string, stat *Stat_t) (err error) { // for checking symlinks begins with $VERSION/ $SYSNAME/ $SYSSYMR/ $SYSSYMA/ func isSpecialPath(path []byte) (v bool) { var special = [4][8]byte{ - [8]byte{'V', 'E', 'R', 'S', 'I', 'O', 'N', '/'}, - [8]byte{'S', 'Y', 'S', 'N', 'A', 'M', 'E', '/'}, - [8]byte{'S', 'Y', 'S', 'S', 'Y', 'M', 'R', '/'}, - [8]byte{'S', 'Y', 'S', 'S', 'Y', 'M', 'A', '/'}} + {'V', 'E', 'R', 'S', 'I', 'O', 'N', '/'}, + {'S', 'Y', 'S', 'N', 'A', 'M', 'E', '/'}, + {'S', 'Y', 'S', 'S', 'Y', 'M', 'R', '/'}, + {'S', 'Y', 'S', 'S', 'Y', 'M', 'A', '/'}} var i, j int for i = 0; i < len(special); i++ { @@ -3115,3 +3124,90 @@ func legacy_Mkfifoat(dirfd int, path string, mode uint32) (err error) { //sys Posix_openpt(oflag int) (fd int, err error) = SYS_POSIX_OPENPT //sys Grantpt(fildes int) (rc int, err error) = SYS_GRANTPT //sys Unlockpt(fildes int) (rc int, err error) = SYS_UNLOCKPT + +func fcntlAsIs(fd uintptr, cmd int, arg uintptr) (val int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FCNTL<<4, uintptr(fd), uintptr(cmd), arg) + runtime.ExitSyscall() + val = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +func Fcntl(fd uintptr, cmd int, op interface{}) (ret int, err error) { + switch op.(type) { + case *Flock_t: + err = FcntlFlock(fd, cmd, op.(*Flock_t)) + if err != nil { + ret = -1 + } + return + case int: + return FcntlInt(fd, cmd, op.(int)) + case *F_cnvrt: + return fcntlAsIs(fd, cmd, uintptr(unsafe.Pointer(op.(*F_cnvrt)))) + case unsafe.Pointer: + return fcntlAsIs(fd, cmd, uintptr(op.(unsafe.Pointer))) + default: + return -1, EINVAL + } + return +} + +func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) { + if raceenabled { + raceReleaseMerge(unsafe.Pointer(&ioSync)) + } + return sendfile(outfd, infd, offset, count) +} + +func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) { + // TODO: use LE call instead if the call is implemented + originalOffset, err := Seek(infd, 0, SEEK_CUR) + if err != nil { + return -1, err + } + //start reading data from in_fd + if offset != nil { + _, err := Seek(infd, *offset, SEEK_SET) + if err != nil { + return -1, err + } + } + + buf := make([]byte, count) + readBuf := make([]byte, 0) + var n int = 0 + for i := 0; i < count; i += n { + n, err := Read(infd, buf) + if n == 0 { + if err != nil { + return -1, err + } else { // EOF + break + } + } + readBuf = append(readBuf, buf...) + buf = buf[0:0] + } + + n2, err := Write(outfd, readBuf) + if err != nil { + return -1, err + } + + //When sendfile() returns, this variable will be set to the + // offset of the byte following the last byte that was read. + if offset != nil { + *offset = *offset + int64(n) + // If offset is not NULL, then sendfile() does not modify the file + // offset of in_fd + _, err := Seek(infd, originalOffset, SEEK_SET) + if err != nil { + return -1, err + } + } + return n2, nil +} diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index de3b462489..6ebc48b3fe 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -321,6 +321,9 @@ const ( AUDIT_INTEGRITY_STATUS = 0x70a AUDIT_IPC = 0x517 AUDIT_IPC_SET_PERM = 0x51f + AUDIT_IPE_ACCESS = 0x58c + AUDIT_IPE_CONFIG_CHANGE = 0x58d + AUDIT_IPE_POLICY_LOAD = 0x58e AUDIT_KERNEL = 0x7d0 AUDIT_KERNEL_OTHER = 0x524 AUDIT_KERN_MODULE = 0x532 @@ -489,6 +492,7 @@ const ( BPF_F_ID = 0x20 BPF_F_NETFILTER_IP_DEFRAG = 0x1 BPF_F_QUERY_EFFECTIVE = 0x1 + BPF_F_REDIRECT_FLAGS = 0x19 BPF_F_REPLACE = 0x4 BPF_F_SLEEPABLE = 0x10 BPF_F_STRICT_ALIGNMENT = 0x1 @@ -1166,6 +1170,7 @@ const ( EXTA = 0xe EXTB = 0xf F2FS_SUPER_MAGIC = 0xf2f52010 + FALLOC_FL_ALLOCATE_RANGE = 0x0 FALLOC_FL_COLLAPSE_RANGE = 0x8 FALLOC_FL_INSERT_RANGE = 0x20 FALLOC_FL_KEEP_SIZE = 0x1 @@ -1799,6 +1804,8 @@ const ( LANDLOCK_ACCESS_NET_BIND_TCP = 0x1 LANDLOCK_ACCESS_NET_CONNECT_TCP = 0x2 LANDLOCK_CREATE_RULESET_VERSION = 0x1 + LANDLOCK_SCOPE_ABSTRACT_UNIX_SOCKET = 0x1 + LANDLOCK_SCOPE_SIGNAL = 0x2 LINUX_REBOOT_CMD_CAD_OFF = 0x0 LINUX_REBOOT_CMD_CAD_ON = 0x89abcdef LINUX_REBOOT_CMD_HALT = 0xcdef0123 @@ -1924,6 +1931,7 @@ const ( MNT_FORCE = 0x1 MNT_ID_REQ_SIZE_VER0 = 0x18 MNT_ID_REQ_SIZE_VER1 = 0x20 + MNT_NS_INFO_SIZE_VER0 = 0x10 MODULE_INIT_COMPRESSED_FILE = 0x4 MODULE_INIT_IGNORE_MODVERSIONS = 0x1 MODULE_INIT_IGNORE_VERMAGIC = 0x2 @@ -2625,6 +2633,28 @@ const ( PR_UNALIGN_NOPRINT = 0x1 PR_UNALIGN_SIGBUS = 0x2 PSTOREFS_MAGIC = 0x6165676c + PTP_CLK_MAGIC = '=' + PTP_ENABLE_FEATURE = 0x1 + PTP_EXTTS_EDGES = 0x6 + PTP_EXTTS_EVENT_VALID = 0x1 + PTP_EXTTS_V1_VALID_FLAGS = 0x7 + PTP_EXTTS_VALID_FLAGS = 0x1f + PTP_EXT_OFFSET = 0x10 + PTP_FALLING_EDGE = 0x4 + PTP_MAX_SAMPLES = 0x19 + PTP_PEROUT_DUTY_CYCLE = 0x2 + PTP_PEROUT_ONE_SHOT = 0x1 + PTP_PEROUT_PHASE = 0x4 + PTP_PEROUT_V1_VALID_FLAGS = 0x0 + PTP_PEROUT_VALID_FLAGS = 0x7 + PTP_PIN_GETFUNC = 0xc0603d06 + PTP_PIN_GETFUNC2 = 0xc0603d0f + PTP_RISING_EDGE = 0x2 + PTP_STRICT_FLAGS = 0x8 + PTP_SYS_OFFSET_EXTENDED = 0xc4c03d09 + PTP_SYS_OFFSET_EXTENDED2 = 0xc4c03d12 + PTP_SYS_OFFSET_PRECISE = 0xc0403d08 + PTP_SYS_OFFSET_PRECISE2 = 0xc0403d11 PTRACE_ATTACH = 0x10 PTRACE_CONT = 0x7 PTRACE_DETACH = 0x11 @@ -2948,6 +2978,7 @@ const ( RWF_WRITE_LIFE_NOT_SET = 0x0 SCHED_BATCH = 0x3 SCHED_DEADLINE = 0x6 + SCHED_EXT = 0x7 SCHED_FIFO = 0x1 SCHED_FLAG_ALL = 0x7f SCHED_FLAG_DL_OVERRUN = 0x4 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go index 8aa6d77c01..c0d45e3205 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go @@ -109,6 +109,7 @@ const ( HIDIOCGRAWINFO = 0x80084803 HIDIOCGRDESC = 0x90044802 HIDIOCGRDESCSIZE = 0x80044801 + HIDIOCREVOKE = 0x4004480d HUPCL = 0x400 ICANON = 0x2 IEXTEN = 0x8000 @@ -237,6 +238,20 @@ const ( PPPIOCUNBRIDGECHAN = 0x7434 PPPIOCXFERUNIT = 0x744e PR_SET_PTRACER_ANY = 0xffffffff + PTP_CLOCK_GETCAPS = 0x80503d01 + PTP_CLOCK_GETCAPS2 = 0x80503d0a + PTP_ENABLE_PPS = 0x40043d04 + PTP_ENABLE_PPS2 = 0x40043d0d + PTP_EXTTS_REQUEST = 0x40103d02 + PTP_EXTTS_REQUEST2 = 0x40103d0b + PTP_MASK_CLEAR_ALL = 0x3d13 + PTP_MASK_EN_SINGLE = 0x40043d14 + PTP_PEROUT_REQUEST = 0x40383d03 + PTP_PEROUT_REQUEST2 = 0x40383d0c + PTP_PIN_SETFUNC = 0x40603d07 + PTP_PIN_SETFUNC2 = 0x40603d10 + PTP_SYS_OFFSET = 0x43403d05 + PTP_SYS_OFFSET2 = 0x43403d0e PTRACE_GETFPREGS = 0xe PTRACE_GETFPXREGS = 0x12 PTRACE_GET_THREAD_AREA = 0x19 @@ -283,6 +298,8 @@ const ( RTC_WIE_ON = 0x700f RTC_WKALM_RD = 0x80287010 RTC_WKALM_SET = 0x4028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -321,6 +338,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x27 SO_DONTROUTE = 0x5 SO_ERROR = 0x4 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go index da428f4253..c731d24f02 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go @@ -109,6 +109,7 @@ const ( HIDIOCGRAWINFO = 0x80084803 HIDIOCGRDESC = 0x90044802 HIDIOCGRDESCSIZE = 0x80044801 + HIDIOCREVOKE = 0x4004480d HUPCL = 0x400 ICANON = 0x2 IEXTEN = 0x8000 @@ -237,6 +238,20 @@ const ( PPPIOCUNBRIDGECHAN = 0x7434 PPPIOCXFERUNIT = 0x744e PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTP_CLOCK_GETCAPS = 0x80503d01 + PTP_CLOCK_GETCAPS2 = 0x80503d0a + PTP_ENABLE_PPS = 0x40043d04 + PTP_ENABLE_PPS2 = 0x40043d0d + PTP_EXTTS_REQUEST = 0x40103d02 + PTP_EXTTS_REQUEST2 = 0x40103d0b + PTP_MASK_CLEAR_ALL = 0x3d13 + PTP_MASK_EN_SINGLE = 0x40043d14 + PTP_PEROUT_REQUEST = 0x40383d03 + PTP_PEROUT_REQUEST2 = 0x40383d0c + PTP_PIN_SETFUNC = 0x40603d07 + PTP_PIN_SETFUNC2 = 0x40603d10 + PTP_SYS_OFFSET = 0x43403d05 + PTP_SYS_OFFSET2 = 0x43403d0e PTRACE_ARCH_PRCTL = 0x1e PTRACE_GETFPREGS = 0xe PTRACE_GETFPXREGS = 0x12 @@ -284,6 +299,8 @@ const ( RTC_WIE_ON = 0x700f RTC_WKALM_RD = 0x80287010 RTC_WKALM_SET = 0x4028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -322,6 +339,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x27 SO_DONTROUTE = 0x5 SO_ERROR = 0x4 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go index bf45bfec78..680018a4a7 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go @@ -108,6 +108,7 @@ const ( HIDIOCGRAWINFO = 0x80084803 HIDIOCGRDESC = 0x90044802 HIDIOCGRDESCSIZE = 0x80044801 + HIDIOCREVOKE = 0x4004480d HUPCL = 0x400 ICANON = 0x2 IEXTEN = 0x8000 @@ -234,6 +235,20 @@ const ( PPPIOCUNBRIDGECHAN = 0x7434 PPPIOCXFERUNIT = 0x744e PR_SET_PTRACER_ANY = 0xffffffff + PTP_CLOCK_GETCAPS = 0x80503d01 + PTP_CLOCK_GETCAPS2 = 0x80503d0a + PTP_ENABLE_PPS = 0x40043d04 + PTP_ENABLE_PPS2 = 0x40043d0d + PTP_EXTTS_REQUEST = 0x40103d02 + PTP_EXTTS_REQUEST2 = 0x40103d0b + PTP_MASK_CLEAR_ALL = 0x3d13 + PTP_MASK_EN_SINGLE = 0x40043d14 + PTP_PEROUT_REQUEST = 0x40383d03 + PTP_PEROUT_REQUEST2 = 0x40383d0c + PTP_PIN_SETFUNC = 0x40603d07 + PTP_PIN_SETFUNC2 = 0x40603d10 + PTP_SYS_OFFSET = 0x43403d05 + PTP_SYS_OFFSET2 = 0x43403d0e PTRACE_GETCRUNCHREGS = 0x19 PTRACE_GETFDPIC = 0x1f PTRACE_GETFDPIC_EXEC = 0x0 @@ -289,6 +304,8 @@ const ( RTC_WIE_ON = 0x700f RTC_WKALM_RD = 0x80287010 RTC_WKALM_SET = 0x4028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -327,6 +344,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x27 SO_DONTROUTE = 0x5 SO_ERROR = 0x4 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go index 71c67162b7..a63909f308 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go @@ -112,6 +112,7 @@ const ( HIDIOCGRAWINFO = 0x80084803 HIDIOCGRDESC = 0x90044802 HIDIOCGRDESCSIZE = 0x80044801 + HIDIOCREVOKE = 0x4004480d HUPCL = 0x400 ICANON = 0x2 IEXTEN = 0x8000 @@ -205,6 +206,7 @@ const ( PERF_EVENT_IOC_SET_BPF = 0x40042408 PERF_EVENT_IOC_SET_FILTER = 0x40082406 PERF_EVENT_IOC_SET_OUTPUT = 0x2405 + POE_MAGIC = 0x504f4530 PPPIOCATTACH = 0x4004743d PPPIOCATTCHAN = 0x40047438 PPPIOCBRIDGECHAN = 0x40047435 @@ -240,6 +242,20 @@ const ( PROT_BTI = 0x10 PROT_MTE = 0x20 PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTP_CLOCK_GETCAPS = 0x80503d01 + PTP_CLOCK_GETCAPS2 = 0x80503d0a + PTP_ENABLE_PPS = 0x40043d04 + PTP_ENABLE_PPS2 = 0x40043d0d + PTP_EXTTS_REQUEST = 0x40103d02 + PTP_EXTTS_REQUEST2 = 0x40103d0b + PTP_MASK_CLEAR_ALL = 0x3d13 + PTP_MASK_EN_SINGLE = 0x40043d14 + PTP_PEROUT_REQUEST = 0x40383d03 + PTP_PEROUT_REQUEST2 = 0x40383d0c + PTP_PIN_SETFUNC = 0x40603d07 + PTP_PIN_SETFUNC2 = 0x40603d10 + PTP_SYS_OFFSET = 0x43403d05 + PTP_SYS_OFFSET2 = 0x43403d0e PTRACE_PEEKMTETAGS = 0x21 PTRACE_POKEMTETAGS = 0x22 PTRACE_SYSEMU = 0x1f @@ -280,6 +296,8 @@ const ( RTC_WIE_ON = 0x700f RTC_WKALM_RD = 0x80287010 RTC_WKALM_SET = 0x4028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -318,6 +336,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x27 SO_DONTROUTE = 0x5 SO_ERROR = 0x4 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go index 9476628fa0..9b0a2573fe 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go @@ -109,6 +109,7 @@ const ( HIDIOCGRAWINFO = 0x80084803 HIDIOCGRDESC = 0x90044802 HIDIOCGRDESCSIZE = 0x80044801 + HIDIOCREVOKE = 0x4004480d HUPCL = 0x400 ICANON = 0x2 IEXTEN = 0x8000 @@ -238,6 +239,20 @@ const ( PPPIOCUNBRIDGECHAN = 0x7434 PPPIOCXFERUNIT = 0x744e PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTP_CLOCK_GETCAPS = 0x80503d01 + PTP_CLOCK_GETCAPS2 = 0x80503d0a + PTP_ENABLE_PPS = 0x40043d04 + PTP_ENABLE_PPS2 = 0x40043d0d + PTP_EXTTS_REQUEST = 0x40103d02 + PTP_EXTTS_REQUEST2 = 0x40103d0b + PTP_MASK_CLEAR_ALL = 0x3d13 + PTP_MASK_EN_SINGLE = 0x40043d14 + PTP_PEROUT_REQUEST = 0x40383d03 + PTP_PEROUT_REQUEST2 = 0x40383d0c + PTP_PIN_SETFUNC = 0x40603d07 + PTP_PIN_SETFUNC2 = 0x40603d10 + PTP_SYS_OFFSET = 0x43403d05 + PTP_SYS_OFFSET2 = 0x43403d0e PTRACE_SYSEMU = 0x1f PTRACE_SYSEMU_SINGLESTEP = 0x20 RLIMIT_AS = 0x9 @@ -276,6 +291,8 @@ const ( RTC_WIE_ON = 0x700f RTC_WKALM_RD = 0x80287010 RTC_WKALM_SET = 0x4028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -314,6 +331,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x27 SO_DONTROUTE = 0x5 SO_ERROR = 0x4 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go index b9e85f3cf0..958e6e0645 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go @@ -108,6 +108,7 @@ const ( HIDIOCGRAWINFO = 0x40084803 HIDIOCGRDESC = 0x50044802 HIDIOCGRDESCSIZE = 0x40044801 + HIDIOCREVOKE = 0x8004480d HUPCL = 0x400 ICANON = 0x2 IEXTEN = 0x100 @@ -234,6 +235,20 @@ const ( PPPIOCUNBRIDGECHAN = 0x20007434 PPPIOCXFERUNIT = 0x2000744e PR_SET_PTRACER_ANY = 0xffffffff + PTP_CLOCK_GETCAPS = 0x40503d01 + PTP_CLOCK_GETCAPS2 = 0x40503d0a + PTP_ENABLE_PPS = 0x80043d04 + PTP_ENABLE_PPS2 = 0x80043d0d + PTP_EXTTS_REQUEST = 0x80103d02 + PTP_EXTTS_REQUEST2 = 0x80103d0b + PTP_MASK_CLEAR_ALL = 0x20003d13 + PTP_MASK_EN_SINGLE = 0x80043d14 + PTP_PEROUT_REQUEST = 0x80383d03 + PTP_PEROUT_REQUEST2 = 0x80383d0c + PTP_PIN_SETFUNC = 0x80603d07 + PTP_PIN_SETFUNC2 = 0x80603d10 + PTP_SYS_OFFSET = 0x83403d05 + PTP_SYS_OFFSET2 = 0x83403d0e PTRACE_GETFPREGS = 0xe PTRACE_GET_THREAD_AREA = 0x19 PTRACE_GET_THREAD_AREA_3264 = 0xc4 @@ -282,6 +297,8 @@ const ( RTC_WIE_ON = 0x2000700f RTC_WKALM_RD = 0x40287010 RTC_WKALM_SET = 0x8028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -320,6 +337,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x1029 SO_DONTROUTE = 0x10 SO_ERROR = 0x1007 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go index a48b68a764..50c7f25bd1 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go @@ -108,6 +108,7 @@ const ( HIDIOCGRAWINFO = 0x40084803 HIDIOCGRDESC = 0x50044802 HIDIOCGRDESCSIZE = 0x40044801 + HIDIOCREVOKE = 0x8004480d HUPCL = 0x400 ICANON = 0x2 IEXTEN = 0x100 @@ -234,6 +235,20 @@ const ( PPPIOCUNBRIDGECHAN = 0x20007434 PPPIOCXFERUNIT = 0x2000744e PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTP_CLOCK_GETCAPS = 0x40503d01 + PTP_CLOCK_GETCAPS2 = 0x40503d0a + PTP_ENABLE_PPS = 0x80043d04 + PTP_ENABLE_PPS2 = 0x80043d0d + PTP_EXTTS_REQUEST = 0x80103d02 + PTP_EXTTS_REQUEST2 = 0x80103d0b + PTP_MASK_CLEAR_ALL = 0x20003d13 + PTP_MASK_EN_SINGLE = 0x80043d14 + PTP_PEROUT_REQUEST = 0x80383d03 + PTP_PEROUT_REQUEST2 = 0x80383d0c + PTP_PIN_SETFUNC = 0x80603d07 + PTP_PIN_SETFUNC2 = 0x80603d10 + PTP_SYS_OFFSET = 0x83403d05 + PTP_SYS_OFFSET2 = 0x83403d0e PTRACE_GETFPREGS = 0xe PTRACE_GET_THREAD_AREA = 0x19 PTRACE_GET_THREAD_AREA_3264 = 0xc4 @@ -282,6 +297,8 @@ const ( RTC_WIE_ON = 0x2000700f RTC_WKALM_RD = 0x40287010 RTC_WKALM_SET = 0x8028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -320,6 +337,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x1029 SO_DONTROUTE = 0x10 SO_ERROR = 0x1007 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go index ea00e8522a..ced21d66d9 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go @@ -108,6 +108,7 @@ const ( HIDIOCGRAWINFO = 0x40084803 HIDIOCGRDESC = 0x50044802 HIDIOCGRDESCSIZE = 0x40044801 + HIDIOCREVOKE = 0x8004480d HUPCL = 0x400 ICANON = 0x2 IEXTEN = 0x100 @@ -234,6 +235,20 @@ const ( PPPIOCUNBRIDGECHAN = 0x20007434 PPPIOCXFERUNIT = 0x2000744e PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTP_CLOCK_GETCAPS = 0x40503d01 + PTP_CLOCK_GETCAPS2 = 0x40503d0a + PTP_ENABLE_PPS = 0x80043d04 + PTP_ENABLE_PPS2 = 0x80043d0d + PTP_EXTTS_REQUEST = 0x80103d02 + PTP_EXTTS_REQUEST2 = 0x80103d0b + PTP_MASK_CLEAR_ALL = 0x20003d13 + PTP_MASK_EN_SINGLE = 0x80043d14 + PTP_PEROUT_REQUEST = 0x80383d03 + PTP_PEROUT_REQUEST2 = 0x80383d0c + PTP_PIN_SETFUNC = 0x80603d07 + PTP_PIN_SETFUNC2 = 0x80603d10 + PTP_SYS_OFFSET = 0x83403d05 + PTP_SYS_OFFSET2 = 0x83403d0e PTRACE_GETFPREGS = 0xe PTRACE_GET_THREAD_AREA = 0x19 PTRACE_GET_THREAD_AREA_3264 = 0xc4 @@ -282,6 +297,8 @@ const ( RTC_WIE_ON = 0x2000700f RTC_WKALM_RD = 0x40287010 RTC_WKALM_SET = 0x8028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -320,6 +337,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x1029 SO_DONTROUTE = 0x10 SO_ERROR = 0x1007 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go index 91c6468717..226c044190 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go @@ -108,6 +108,7 @@ const ( HIDIOCGRAWINFO = 0x40084803 HIDIOCGRDESC = 0x50044802 HIDIOCGRDESCSIZE = 0x40044801 + HIDIOCREVOKE = 0x8004480d HUPCL = 0x400 ICANON = 0x2 IEXTEN = 0x100 @@ -234,6 +235,20 @@ const ( PPPIOCUNBRIDGECHAN = 0x20007434 PPPIOCXFERUNIT = 0x2000744e PR_SET_PTRACER_ANY = 0xffffffff + PTP_CLOCK_GETCAPS = 0x40503d01 + PTP_CLOCK_GETCAPS2 = 0x40503d0a + PTP_ENABLE_PPS = 0x80043d04 + PTP_ENABLE_PPS2 = 0x80043d0d + PTP_EXTTS_REQUEST = 0x80103d02 + PTP_EXTTS_REQUEST2 = 0x80103d0b + PTP_MASK_CLEAR_ALL = 0x20003d13 + PTP_MASK_EN_SINGLE = 0x80043d14 + PTP_PEROUT_REQUEST = 0x80383d03 + PTP_PEROUT_REQUEST2 = 0x80383d0c + PTP_PIN_SETFUNC = 0x80603d07 + PTP_PIN_SETFUNC2 = 0x80603d10 + PTP_SYS_OFFSET = 0x83403d05 + PTP_SYS_OFFSET2 = 0x83403d0e PTRACE_GETFPREGS = 0xe PTRACE_GET_THREAD_AREA = 0x19 PTRACE_GET_THREAD_AREA_3264 = 0xc4 @@ -282,6 +297,8 @@ const ( RTC_WIE_ON = 0x2000700f RTC_WKALM_RD = 0x40287010 RTC_WKALM_SET = 0x8028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -320,6 +337,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x1029 SO_DONTROUTE = 0x10 SO_ERROR = 0x1007 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go index 8cbf38d639..3122737cd4 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go @@ -108,6 +108,7 @@ const ( HIDIOCGRAWINFO = 0x40084803 HIDIOCGRDESC = 0x50044802 HIDIOCGRDESCSIZE = 0x40044801 + HIDIOCREVOKE = 0x8004480d HUPCL = 0x4000 ICANON = 0x100 IEXTEN = 0x400 @@ -237,6 +238,20 @@ const ( PPPIOCXFERUNIT = 0x2000744e PROT_SAO = 0x10 PR_SET_PTRACER_ANY = 0xffffffff + PTP_CLOCK_GETCAPS = 0x40503d01 + PTP_CLOCK_GETCAPS2 = 0x40503d0a + PTP_ENABLE_PPS = 0x80043d04 + PTP_ENABLE_PPS2 = 0x80043d0d + PTP_EXTTS_REQUEST = 0x80103d02 + PTP_EXTTS_REQUEST2 = 0x80103d0b + PTP_MASK_CLEAR_ALL = 0x20003d13 + PTP_MASK_EN_SINGLE = 0x80043d14 + PTP_PEROUT_REQUEST = 0x80383d03 + PTP_PEROUT_REQUEST2 = 0x80383d0c + PTP_PIN_SETFUNC = 0x80603d07 + PTP_PIN_SETFUNC2 = 0x80603d10 + PTP_SYS_OFFSET = 0x83403d05 + PTP_SYS_OFFSET2 = 0x83403d0e PTRACE_GETEVRREGS = 0x14 PTRACE_GETFPREGS = 0xe PTRACE_GETREGS64 = 0x16 @@ -337,6 +352,8 @@ const ( RTC_WIE_ON = 0x2000700f RTC_WKALM_RD = 0x40287010 RTC_WKALM_SET = 0x8028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -375,6 +392,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x27 SO_DONTROUTE = 0x5 SO_ERROR = 0x4 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go index a2df734191..eb5d3467ed 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go @@ -108,6 +108,7 @@ const ( HIDIOCGRAWINFO = 0x40084803 HIDIOCGRDESC = 0x50044802 HIDIOCGRDESCSIZE = 0x40044801 + HIDIOCREVOKE = 0x8004480d HUPCL = 0x4000 ICANON = 0x100 IEXTEN = 0x400 @@ -237,6 +238,20 @@ const ( PPPIOCXFERUNIT = 0x2000744e PROT_SAO = 0x10 PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTP_CLOCK_GETCAPS = 0x40503d01 + PTP_CLOCK_GETCAPS2 = 0x40503d0a + PTP_ENABLE_PPS = 0x80043d04 + PTP_ENABLE_PPS2 = 0x80043d0d + PTP_EXTTS_REQUEST = 0x80103d02 + PTP_EXTTS_REQUEST2 = 0x80103d0b + PTP_MASK_CLEAR_ALL = 0x20003d13 + PTP_MASK_EN_SINGLE = 0x80043d14 + PTP_PEROUT_REQUEST = 0x80383d03 + PTP_PEROUT_REQUEST2 = 0x80383d0c + PTP_PIN_SETFUNC = 0x80603d07 + PTP_PIN_SETFUNC2 = 0x80603d10 + PTP_SYS_OFFSET = 0x83403d05 + PTP_SYS_OFFSET2 = 0x83403d0e PTRACE_GETEVRREGS = 0x14 PTRACE_GETFPREGS = 0xe PTRACE_GETREGS64 = 0x16 @@ -341,6 +356,8 @@ const ( RTC_WIE_ON = 0x2000700f RTC_WKALM_RD = 0x40287010 RTC_WKALM_SET = 0x8028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -379,6 +396,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x27 SO_DONTROUTE = 0x5 SO_ERROR = 0x4 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go index 2479137923..e921ebc60b 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go @@ -108,6 +108,7 @@ const ( HIDIOCGRAWINFO = 0x40084803 HIDIOCGRDESC = 0x50044802 HIDIOCGRDESCSIZE = 0x40044801 + HIDIOCREVOKE = 0x8004480d HUPCL = 0x4000 ICANON = 0x100 IEXTEN = 0x400 @@ -237,6 +238,20 @@ const ( PPPIOCXFERUNIT = 0x2000744e PROT_SAO = 0x10 PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTP_CLOCK_GETCAPS = 0x40503d01 + PTP_CLOCK_GETCAPS2 = 0x40503d0a + PTP_ENABLE_PPS = 0x80043d04 + PTP_ENABLE_PPS2 = 0x80043d0d + PTP_EXTTS_REQUEST = 0x80103d02 + PTP_EXTTS_REQUEST2 = 0x80103d0b + PTP_MASK_CLEAR_ALL = 0x20003d13 + PTP_MASK_EN_SINGLE = 0x80043d14 + PTP_PEROUT_REQUEST = 0x80383d03 + PTP_PEROUT_REQUEST2 = 0x80383d0c + PTP_PIN_SETFUNC = 0x80603d07 + PTP_PIN_SETFUNC2 = 0x80603d10 + PTP_SYS_OFFSET = 0x83403d05 + PTP_SYS_OFFSET2 = 0x83403d0e PTRACE_GETEVRREGS = 0x14 PTRACE_GETFPREGS = 0xe PTRACE_GETREGS64 = 0x16 @@ -341,6 +356,8 @@ const ( RTC_WIE_ON = 0x2000700f RTC_WKALM_RD = 0x40287010 RTC_WKALM_SET = 0x8028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -379,6 +396,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x27 SO_DONTROUTE = 0x5 SO_ERROR = 0x4 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go index d265f146ee..38ba81c55c 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go @@ -108,6 +108,7 @@ const ( HIDIOCGRAWINFO = 0x80084803 HIDIOCGRDESC = 0x90044802 HIDIOCGRDESCSIZE = 0x80044801 + HIDIOCREVOKE = 0x4004480d HUPCL = 0x400 ICANON = 0x2 IEXTEN = 0x8000 @@ -234,6 +235,20 @@ const ( PPPIOCUNBRIDGECHAN = 0x7434 PPPIOCXFERUNIT = 0x744e PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTP_CLOCK_GETCAPS = 0x80503d01 + PTP_CLOCK_GETCAPS2 = 0x80503d0a + PTP_ENABLE_PPS = 0x40043d04 + PTP_ENABLE_PPS2 = 0x40043d0d + PTP_EXTTS_REQUEST = 0x40103d02 + PTP_EXTTS_REQUEST2 = 0x40103d0b + PTP_MASK_CLEAR_ALL = 0x3d13 + PTP_MASK_EN_SINGLE = 0x40043d14 + PTP_PEROUT_REQUEST = 0x40383d03 + PTP_PEROUT_REQUEST2 = 0x40383d0c + PTP_PIN_SETFUNC = 0x40603d07 + PTP_PIN_SETFUNC2 = 0x40603d10 + PTP_SYS_OFFSET = 0x43403d05 + PTP_SYS_OFFSET2 = 0x43403d0e PTRACE_GETFDPIC = 0x21 PTRACE_GETFDPIC_EXEC = 0x0 PTRACE_GETFDPIC_INTERP = 0x1 @@ -273,6 +288,8 @@ const ( RTC_WIE_ON = 0x700f RTC_WKALM_RD = 0x80287010 RTC_WKALM_SET = 0x4028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -311,6 +328,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x27 SO_DONTROUTE = 0x5 SO_ERROR = 0x4 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go index 3f2d644396..71f0400977 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go @@ -108,6 +108,7 @@ const ( HIDIOCGRAWINFO = 0x80084803 HIDIOCGRDESC = 0x90044802 HIDIOCGRDESCSIZE = 0x80044801 + HIDIOCREVOKE = 0x4004480d HUPCL = 0x400 ICANON = 0x2 IEXTEN = 0x8000 @@ -234,6 +235,20 @@ const ( PPPIOCUNBRIDGECHAN = 0x7434 PPPIOCXFERUNIT = 0x744e PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTP_CLOCK_GETCAPS = 0x80503d01 + PTP_CLOCK_GETCAPS2 = 0x80503d0a + PTP_ENABLE_PPS = 0x40043d04 + PTP_ENABLE_PPS2 = 0x40043d0d + PTP_EXTTS_REQUEST = 0x40103d02 + PTP_EXTTS_REQUEST2 = 0x40103d0b + PTP_MASK_CLEAR_ALL = 0x3d13 + PTP_MASK_EN_SINGLE = 0x40043d14 + PTP_PEROUT_REQUEST = 0x40383d03 + PTP_PEROUT_REQUEST2 = 0x40383d0c + PTP_PIN_SETFUNC = 0x40603d07 + PTP_PIN_SETFUNC2 = 0x40603d10 + PTP_SYS_OFFSET = 0x43403d05 + PTP_SYS_OFFSET2 = 0x43403d0e PTRACE_DISABLE_TE = 0x5010 PTRACE_ENABLE_TE = 0x5009 PTRACE_GET_LAST_BREAK = 0x5006 @@ -345,6 +360,8 @@ const ( RTC_WIE_ON = 0x700f RTC_WKALM_RD = 0x80287010 RTC_WKALM_SET = 0x4028700f + SCM_DEVMEM_DMABUF = 0x4f + SCM_DEVMEM_LINEAR = 0x4e SCM_TIMESTAMPING = 0x25 SCM_TIMESTAMPING_OPT_STATS = 0x36 SCM_TIMESTAMPING_PKTINFO = 0x3a @@ -383,6 +400,9 @@ const ( SO_CNX_ADVICE = 0x35 SO_COOKIE = 0x39 SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DEVMEM_DMABUF = 0x4f + SO_DEVMEM_DONTNEED = 0x50 + SO_DEVMEM_LINEAR = 0x4e SO_DOMAIN = 0x27 SO_DONTROUTE = 0x5 SO_ERROR = 0x4 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go index 5d8b727a1c..c44a313322 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go @@ -112,6 +112,7 @@ const ( HIDIOCGRAWINFO = 0x40084803 HIDIOCGRDESC = 0x50044802 HIDIOCGRDESCSIZE = 0x40044801 + HIDIOCREVOKE = 0x8004480d HUPCL = 0x400 ICANON = 0x2 IEXTEN = 0x8000 @@ -239,6 +240,20 @@ const ( PPPIOCUNBRIDGECHAN = 0x20007434 PPPIOCXFERUNIT = 0x2000744e PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTP_CLOCK_GETCAPS = 0x40503d01 + PTP_CLOCK_GETCAPS2 = 0x40503d0a + PTP_ENABLE_PPS = 0x80043d04 + PTP_ENABLE_PPS2 = 0x80043d0d + PTP_EXTTS_REQUEST = 0x80103d02 + PTP_EXTTS_REQUEST2 = 0x80103d0b + PTP_MASK_CLEAR_ALL = 0x20003d13 + PTP_MASK_EN_SINGLE = 0x80043d14 + PTP_PEROUT_REQUEST = 0x80383d03 + PTP_PEROUT_REQUEST2 = 0x80383d0c + PTP_PIN_SETFUNC = 0x80603d07 + PTP_PIN_SETFUNC2 = 0x80603d10 + PTP_SYS_OFFSET = 0x83403d05 + PTP_SYS_OFFSET2 = 0x83403d0e PTRACE_GETFPAREGS = 0x14 PTRACE_GETFPREGS = 0xe PTRACE_GETFPREGS64 = 0x19 @@ -336,6 +351,8 @@ const ( RTC_WIE_ON = 0x2000700f RTC_WKALM_RD = 0x40287010 RTC_WKALM_SET = 0x8028700f + SCM_DEVMEM_DMABUF = 0x58 + SCM_DEVMEM_LINEAR = 0x57 SCM_TIMESTAMPING = 0x23 SCM_TIMESTAMPING_OPT_STATS = 0x38 SCM_TIMESTAMPING_PKTINFO = 0x3c @@ -422,6 +439,9 @@ const ( SO_CNX_ADVICE = 0x37 SO_COOKIE = 0x3b SO_DETACH_REUSEPORT_BPF = 0x47 + SO_DEVMEM_DMABUF = 0x58 + SO_DEVMEM_DONTNEED = 0x59 + SO_DEVMEM_LINEAR = 0x57 SO_DOMAIN = 0x1029 SO_DONTROUTE = 0x10 SO_ERROR = 0x1007 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index af30da5578..5cc1e8eb2f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -592,6 +592,16 @@ func ClockGettime(clockid int32, time *Timespec) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockSettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := Syscall(SYS_CLOCK_SETTIME, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ClockNanosleep(clockid int32, flags int, request *Timespec, remain *Timespec) (err error) { _, _, e1 := Syscall6(SYS_CLOCK_NANOSLEEP, uintptr(clockid), uintptr(flags), uintptr(unsafe.Pointer(request)), uintptr(unsafe.Pointer(remain)), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go index d003c3d437..17c53bd9b3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go @@ -462,11 +462,14 @@ type FdSet struct { const ( SizeofIfMsghdr = 0x70 + SizeofIfMsghdr2 = 0xa0 SizeofIfData = 0x60 + SizeofIfData64 = 0x80 SizeofIfaMsghdr = 0x14 SizeofIfmaMsghdr = 0x10 SizeofIfmaMsghdr2 = 0x14 SizeofRtMsghdr = 0x5c + SizeofRtMsghdr2 = 0x5c SizeofRtMetrics = 0x38 ) @@ -480,6 +483,20 @@ type IfMsghdr struct { Data IfData } +type IfMsghdr2 struct { + Msglen uint16 + Version uint8 + Type uint8 + Addrs int32 + Flags int32 + Index uint16 + Snd_len int32 + Snd_maxlen int32 + Snd_drops int32 + Timer int32 + Data IfData64 +} + type IfData struct { Type uint8 Typelen uint8 @@ -512,6 +529,34 @@ type IfData struct { Reserved2 uint32 } +type IfData64 struct { + Type uint8 + Typelen uint8 + Physical uint8 + Addrlen uint8 + Hdrlen uint8 + Recvquota uint8 + Xmitquota uint8 + Unused1 uint8 + Mtu uint32 + Metric uint32 + Baudrate uint64 + Ipackets uint64 + Ierrors uint64 + Opackets uint64 + Oerrors uint64 + Collisions uint64 + Ibytes uint64 + Obytes uint64 + Imcasts uint64 + Omcasts uint64 + Iqdrops uint64 + Noproto uint64 + Recvtiming uint32 + Xmittiming uint32 + Lastchange Timeval32 +} + type IfaMsghdr struct { Msglen uint16 Version uint8 @@ -557,6 +602,21 @@ type RtMsghdr struct { Rmx RtMetrics } +type RtMsghdr2 struct { + Msglen uint16 + Version uint8 + Type uint8 + Index uint16 + Flags int32 + Addrs int32 + Refcnt int32 + Parentflags int32 + Reserved int32 + Use int32 + Inits uint32 + Rmx RtMetrics +} + type RtMetrics struct { Locks uint32 Mtu uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go index 0d45a941aa..2392226a74 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go @@ -462,11 +462,14 @@ type FdSet struct { const ( SizeofIfMsghdr = 0x70 + SizeofIfMsghdr2 = 0xa0 SizeofIfData = 0x60 + SizeofIfData64 = 0x80 SizeofIfaMsghdr = 0x14 SizeofIfmaMsghdr = 0x10 SizeofIfmaMsghdr2 = 0x14 SizeofRtMsghdr = 0x5c + SizeofRtMsghdr2 = 0x5c SizeofRtMetrics = 0x38 ) @@ -480,6 +483,20 @@ type IfMsghdr struct { Data IfData } +type IfMsghdr2 struct { + Msglen uint16 + Version uint8 + Type uint8 + Addrs int32 + Flags int32 + Index uint16 + Snd_len int32 + Snd_maxlen int32 + Snd_drops int32 + Timer int32 + Data IfData64 +} + type IfData struct { Type uint8 Typelen uint8 @@ -512,6 +529,34 @@ type IfData struct { Reserved2 uint32 } +type IfData64 struct { + Type uint8 + Typelen uint8 + Physical uint8 + Addrlen uint8 + Hdrlen uint8 + Recvquota uint8 + Xmitquota uint8 + Unused1 uint8 + Mtu uint32 + Metric uint32 + Baudrate uint64 + Ipackets uint64 + Ierrors uint64 + Opackets uint64 + Oerrors uint64 + Collisions uint64 + Ibytes uint64 + Obytes uint64 + Imcasts uint64 + Omcasts uint64 + Iqdrops uint64 + Noproto uint64 + Recvtiming uint32 + Xmittiming uint32 + Lastchange Timeval32 +} + type IfaMsghdr struct { Msglen uint16 Version uint8 @@ -557,6 +602,21 @@ type RtMsghdr struct { Rmx RtMetrics } +type RtMsghdr2 struct { + Msglen uint16 + Version uint8 + Type uint8 + Index uint16 + Flags int32 + Addrs int32 + Refcnt int32 + Parentflags int32 + Reserved int32 + Use int32 + Inits uint32 + Rmx RtMetrics +} + type RtMetrics struct { Locks uint32 Mtu uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index 3a69e45496..5537148dcb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -1752,12 +1752,6 @@ const ( IFLA_IPVLAN_UNSPEC = 0x0 IFLA_IPVLAN_MODE = 0x1 IFLA_IPVLAN_FLAGS = 0x2 - NETKIT_NEXT = -0x1 - NETKIT_PASS = 0x0 - NETKIT_DROP = 0x2 - NETKIT_REDIRECT = 0x7 - NETKIT_L2 = 0x0 - NETKIT_L3 = 0x1 IFLA_NETKIT_UNSPEC = 0x0 IFLA_NETKIT_PEER_INFO = 0x1 IFLA_NETKIT_PRIMARY = 0x2 @@ -1796,6 +1790,7 @@ const ( IFLA_VXLAN_DF = 0x1d IFLA_VXLAN_VNIFILTER = 0x1e IFLA_VXLAN_LOCALBYPASS = 0x1f + IFLA_VXLAN_LABEL_POLICY = 0x20 IFLA_GENEVE_UNSPEC = 0x0 IFLA_GENEVE_ID = 0x1 IFLA_GENEVE_REMOTE = 0x2 @@ -1825,6 +1820,8 @@ const ( IFLA_GTP_ROLE = 0x4 IFLA_GTP_CREATE_SOCKETS = 0x5 IFLA_GTP_RESTART_COUNT = 0x6 + IFLA_GTP_LOCAL = 0x7 + IFLA_GTP_LOCAL6 = 0x8 IFLA_BOND_UNSPEC = 0x0 IFLA_BOND_MODE = 0x1 IFLA_BOND_ACTIVE_SLAVE = 0x2 @@ -1857,6 +1854,7 @@ const ( IFLA_BOND_AD_LACP_ACTIVE = 0x1d IFLA_BOND_MISSED_MAX = 0x1e IFLA_BOND_NS_IP6_TARGET = 0x1f + IFLA_BOND_COUPLED_CONTROL = 0x20 IFLA_BOND_AD_INFO_UNSPEC = 0x0 IFLA_BOND_AD_INFO_AGGREGATOR = 0x1 IFLA_BOND_AD_INFO_NUM_PORTS = 0x2 @@ -1925,6 +1923,7 @@ const ( IFLA_HSR_SEQ_NR = 0x5 IFLA_HSR_VERSION = 0x6 IFLA_HSR_PROTOCOL = 0x7 + IFLA_HSR_INTERLINK = 0x8 IFLA_STATS_UNSPEC = 0x0 IFLA_STATS_LINK_64 = 0x1 IFLA_STATS_LINK_XSTATS = 0x2 @@ -1977,6 +1976,15 @@ const ( IFLA_DSA_MASTER = 0x1 ) +const ( + NETKIT_NEXT = -0x1 + NETKIT_PASS = 0x0 + NETKIT_DROP = 0x2 + NETKIT_REDIRECT = 0x7 + NETKIT_L2 = 0x0 + NETKIT_L3 = 0x1 +) + const ( NF_INET_PRE_ROUTING = 0x0 NF_INET_LOCAL_IN = 0x1 @@ -2586,8 +2594,8 @@ const ( SOF_TIMESTAMPING_BIND_PHC = 0x8000 SOF_TIMESTAMPING_OPT_ID_TCP = 0x10000 - SOF_TIMESTAMPING_LAST = 0x10000 - SOF_TIMESTAMPING_MASK = 0x1ffff + SOF_TIMESTAMPING_LAST = 0x20000 + SOF_TIMESTAMPING_MASK = 0x3ffff SCM_TSTAMP_SND = 0x0 SCM_TSTAMP_SCHED = 0x1 @@ -3533,7 +3541,7 @@ type Nhmsg struct { type NexthopGrp struct { Id uint32 Weight uint8 - Resvd1 uint8 + High uint8 Resvd2 uint16 } @@ -3794,7 +3802,7 @@ const ( ETHTOOL_MSG_PSE_GET = 0x24 ETHTOOL_MSG_PSE_SET = 0x25 ETHTOOL_MSG_RSS_GET = 0x26 - ETHTOOL_MSG_USER_MAX = 0x2c + ETHTOOL_MSG_USER_MAX = 0x2d ETHTOOL_MSG_KERNEL_NONE = 0x0 ETHTOOL_MSG_STRSET_GET_REPLY = 0x1 ETHTOOL_MSG_LINKINFO_GET_REPLY = 0x2 @@ -3834,7 +3842,7 @@ const ( ETHTOOL_MSG_MODULE_NTF = 0x24 ETHTOOL_MSG_PSE_GET_REPLY = 0x25 ETHTOOL_MSG_RSS_GET_REPLY = 0x26 - ETHTOOL_MSG_KERNEL_MAX = 0x2c + ETHTOOL_MSG_KERNEL_MAX = 0x2e ETHTOOL_FLAG_COMPACT_BITSETS = 0x1 ETHTOOL_FLAG_OMIT_REPLY = 0x2 ETHTOOL_FLAG_STATS = 0x4 @@ -3842,7 +3850,7 @@ const ( ETHTOOL_A_HEADER_DEV_INDEX = 0x1 ETHTOOL_A_HEADER_DEV_NAME = 0x2 ETHTOOL_A_HEADER_FLAGS = 0x3 - ETHTOOL_A_HEADER_MAX = 0x3 + ETHTOOL_A_HEADER_MAX = 0x4 ETHTOOL_A_BITSET_BIT_UNSPEC = 0x0 ETHTOOL_A_BITSET_BIT_INDEX = 0x1 ETHTOOL_A_BITSET_BIT_NAME = 0x2 @@ -4023,11 +4031,11 @@ const ( ETHTOOL_A_CABLE_RESULT_UNSPEC = 0x0 ETHTOOL_A_CABLE_RESULT_PAIR = 0x1 ETHTOOL_A_CABLE_RESULT_CODE = 0x2 - ETHTOOL_A_CABLE_RESULT_MAX = 0x2 + ETHTOOL_A_CABLE_RESULT_MAX = 0x3 ETHTOOL_A_CABLE_FAULT_LENGTH_UNSPEC = 0x0 ETHTOOL_A_CABLE_FAULT_LENGTH_PAIR = 0x1 ETHTOOL_A_CABLE_FAULT_LENGTH_CM = 0x2 - ETHTOOL_A_CABLE_FAULT_LENGTH_MAX = 0x2 + ETHTOOL_A_CABLE_FAULT_LENGTH_MAX = 0x3 ETHTOOL_A_CABLE_TEST_NTF_STATUS_UNSPEC = 0x0 ETHTOOL_A_CABLE_TEST_NTF_STATUS_STARTED = 0x1 ETHTOOL_A_CABLE_TEST_NTF_STATUS_COMPLETED = 0x2 @@ -4110,6 +4118,107 @@ type EthtoolDrvinfo struct { Regdump_len uint32 } +type EthtoolTsInfo struct { + Cmd uint32 + So_timestamping uint32 + Phc_index int32 + Tx_types uint32 + Tx_reserved [3]uint32 + Rx_filters uint32 + Rx_reserved [3]uint32 +} + +type HwTstampConfig struct { + Flags int32 + Tx_type int32 + Rx_filter int32 +} + +const ( + HWTSTAMP_FILTER_NONE = 0x0 + HWTSTAMP_FILTER_ALL = 0x1 + HWTSTAMP_FILTER_SOME = 0x2 + HWTSTAMP_FILTER_PTP_V1_L4_EVENT = 0x3 + HWTSTAMP_FILTER_PTP_V2_L4_EVENT = 0x6 + HWTSTAMP_FILTER_PTP_V2_L2_EVENT = 0x9 + HWTSTAMP_FILTER_PTP_V2_EVENT = 0xc +) + +const ( + HWTSTAMP_TX_OFF = 0x0 + HWTSTAMP_TX_ON = 0x1 + HWTSTAMP_TX_ONESTEP_SYNC = 0x2 +) + +type ( + PtpClockCaps struct { + Max_adj int32 + N_alarm int32 + N_ext_ts int32 + N_per_out int32 + Pps int32 + N_pins int32 + Cross_timestamping int32 + Adjust_phase int32 + Max_phase_adj int32 + Rsv [11]int32 + } + PtpClockTime struct { + Sec int64 + Nsec uint32 + Reserved uint32 + } + PtpExttsEvent struct { + T PtpClockTime + Index uint32 + Flags uint32 + Rsv [2]uint32 + } + PtpExttsRequest struct { + Index uint32 + Flags uint32 + Rsv [2]uint32 + } + PtpPeroutRequest struct { + StartOrPhase PtpClockTime + Period PtpClockTime + Index uint32 + Flags uint32 + On PtpClockTime + } + PtpPinDesc struct { + Name [64]byte + Index uint32 + Func uint32 + Chan uint32 + Rsv [5]uint32 + } + PtpSysOffset struct { + Samples uint32 + Rsv [3]uint32 + Ts [51]PtpClockTime + } + PtpSysOffsetExtended struct { + Samples uint32 + Clockid int32 + Rsv [2]uint32 + Ts [25][3]PtpClockTime + } + PtpSysOffsetPrecise struct { + Device PtpClockTime + Realtime PtpClockTime + Monoraw PtpClockTime + Rsv [4]uint32 + } +) + +const ( + PTP_PF_NONE = 0x0 + PTP_PF_EXTTS = 0x1 + PTP_PF_PEROUT = 0x2 + PTP_PF_PHYSYNC = 0x3 +) + type ( HIDRawReportDescriptor struct { Size uint32 @@ -4291,6 +4400,7 @@ const ( type LandlockRulesetAttr struct { Access_fs uint64 Access_net uint64 + Scoped uint64 } type LandlockPathBeneathAttr struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go index d9a13af468..2e5d5a4435 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go @@ -377,6 +377,12 @@ type Flock_t struct { Pid int32 } +type F_cnvrt struct { + Cvtcmd int32 + Pccsid int16 + Fccsid int16 +} + type Termios struct { Cflag uint32 Iflag uint32 diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index 5cee9a3143..4a32543868 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -168,6 +168,8 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys CreateNamedPipe(name *uint16, flags uint32, pipeMode uint32, maxInstances uint32, outSize uint32, inSize uint32, defaultTimeout uint32, sa *SecurityAttributes) (handle Handle, err error) [failretval==InvalidHandle] = CreateNamedPipeW //sys ConnectNamedPipe(pipe Handle, overlapped *Overlapped) (err error) //sys DisconnectNamedPipe(pipe Handle) (err error) +//sys GetNamedPipeClientProcessId(pipe Handle, clientProcessID *uint32) (err error) +//sys GetNamedPipeServerProcessId(pipe Handle, serverProcessID *uint32) (err error) //sys GetNamedPipeInfo(pipe Handle, flags *uint32, outSize *uint32, inSize *uint32, maxInstances *uint32) (err error) //sys GetNamedPipeHandleState(pipe Handle, state *uint32, curInstances *uint32, maxCollectionCount *uint32, collectDataTimeout *uint32, userName *uint16, maxUserNameSize uint32) (err error) = GetNamedPipeHandleStateW //sys SetNamedPipeHandleState(pipe Handle, state *uint32, maxCollectionCount *uint32, collectDataTimeout *uint32) (err error) = SetNamedPipeHandleState @@ -725,20 +727,12 @@ func DurationSinceBoot() time.Duration { } func Ftruncate(fd Handle, length int64) (err error) { - curoffset, e := Seek(fd, 0, 1) - if e != nil { - return e - } - defer Seek(fd, curoffset, 0) - _, e = Seek(fd, length, 0) - if e != nil { - return e + type _FILE_END_OF_FILE_INFO struct { + EndOfFile int64 } - e = SetEndOfFile(fd) - if e != nil { - return e - } - return nil + var info _FILE_END_OF_FILE_INFO + info.EndOfFile = length + return SetFileInformationByHandle(fd, FileEndOfFileInfo, (*byte)(unsafe.Pointer(&info)), uint32(unsafe.Sizeof(info))) } func Gettimeofday(tv *Timeval) (err error) { @@ -894,6 +888,11 @@ const socket_error = uintptr(^uint32(0)) //sys GetACP() (acp uint32) = kernel32.GetACP //sys MultiByteToWideChar(codePage uint32, dwFlags uint32, str *byte, nstr int32, wchar *uint16, nwchar int32) (nwrite int32, err error) = kernel32.MultiByteToWideChar //sys getBestInterfaceEx(sockaddr unsafe.Pointer, pdwBestIfIndex *uint32) (errcode error) = iphlpapi.GetBestInterfaceEx +//sys GetIfEntry2Ex(level uint32, row *MibIfRow2) (errcode error) = iphlpapi.GetIfEntry2Ex +//sys GetUnicastIpAddressEntry(row *MibUnicastIpAddressRow) (errcode error) = iphlpapi.GetUnicastIpAddressEntry +//sys NotifyIpInterfaceChange(family uint16, callback uintptr, callerContext unsafe.Pointer, initialNotification bool, notificationHandle *Handle) (errcode error) = iphlpapi.NotifyIpInterfaceChange +//sys NotifyUnicastIpAddressChange(family uint16, callback uintptr, callerContext unsafe.Pointer, initialNotification bool, notificationHandle *Handle) (errcode error) = iphlpapi.NotifyUnicastIpAddressChange +//sys CancelMibChangeNotify2(notificationHandle Handle) (errcode error) = iphlpapi.CancelMibChangeNotify2 // For testing: clients can set this flag to force // creation of IPv6 sockets to return EAFNOSUPPORT. @@ -1685,13 +1684,16 @@ func (s NTStatus) Error() string { // do not use NTUnicodeString, and instead UTF16PtrFromString should be used for // the more common *uint16 string type. func NewNTUnicodeString(s string) (*NTUnicodeString, error) { - var u NTUnicodeString - s16, err := UTF16PtrFromString(s) + s16, err := UTF16FromString(s) if err != nil { return nil, err } - RtlInitUnicodeString(&u, s16) - return &u, nil + n := uint16(len(s16) * 2) + return &NTUnicodeString{ + Length: n - 2, // subtract 2 bytes for the NULL terminator + MaximumLength: n, + Buffer: &s16[0], + }, nil } // Slice returns a uint16 slice that aliases the data in the NTUnicodeString. diff --git a/vendor/golang.org/x/sys/windows/types_windows.go b/vendor/golang.org/x/sys/windows/types_windows.go index 7b97a154c9..9d138de5fe 100644 --- a/vendor/golang.org/x/sys/windows/types_windows.go +++ b/vendor/golang.org/x/sys/windows/types_windows.go @@ -176,6 +176,7 @@ const ( WAIT_FAILED = 0xFFFFFFFF // Access rights for process. + PROCESS_ALL_ACCESS = 0xFFFF PROCESS_CREATE_PROCESS = 0x0080 PROCESS_CREATE_THREAD = 0x0002 PROCESS_DUP_HANDLE = 0x0040 @@ -2203,6 +2204,132 @@ const ( IfOperStatusLowerLayerDown = 7 ) +const ( + IF_MAX_PHYS_ADDRESS_LENGTH = 32 + IF_MAX_STRING_SIZE = 256 +) + +// MIB_IF_ENTRY_LEVEL enumeration from netioapi.h or +// https://learn.microsoft.com/en-us/windows/win32/api/netioapi/nf-netioapi-getifentry2ex. +const ( + MibIfEntryNormal = 0 + MibIfEntryNormalWithoutStatistics = 2 +) + +// MIB_NOTIFICATION_TYPE enumeration from netioapi.h or +// https://learn.microsoft.com/en-us/windows/win32/api/netioapi/ne-netioapi-mib_notification_type. +const ( + MibParameterNotification = 0 + MibAddInstance = 1 + MibDeleteInstance = 2 + MibInitialNotification = 3 +) + +// MibIfRow2 stores information about a particular interface. See +// https://learn.microsoft.com/en-us/windows/win32/api/netioapi/ns-netioapi-mib_if_row2. +type MibIfRow2 struct { + InterfaceLuid uint64 + InterfaceIndex uint32 + InterfaceGuid GUID + Alias [IF_MAX_STRING_SIZE + 1]uint16 + Description [IF_MAX_STRING_SIZE + 1]uint16 + PhysicalAddressLength uint32 + PhysicalAddress [IF_MAX_PHYS_ADDRESS_LENGTH]uint8 + PermanentPhysicalAddress [IF_MAX_PHYS_ADDRESS_LENGTH]uint8 + Mtu uint32 + Type uint32 + TunnelType uint32 + MediaType uint32 + PhysicalMediumType uint32 + AccessType uint32 + DirectionType uint32 + InterfaceAndOperStatusFlags uint8 + OperStatus uint32 + AdminStatus uint32 + MediaConnectState uint32 + NetworkGuid GUID + ConnectionType uint32 + TransmitLinkSpeed uint64 + ReceiveLinkSpeed uint64 + InOctets uint64 + InUcastPkts uint64 + InNUcastPkts uint64 + InDiscards uint64 + InErrors uint64 + InUnknownProtos uint64 + InUcastOctets uint64 + InMulticastOctets uint64 + InBroadcastOctets uint64 + OutOctets uint64 + OutUcastPkts uint64 + OutNUcastPkts uint64 + OutDiscards uint64 + OutErrors uint64 + OutUcastOctets uint64 + OutMulticastOctets uint64 + OutBroadcastOctets uint64 + OutQLen uint64 +} + +// MIB_UNICASTIPADDRESS_ROW stores information about a unicast IP address. See +// https://learn.microsoft.com/en-us/windows/win32/api/netioapi/ns-netioapi-mib_unicastipaddress_row. +type MibUnicastIpAddressRow struct { + Address RawSockaddrInet6 // SOCKADDR_INET union + InterfaceLuid uint64 + InterfaceIndex uint32 + PrefixOrigin uint32 + SuffixOrigin uint32 + ValidLifetime uint32 + PreferredLifetime uint32 + OnLinkPrefixLength uint8 + SkipAsSource uint8 + DadState uint32 + ScopeId uint32 + CreationTimeStamp Filetime +} + +const ScopeLevelCount = 16 + +// MIB_IPINTERFACE_ROW stores interface management information for a particular IP address family on a network interface. +// See https://learn.microsoft.com/en-us/windows/win32/api/netioapi/ns-netioapi-mib_ipinterface_row. +type MibIpInterfaceRow struct { + Family uint16 + InterfaceLuid uint64 + InterfaceIndex uint32 + MaxReassemblySize uint32 + InterfaceIdentifier uint64 + MinRouterAdvertisementInterval uint32 + MaxRouterAdvertisementInterval uint32 + AdvertisingEnabled uint8 + ForwardingEnabled uint8 + WeakHostSend uint8 + WeakHostReceive uint8 + UseAutomaticMetric uint8 + UseNeighborUnreachabilityDetection uint8 + ManagedAddressConfigurationSupported uint8 + OtherStatefulConfigurationSupported uint8 + AdvertiseDefaultRoute uint8 + RouterDiscoveryBehavior uint32 + DadTransmits uint32 + BaseReachableTime uint32 + RetransmitTime uint32 + PathMtuDiscoveryTimeout uint32 + LinkLocalAddressBehavior uint32 + LinkLocalAddressTimeout uint32 + ZoneIndices [ScopeLevelCount]uint32 + SitePrefixLength uint32 + Metric uint32 + NlMtu uint32 + Connected uint8 + SupportsWakeUpPatterns uint8 + SupportsNeighborDiscovery uint8 + SupportsRouterDiscovery uint8 + ReachableTime uint32 + TransmitOffload uint32 + ReceiveOffload uint32 + DisableDefaultRoutes uint8 +} + // Console related constants used for the mode parameter to SetConsoleMode. See // https://docs.microsoft.com/en-us/windows/console/setconsolemode for details. diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index 4c2e1bdc01..01c0716c2c 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -181,10 +181,15 @@ var ( procDnsRecordListFree = moddnsapi.NewProc("DnsRecordListFree") procDwmGetWindowAttribute = moddwmapi.NewProc("DwmGetWindowAttribute") procDwmSetWindowAttribute = moddwmapi.NewProc("DwmSetWindowAttribute") + procCancelMibChangeNotify2 = modiphlpapi.NewProc("CancelMibChangeNotify2") procGetAdaptersAddresses = modiphlpapi.NewProc("GetAdaptersAddresses") procGetAdaptersInfo = modiphlpapi.NewProc("GetAdaptersInfo") procGetBestInterfaceEx = modiphlpapi.NewProc("GetBestInterfaceEx") procGetIfEntry = modiphlpapi.NewProc("GetIfEntry") + procGetIfEntry2Ex = modiphlpapi.NewProc("GetIfEntry2Ex") + procGetUnicastIpAddressEntry = modiphlpapi.NewProc("GetUnicastIpAddressEntry") + procNotifyIpInterfaceChange = modiphlpapi.NewProc("NotifyIpInterfaceChange") + procNotifyUnicastIpAddressChange = modiphlpapi.NewProc("NotifyUnicastIpAddressChange") procAddDllDirectory = modkernel32.NewProc("AddDllDirectory") procAssignProcessToJobObject = modkernel32.NewProc("AssignProcessToJobObject") procCancelIo = modkernel32.NewProc("CancelIo") @@ -275,8 +280,10 @@ var ( procGetMaximumProcessorCount = modkernel32.NewProc("GetMaximumProcessorCount") procGetModuleFileNameW = modkernel32.NewProc("GetModuleFileNameW") procGetModuleHandleExW = modkernel32.NewProc("GetModuleHandleExW") + procGetNamedPipeClientProcessId = modkernel32.NewProc("GetNamedPipeClientProcessId") procGetNamedPipeHandleStateW = modkernel32.NewProc("GetNamedPipeHandleStateW") procGetNamedPipeInfo = modkernel32.NewProc("GetNamedPipeInfo") + procGetNamedPipeServerProcessId = modkernel32.NewProc("GetNamedPipeServerProcessId") procGetOverlappedResult = modkernel32.NewProc("GetOverlappedResult") procGetPriorityClass = modkernel32.NewProc("GetPriorityClass") procGetProcAddress = modkernel32.NewProc("GetProcAddress") @@ -1606,6 +1613,14 @@ func DwmSetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, si return } +func CancelMibChangeNotify2(notificationHandle Handle) (errcode error) { + r0, _, _ := syscall.Syscall(procCancelMibChangeNotify2.Addr(), 1, uintptr(notificationHandle), 0, 0) + if r0 != 0 { + errcode = syscall.Errno(r0) + } + return +} + func GetAdaptersAddresses(family uint32, flags uint32, reserved uintptr, adapterAddresses *IpAdapterAddresses, sizePointer *uint32) (errcode error) { r0, _, _ := syscall.Syscall6(procGetAdaptersAddresses.Addr(), 5, uintptr(family), uintptr(flags), uintptr(reserved), uintptr(unsafe.Pointer(adapterAddresses)), uintptr(unsafe.Pointer(sizePointer)), 0) if r0 != 0 { @@ -1638,6 +1653,46 @@ func GetIfEntry(pIfRow *MibIfRow) (errcode error) { return } +func GetIfEntry2Ex(level uint32, row *MibIfRow2) (errcode error) { + r0, _, _ := syscall.Syscall(procGetIfEntry2Ex.Addr(), 2, uintptr(level), uintptr(unsafe.Pointer(row)), 0) + if r0 != 0 { + errcode = syscall.Errno(r0) + } + return +} + +func GetUnicastIpAddressEntry(row *MibUnicastIpAddressRow) (errcode error) { + r0, _, _ := syscall.Syscall(procGetUnicastIpAddressEntry.Addr(), 1, uintptr(unsafe.Pointer(row)), 0, 0) + if r0 != 0 { + errcode = syscall.Errno(r0) + } + return +} + +func NotifyIpInterfaceChange(family uint16, callback uintptr, callerContext unsafe.Pointer, initialNotification bool, notificationHandle *Handle) (errcode error) { + var _p0 uint32 + if initialNotification { + _p0 = 1 + } + r0, _, _ := syscall.Syscall6(procNotifyIpInterfaceChange.Addr(), 5, uintptr(family), uintptr(callback), uintptr(callerContext), uintptr(_p0), uintptr(unsafe.Pointer(notificationHandle)), 0) + if r0 != 0 { + errcode = syscall.Errno(r0) + } + return +} + +func NotifyUnicastIpAddressChange(family uint16, callback uintptr, callerContext unsafe.Pointer, initialNotification bool, notificationHandle *Handle) (errcode error) { + var _p0 uint32 + if initialNotification { + _p0 = 1 + } + r0, _, _ := syscall.Syscall6(procNotifyUnicastIpAddressChange.Addr(), 5, uintptr(family), uintptr(callback), uintptr(callerContext), uintptr(_p0), uintptr(unsafe.Pointer(notificationHandle)), 0) + if r0 != 0 { + errcode = syscall.Errno(r0) + } + return +} + func AddDllDirectory(path *uint16) (cookie uintptr, err error) { r0, _, e1 := syscall.Syscall(procAddDllDirectory.Addr(), 1, uintptr(unsafe.Pointer(path)), 0, 0) cookie = uintptr(r0) @@ -2393,6 +2448,14 @@ func GetModuleHandleEx(flags uint32, moduleName *uint16, module *Handle) (err er return } +func GetNamedPipeClientProcessId(pipe Handle, clientProcessID *uint32) (err error) { + r1, _, e1 := syscall.Syscall(procGetNamedPipeClientProcessId.Addr(), 2, uintptr(pipe), uintptr(unsafe.Pointer(clientProcessID)), 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func GetNamedPipeHandleState(pipe Handle, state *uint32, curInstances *uint32, maxCollectionCount *uint32, collectDataTimeout *uint32, userName *uint16, maxUserNameSize uint32) (err error) { r1, _, e1 := syscall.Syscall9(procGetNamedPipeHandleStateW.Addr(), 7, uintptr(pipe), uintptr(unsafe.Pointer(state)), uintptr(unsafe.Pointer(curInstances)), uintptr(unsafe.Pointer(maxCollectionCount)), uintptr(unsafe.Pointer(collectDataTimeout)), uintptr(unsafe.Pointer(userName)), uintptr(maxUserNameSize), 0, 0) if r1 == 0 { @@ -2409,6 +2472,14 @@ func GetNamedPipeInfo(pipe Handle, flags *uint32, outSize *uint32, inSize *uint3 return } +func GetNamedPipeServerProcessId(pipe Handle, serverProcessID *uint32) (err error) { + r1, _, e1 := syscall.Syscall(procGetNamedPipeServerProcessId.Addr(), 2, uintptr(pipe), uintptr(unsafe.Pointer(serverProcessID)), 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func GetOverlappedResult(handle Handle, overlapped *Overlapped, done *uint32, wait bool) (err error) { var _p0 uint32 if wait { diff --git a/vendor/golang.org/x/term/README.md b/vendor/golang.org/x/term/README.md index d03d0aefef..05ff623f94 100644 --- a/vendor/golang.org/x/term/README.md +++ b/vendor/golang.org/x/term/README.md @@ -4,16 +4,13 @@ This repository provides Go terminal and console support packages. -## Download/Install - -The easiest way to install is to run `go get -u golang.org/x/term`. You can -also manually git clone the repository to `$GOPATH/src/golang.org/x/term`. - ## Report Issues / Send Patches This repository uses Gerrit for code changes. To learn how to submit changes to -this repository, see https://golang.org/doc/contribute.html. +this repository, see https://go.dev/doc/contribute. + +The git repository is https://go.googlesource.com/term. The main issue tracker for the term repository is located at -https://github.com/golang/go/issues. Prefix your issue with "x/term:" in the +https://go.dev/issues. Prefix your issue with "x/term:" in the subject line, so it is easy to find. diff --git a/vendor/golang.org/x/tools/go/ast/astutil/imports.go b/vendor/golang.org/x/tools/go/ast/astutil/imports.go index 18d1adb05d..a6b5ed0a89 100644 --- a/vendor/golang.org/x/tools/go/ast/astutil/imports.go +++ b/vendor/golang.org/x/tools/go/ast/astutil/imports.go @@ -344,7 +344,12 @@ func RewriteImport(fset *token.FileSet, f *ast.File, oldPath, newPath string) (r } // UsesImport reports whether a given import is used. +// The provided File must have been parsed with syntactic object resolution +// (not using go/parser.SkipObjectResolution). func UsesImport(f *ast.File, path string) (used bool) { + if f.Scope == nil { + panic("file f was not parsed with syntactic object resolution") + } spec := importSpec(f, path) if spec == nil { return diff --git a/vendor/golang.org/x/tools/go/ast/inspector/inspector.go b/vendor/golang.org/x/tools/go/ast/inspector/inspector.go index 0e0ba4c035..958cf38deb 100644 --- a/vendor/golang.org/x/tools/go/ast/inspector/inspector.go +++ b/vendor/golang.org/x/tools/go/ast/inspector/inspector.go @@ -180,7 +180,9 @@ func (in *Inspector) WithStack(types []ast.Node, f func(n ast.Node, push bool, s // traverse builds the table of events representing a traversal. func traverse(files []*ast.File) []event { // Preallocate approximate number of events - // based on source file extent. + // based on source file extent of the declarations. + // (We use End-Pos not FileStart-FileEnd to neglect + // the effect of long doc comments.) // This makes traverse faster by 4x (!). var extent int for _, f := range files { diff --git a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go index 137cc8df1d..65fe2628e9 100644 --- a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go +++ b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go @@ -2,22 +2,64 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// Package gcexportdata provides functions for locating, reading, and -// writing export data files containing type information produced by the -// gc compiler. This package supports go1.7 export data format and all -// later versions. -// -// Although it might seem convenient for this package to live alongside -// go/types in the standard library, this would cause version skew -// problems for developer tools that use it, since they must be able to -// consume the outputs of the gc compiler both before and after a Go -// update such as from Go 1.7 to Go 1.8. Because this package lives in -// golang.org/x/tools, sites can update their version of this repo some -// time before the Go 1.8 release and rebuild and redeploy their -// developer tools, which will then be able to consume both Go 1.7 and -// Go 1.8 export data files, so they will work before and after the -// Go update. (See discussion at https://golang.org/issue/15651.) -package gcexportdata // import "golang.org/x/tools/go/gcexportdata" +// Package gcexportdata provides functions for reading and writing +// export data, which is a serialized description of the API of a Go +// package including the names, kinds, types, and locations of all +// exported declarations. +// +// The standard Go compiler (cmd/compile) writes an export data file +// for each package it compiles, which it later reads when compiling +// packages that import the earlier one. The compiler must thus +// contain logic to both write and read export data. +// (See the "Export" section in the cmd/compile/README file.) +// +// The [Read] function in this package can read files produced by the +// compiler, producing [go/types] data structures. As a matter of +// policy, Read supports export data files produced by only the last +// two Go releases plus tip; see https://go.dev/issue/68898. The +// export data files produced by the compiler contain additional +// details related to generics, inlining, and other optimizations that +// cannot be decoded by the [Read] function. +// +// In files written by the compiler, the export data is not at the +// start of the file. Before calling Read, use [NewReader] to locate +// the desired portion of the file. +// +// The [Write] function in this package encodes the exported API of a +// Go package ([types.Package]) as a file. Such files can be later +// decoded by Read, but cannot be consumed by the compiler. +// +// # Future changes +// +// Although Read supports the formats written by both Write and the +// compiler, the two are quite different, and there is an open +// proposal (https://go.dev/issue/69491) to separate these APIs. +// +// Under that proposal, this package would ultimately provide only the +// Read operation for compiler export data, which must be defined in +// this module (golang.org/x/tools), not in the standard library, to +// avoid version skew for developer tools that need to read compiler +// export data both before and after a Go release, such as from Go +// 1.23 to Go 1.24. Because this package lives in the tools module, +// clients can update their version of the module some time before the +// Go 1.24 release and rebuild and redeploy their tools, which will +// then be able to consume both Go 1.23 and Go 1.24 export data files, +// so they will work before and after the Go update. (See discussion +// at https://go.dev/issue/15651.) +// +// The operations to import and export [go/types] data structures +// would be defined in the go/types package as Import and Export. +// [Write] would (eventually) delegate to Export, +// and [Read], when it detects a file produced by Export, +// would delegate to Import. +// +// # Deprecations +// +// The [NewImporter] and [Find] functions are deprecated and should +// not be used in new code. The [WriteBundle] and [ReadBundle] +// functions are experimental, and there is an open proposal to +// deprecate them (https://go.dev/issue/69573). +package gcexportdata import ( "bufio" @@ -64,24 +106,18 @@ func Find(importPath, srcDir string) (filename, path string) { // additional trailing data beyond the end of the export data. func NewReader(r io.Reader) (io.Reader, error) { buf := bufio.NewReader(r) - _, size, err := gcimporter.FindExportData(buf) + size, err := gcimporter.FindExportData(buf) if err != nil { return nil, err } - if size >= 0 { - // We were given an archive and found the __.PKGDEF in it. - // This tells us the size of the export data, and we don't - // need to return the entire file. - return &io.LimitedReader{ - R: buf, - N: size, - }, nil - } else { - // We were given an object file. As such, we don't know how large - // the export data is and must return the entire file. - return buf, nil - } + // We were given an archive and found the __.PKGDEF in it. + // This tells us the size of the export data, and we don't + // need to return the entire file. + return &io.LimitedReader{ + R: buf, + N: size, + }, nil } // readAll works the same way as io.ReadAll, but avoids allocations and copies @@ -100,6 +136,11 @@ func readAll(r io.Reader) ([]byte, error) { // Read reads export data from in, decodes it, and returns type // information for the package. // +// Read is capable of reading export data produced by [Write] at the +// same source code version, or by the last two Go releases (plus tip) +// of the standard Go compiler. Reading files from older compilers may +// produce an error. +// // The package path (effectively its linker symbol prefix) is // specified by path, since unlike the package name, this information // may not be recorded in the export data. @@ -128,14 +169,26 @@ func Read(in io.Reader, fset *token.FileSet, imports map[string]*types.Package, // (from "version"). Select appropriate importer. if len(data) > 0 { switch data[0] { - case 'v', 'c', 'd': // binary, till go1.10 + case 'v', 'c', 'd': + // binary, produced by cmd/compile till go1.10 return nil, fmt.Errorf("binary (%c) import format is no longer supported", data[0]) - case 'i': // indexed, till go1.19 + case 'i': + // indexed, produced by cmd/compile till go1.19, + // and also by [Write]. + // + // If proposal #69491 is accepted, go/types + // serialization will be implemented by + // types.Export, to which Write would eventually + // delegate (explicitly dropping any pretence at + // inter-version Write-Read compatibility). + // This [Read] function would delegate to types.Import + // when it detects that the file was produced by Export. _, pkg, err := gcimporter.IImportData(fset, imports, data[1:], path) return pkg, err - case 'u': // unified, from go1.20 + case 'u': + // unified, produced by cmd/compile since go1.20 _, pkg, err := gcimporter.UImportData(fset, imports, data[1:], path) return pkg, err diff --git a/vendor/golang.org/x/tools/go/packages/external.go b/vendor/golang.org/x/tools/go/packages/external.go index 8f7afcb5df..91bd62e83b 100644 --- a/vendor/golang.org/x/tools/go/packages/external.go +++ b/vendor/golang.org/x/tools/go/packages/external.go @@ -13,6 +13,7 @@ import ( "fmt" "os" "os/exec" + "slices" "strings" ) @@ -79,7 +80,7 @@ type DriverResponse struct { // driver is the type for functions that query the build system for the // packages named by the patterns. -type driver func(cfg *Config, patterns ...string) (*DriverResponse, error) +type driver func(cfg *Config, patterns []string) (*DriverResponse, error) // findExternalDriver returns the file path of a tool that supplies // the build system package structure, or "" if not found. @@ -103,7 +104,7 @@ func findExternalDriver(cfg *Config) driver { return nil } } - return func(cfg *Config, words ...string) (*DriverResponse, error) { + return func(cfg *Config, patterns []string) (*DriverResponse, error) { req, err := json.Marshal(DriverRequest{ Mode: cfg.Mode, Env: cfg.Env, @@ -117,7 +118,7 @@ func findExternalDriver(cfg *Config) driver { buf := new(bytes.Buffer) stderr := new(bytes.Buffer) - cmd := exec.CommandContext(cfg.Context, tool, words...) + cmd := exec.CommandContext(cfg.Context, tool, patterns...) cmd.Dir = cfg.Dir // The cwd gets resolved to the real path. On Darwin, where // /tmp is a symlink, this breaks anything that expects the @@ -131,7 +132,7 @@ func findExternalDriver(cfg *Config) driver { // command. // // (See similar trick in Invocation.run in ../../internal/gocommand/invoke.go) - cmd.Env = append(slicesClip(cfg.Env), "PWD="+cfg.Dir) + cmd.Env = append(slices.Clip(cfg.Env), "PWD="+cfg.Dir) cmd.Stdin = bytes.NewReader(req) cmd.Stdout = buf cmd.Stderr = stderr @@ -150,7 +151,3 @@ func findExternalDriver(cfg *Config) driver { return &response, nil } } - -// slicesClip removes unused capacity from the slice, returning s[:len(s):len(s)]. -// TODO(adonovan): use go1.21 slices.Clip. -func slicesClip[S ~[]E, E any](s S) S { return s[:len(s):len(s)] } diff --git a/vendor/golang.org/x/tools/go/packages/golist.go b/vendor/golang.org/x/tools/go/packages/golist.go index 1a3a5b44f5..870271ed51 100644 --- a/vendor/golang.org/x/tools/go/packages/golist.go +++ b/vendor/golang.org/x/tools/go/packages/golist.go @@ -80,6 +80,12 @@ type golistState struct { cfg *Config ctx context.Context + runner *gocommand.Runner + + // overlay is the JSON file that encodes the Config.Overlay + // mapping, used by 'go list -overlay=...'. + overlay string + envOnce sync.Once goEnvError error goEnv map[string]string @@ -127,7 +133,10 @@ func (state *golistState) mustGetEnv() map[string]string { // goListDriver uses the go list command to interpret the patterns and produce // the build system package structure. // See driver for more details. -func goListDriver(cfg *Config, patterns ...string) (_ *DriverResponse, err error) { +// +// overlay is the JSON file that encodes the cfg.Overlay +// mapping, used by 'go list -overlay=...' +func goListDriver(cfg *Config, runner *gocommand.Runner, overlay string, patterns []string) (_ *DriverResponse, err error) { // Make sure that any asynchronous go commands are killed when we return. parentCtx := cfg.Context if parentCtx == nil { @@ -142,13 +151,15 @@ func goListDriver(cfg *Config, patterns ...string) (_ *DriverResponse, err error cfg: cfg, ctx: ctx, vendorDirs: map[string]bool{}, + overlay: overlay, + runner: runner, } // Fill in response.Sizes asynchronously if necessary. - if cfg.Mode&NeedTypesSizes != 0 || cfg.Mode&NeedTypes != 0 { + if cfg.Mode&NeedTypesSizes != 0 || cfg.Mode&(NeedTypes|NeedTypesInfo) != 0 { errCh := make(chan error) go func() { - compiler, arch, err := getSizesForArgs(ctx, state.cfgInvocation(), cfg.gocmdRunner) + compiler, arch, err := getSizesForArgs(ctx, state.cfgInvocation(), runner) response.dr.Compiler = compiler response.dr.Arch = arch errCh <- err @@ -494,13 +505,14 @@ func (state *golistState) createDriverResponse(words ...string) (*DriverResponse pkg := &Package{ Name: p.Name, ID: p.ImportPath, + Dir: p.Dir, GoFiles: absJoin(p.Dir, p.GoFiles, p.CgoFiles), CompiledGoFiles: absJoin(p.Dir, p.CompiledGoFiles), OtherFiles: absJoin(p.Dir, otherFiles(p)...), EmbedFiles: absJoin(p.Dir, p.EmbedFiles), EmbedPatterns: absJoin(p.Dir, p.EmbedPatterns), IgnoredFiles: absJoin(p.Dir, p.IgnoredGoFiles, p.IgnoredOtherFiles), - forTest: p.ForTest, + ForTest: p.ForTest, depsErrors: p.DepsErrors, Module: p.Module, } @@ -681,7 +693,7 @@ func (state *golistState) shouldAddFilenameFromError(p *jsonPackage) bool { // getGoVersion returns the effective minor version of the go command. func (state *golistState) getGoVersion() (int, error) { state.goVersionOnce.Do(func() { - state.goVersion, state.goVersionError = gocommand.GoVersion(state.ctx, state.cfgInvocation(), state.cfg.gocmdRunner) + state.goVersion, state.goVersionError = gocommand.GoVersion(state.ctx, state.cfgInvocation(), state.runner) }) return state.goVersion, state.goVersionError } @@ -751,7 +763,7 @@ func jsonFlag(cfg *Config, goVersion int) string { } } addFields("Name", "ImportPath", "Error") // These fields are always needed - if cfg.Mode&NeedFiles != 0 || cfg.Mode&NeedTypes != 0 { + if cfg.Mode&NeedFiles != 0 || cfg.Mode&(NeedTypes|NeedTypesInfo) != 0 { addFields("Dir", "GoFiles", "IgnoredGoFiles", "IgnoredOtherFiles", "CFiles", "CgoFiles", "CXXFiles", "MFiles", "HFiles", "FFiles", "SFiles", "SwigFiles", "SwigCXXFiles", "SysoFiles") @@ -759,7 +771,7 @@ func jsonFlag(cfg *Config, goVersion int) string { addFields("TestGoFiles", "XTestGoFiles") } } - if cfg.Mode&NeedTypes != 0 { + if cfg.Mode&(NeedTypes|NeedTypesInfo) != 0 { // CompiledGoFiles seems to be required for the test case TestCgoNoSyntax, // even when -compiled isn't passed in. // TODO(#52435): Should we make the test ask for -compiled, or automatically @@ -784,7 +796,7 @@ func jsonFlag(cfg *Config, goVersion int) string { // Request Dir in the unlikely case Export is not absolute. addFields("Dir", "Export") } - if cfg.Mode&needInternalForTest != 0 { + if cfg.Mode&NeedForTest != 0 { addFields("ForTest") } if cfg.Mode&needInternalDepsErrors != 0 { @@ -840,7 +852,7 @@ func (state *golistState) cfgInvocation() gocommand.Invocation { Env: cfg.Env, Logf: cfg.Logf, WorkingDir: cfg.Dir, - Overlay: cfg.goListOverlayFile, + Overlay: state.overlay, } } @@ -851,11 +863,8 @@ func (state *golistState) invokeGo(verb string, args ...string) (*bytes.Buffer, inv := state.cfgInvocation() inv.Verb = verb inv.Args = args - gocmdRunner := cfg.gocmdRunner - if gocmdRunner == nil { - gocmdRunner = &gocommand.Runner{} - } - stdout, stderr, friendlyErr, err := gocmdRunner.RunRaw(cfg.Context, inv) + + stdout, stderr, friendlyErr, err := state.runner.RunRaw(cfg.Context, inv) if err != nil { // Check for 'go' executable not being found. if ee, ok := err.(*exec.Error); ok && ee.Err == exec.ErrNotFound { @@ -879,6 +888,12 @@ func (state *golistState) invokeGo(verb string, args ...string) (*bytes.Buffer, return nil, friendlyErr } + // Return an error if 'go list' failed due to missing tools in + // $GOROOT/pkg/tool/$GOOS_$GOARCH (#69606). + if len(stderr.String()) > 0 && strings.Contains(stderr.String(), `go: no such tool`) { + return nil, friendlyErr + } + // Is there an error running the C compiler in cgo? This will be reported in the "Error" field // and should be suppressed by go list -e. // diff --git a/vendor/golang.org/x/tools/go/packages/loadmode_string.go b/vendor/golang.org/x/tools/go/packages/loadmode_string.go index 5fcad6ea6d..969da4c263 100644 --- a/vendor/golang.org/x/tools/go/packages/loadmode_string.go +++ b/vendor/golang.org/x/tools/go/packages/loadmode_string.go @@ -23,6 +23,7 @@ var modes = [...]struct { {NeedSyntax, "NeedSyntax"}, {NeedTypesInfo, "NeedTypesInfo"}, {NeedTypesSizes, "NeedTypesSizes"}, + {NeedForTest, "NeedForTest"}, {NeedModule, "NeedModule"}, {NeedEmbedFiles, "NeedEmbedFiles"}, {NeedEmbedPatterns, "NeedEmbedPatterns"}, diff --git a/vendor/golang.org/x/tools/go/packages/packages.go b/vendor/golang.org/x/tools/go/packages/packages.go index f227f1bab1..9dedf9777d 100644 --- a/vendor/golang.org/x/tools/go/packages/packages.go +++ b/vendor/golang.org/x/tools/go/packages/packages.go @@ -16,13 +16,13 @@ import ( "go/scanner" "go/token" "go/types" - "io" "log" "os" "path/filepath" "runtime" "strings" "sync" + "sync/atomic" "time" "golang.org/x/sync/errgroup" @@ -31,7 +31,6 @@ import ( "golang.org/x/tools/internal/gocommand" "golang.org/x/tools/internal/packagesinternal" "golang.org/x/tools/internal/typesinternal" - "golang.org/x/tools/internal/versions" ) // A LoadMode controls the amount of detail to return when loading. @@ -44,6 +43,20 @@ import ( // ID and Errors (if present) will always be filled. // [Load] may return more information than requested. // +// The Mode flag is a union of several bits named NeedName, +// NeedFiles, and so on, each of which determines whether +// a given field of Package (Name, Files, etc) should be +// populated. +// +// For convenience, we provide named constants for the most +// common combinations of Need flags: +// +// [LoadFiles] lists of files in each package +// [LoadImports] ... plus imports +// [LoadTypes] ... plus type information +// [LoadSyntax] ... plus type-annotated syntax +// [LoadAllSyntax] ... for all dependencies +// // Unfortunately there are a number of open bugs related to // interactions among the LoadMode bits: // - https://github.com/golang/go/issues/56633 @@ -56,7 +69,7 @@ const ( // NeedName adds Name and PkgPath. NeedName LoadMode = 1 << iota - // NeedFiles adds GoFiles and OtherFiles. + // NeedFiles adds Dir, GoFiles, OtherFiles, and IgnoredFiles NeedFiles // NeedCompiledGoFiles adds CompiledGoFiles. @@ -78,7 +91,7 @@ const ( // NeedSyntax adds Syntax and Fset. NeedSyntax - // NeedTypesInfo adds TypesInfo. + // NeedTypesInfo adds TypesInfo and Fset. NeedTypesInfo // NeedTypesSizes adds TypesSizes. @@ -87,9 +100,10 @@ const ( // needInternalDepsErrors adds the internal deps errors field for use by gopls. needInternalDepsErrors - // needInternalForTest adds the internal forTest field. + // NeedForTest adds ForTest. + // // Tests must also be set on the context for this field to be populated. - needInternalForTest + NeedForTest // typecheckCgo enables full support for type checking cgo. Requires Go 1.15+. // Modifies CompiledGoFiles and Types, and has no effect on its own. @@ -109,33 +123,18 @@ const ( const ( // LoadFiles loads the name and file names for the initial packages. - // - // Deprecated: LoadFiles exists for historical compatibility - // and should not be used. Please directly specify the needed fields using the Need values. LoadFiles = NeedName | NeedFiles | NeedCompiledGoFiles // LoadImports loads the name, file names, and import mapping for the initial packages. - // - // Deprecated: LoadImports exists for historical compatibility - // and should not be used. Please directly specify the needed fields using the Need values. LoadImports = LoadFiles | NeedImports // LoadTypes loads exported type information for the initial packages. - // - // Deprecated: LoadTypes exists for historical compatibility - // and should not be used. Please directly specify the needed fields using the Need values. LoadTypes = LoadImports | NeedTypes | NeedTypesSizes // LoadSyntax loads typed syntax for the initial packages. - // - // Deprecated: LoadSyntax exists for historical compatibility - // and should not be used. Please directly specify the needed fields using the Need values. LoadSyntax = LoadTypes | NeedSyntax | NeedTypesInfo // LoadAllSyntax loads typed syntax for the initial packages and all dependencies. - // - // Deprecated: LoadAllSyntax exists for historical compatibility - // and should not be used. Please directly specify the needed fields using the Need values. LoadAllSyntax = LoadSyntax | NeedDeps // Deprecated: NeedExportsFile is a historical misspelling of NeedExportFile. @@ -145,13 +144,7 @@ const ( // A Config specifies details about how packages should be loaded. // The zero value is a valid configuration. // -// Calls to Load do not modify this struct. -// -// TODO(adonovan): #67702: this is currently false: in fact, -// calls to [Load] do not modify the public fields of this struct, but -// may modify hidden fields, so concurrent calls to [Load] must not -// use the same Config. But perhaps we should reestablish the -// documented invariant. +// Calls to [Load] do not modify this struct. type Config struct { // Mode controls the level of information returned for each package. Mode LoadMode @@ -182,19 +175,10 @@ type Config struct { // Env []string - // gocmdRunner guards go command calls from concurrency errors. - gocmdRunner *gocommand.Runner - // BuildFlags is a list of command-line flags to be passed through to // the build system's query tool. BuildFlags []string - // modFile will be used for -modfile in go command invocations. - modFile string - - // modFlag will be used for -modfile in go command invocations. - modFlag string - // Fset provides source position information for syntax trees and types. // If Fset is nil, Load will use a new fileset, but preserve Fset's value. Fset *token.FileSet @@ -241,9 +225,13 @@ type Config struct { // drivers may vary in their level of support for overlays. Overlay map[string][]byte - // goListOverlayFile is the JSON file that encodes the Overlay - // mapping, used by 'go list -overlay=...' - goListOverlayFile string + // -- Hidden configuration fields only for use in x/tools -- + + // modFile will be used for -modfile in go command invocations. + modFile string + + // modFlag will be used for -modfile in go command invocations. + modFlag string } // Load loads and returns the Go packages named by the given patterns. @@ -334,21 +322,24 @@ func defaultDriver(cfg *Config, patterns ...string) (*DriverResponse, bool, erro } else if !response.NotHandled { return response, true, nil } - // (fall through) + // not handled: fall through } // go list fallback - // + // Write overlays once, as there are many calls // to 'go list' (one per chunk plus others too). - overlay, cleanupOverlay, err := gocommand.WriteOverlays(cfg.Overlay) + overlayFile, cleanupOverlay, err := gocommand.WriteOverlays(cfg.Overlay) if err != nil { return nil, false, err } defer cleanupOverlay() - cfg.goListOverlayFile = overlay - response, err := callDriverOnChunks(goListDriver, cfg, chunks) + var runner gocommand.Runner // (shared across many 'go list' calls) + driver := func(cfg *Config, patterns []string) (*DriverResponse, error) { + return goListDriver(cfg, &runner, overlayFile, patterns) + } + response, err := callDriverOnChunks(driver, cfg, chunks) if err != nil { return nil, false, err } @@ -386,16 +377,14 @@ func splitIntoChunks(patterns []string, argMax int) ([][]string, error) { func callDriverOnChunks(driver driver, cfg *Config, chunks [][]string) (*DriverResponse, error) { if len(chunks) == 0 { - return driver(cfg) + return driver(cfg, nil) } responses := make([]*DriverResponse, len(chunks)) errNotHandled := errors.New("driver returned NotHandled") var g errgroup.Group for i, chunk := range chunks { - i := i - chunk := chunk g.Go(func() (err error) { - responses[i], err = driver(cfg, chunk...) + responses[i], err = driver(cfg, chunk) if responses[i] != nil && responses[i].NotHandled { err = errNotHandled } @@ -445,6 +434,12 @@ type Package struct { // PkgPath is the package path as used by the go/types package. PkgPath string + // Dir is the directory associated with the package, if it exists. + // + // For packages listed by the go command, this is the directory containing + // the package files. + Dir string + // Errors contains any errors encountered querying the metadata // of the package, or while parsing or type-checking its files. Errors []Error @@ -532,8 +527,8 @@ type Package struct { // -- internal -- - // forTest is the package under test, if any. - forTest string + // ForTest is the package under test, if any. + ForTest string // depsErrors is the DepsErrors field from the go list response, if any. depsErrors []*packagesinternal.PackageError @@ -562,9 +557,6 @@ type ModuleError struct { } func init() { - packagesinternal.GetForTest = func(p interface{}) string { - return p.(*Package).forTest - } packagesinternal.GetDepsErrors = func(p interface{}) []*packagesinternal.PackageError { return p.(*Package).depsErrors } @@ -576,7 +568,6 @@ func init() { } packagesinternal.TypecheckCgo = int(typecheckCgo) packagesinternal.DepsErrors = int(needInternalDepsErrors) - packagesinternal.ForTest = int(needInternalForTest) } // An Error describes a problem with a package's metadata, syntax, or types. @@ -692,18 +683,19 @@ func (p *Package) String() string { return p.ID } // loaderPackage augments Package with state used during the loading phase type loaderPackage struct { *Package - importErrors map[string]error // maps each bad import to its error - loadOnce sync.Once - color uint8 // for cycle detection - needsrc bool // load from source (Mode >= LoadTypes) - needtypes bool // type information is either requested or depended on - initial bool // package was matched by a pattern - goVersion int // minor version number of go command on PATH + importErrors map[string]error // maps each bad import to its error + preds []*loaderPackage // packages that import this one + unfinishedSuccs atomic.Int32 // number of direct imports not yet loaded + color uint8 // for cycle detection + needsrc bool // load from source (Mode >= LoadTypes) + needtypes bool // type information is either requested or depended on + initial bool // package was matched by a pattern + goVersion int // minor version number of go command on PATH } // loader holds the working state of a single call to load. type loader struct { - pkgs map[string]*loaderPackage + pkgs map[string]*loaderPackage // keyed by Package.ID Config sizes types.Sizes // non-nil if needed by mode parseCache map[string]*parseValue @@ -749,9 +741,6 @@ func newLoader(cfg *Config) *loader { if ld.Config.Env == nil { ld.Config.Env = os.Environ() } - if ld.Config.gocmdRunner == nil { - ld.Config.gocmdRunner = &gocommand.Runner{} - } if ld.Context == nil { ld.Context = context.Background() } @@ -765,7 +754,7 @@ func newLoader(cfg *Config) *loader { ld.requestedMode = ld.Mode ld.Mode = impliedLoadMode(ld.Mode) - if ld.Mode&NeedTypes != 0 || ld.Mode&NeedSyntax != 0 { + if ld.Mode&(NeedSyntax|NeedTypes|NeedTypesInfo) != 0 { if ld.Fset == nil { ld.Fset = token.NewFileSet() } @@ -806,7 +795,7 @@ func (ld *loader) refine(response *DriverResponse) ([]*Package, error) { exportDataInvalid := len(ld.Overlay) > 0 || pkg.ExportFile == "" && pkg.PkgPath != "unsafe" // This package needs type information if the caller requested types and the package is // either a root, or it's a non-root and the user requested dependencies ... - needtypes := (ld.Mode&NeedTypes|NeedTypesInfo != 0 && (rootIndex >= 0 || ld.Mode&NeedDeps != 0)) + needtypes := (ld.Mode&(NeedTypes|NeedTypesInfo) != 0 && (rootIndex >= 0 || ld.Mode&NeedDeps != 0)) // This package needs source if the call requested source (or types info, which implies source) // and the package is either a root, or itas a non- root and the user requested dependencies... needsrc := ((ld.Mode&(NeedSyntax|NeedTypesInfo) != 0 && (rootIndex >= 0 || ld.Mode&NeedDeps != 0)) || @@ -831,9 +820,10 @@ func (ld *loader) refine(response *DriverResponse) ([]*Package, error) { } } - if ld.Mode&NeedImports != 0 { - // Materialize the import graph. - + // Materialize the import graph if it is needed (NeedImports), + // or if we'll be using loadPackages (Need{Syntax|Types|TypesInfo}). + var leaves []*loaderPackage // packages with no unfinished successors + if ld.Mode&(NeedImports|NeedSyntax|NeedTypes|NeedTypesInfo) != 0 { const ( white = 0 // new grey = 1 // in progress @@ -852,63 +842,76 @@ func (ld *loader) refine(response *DriverResponse) ([]*Package, error) { // dependency on a package that does. These are the only packages // for which we load source code. var stack []*loaderPackage - var visit func(lpkg *loaderPackage) bool - visit = func(lpkg *loaderPackage) bool { - switch lpkg.color { - case black: - return lpkg.needsrc - case grey: + var visit func(from, lpkg *loaderPackage) bool + visit = func(from, lpkg *loaderPackage) bool { + if lpkg.color == grey { panic("internal error: grey node") } - lpkg.color = grey - stack = append(stack, lpkg) // push - stubs := lpkg.Imports // the structure form has only stubs with the ID in the Imports - lpkg.Imports = make(map[string]*Package, len(stubs)) - for importPath, ipkg := range stubs { - var importErr error - imp := ld.pkgs[ipkg.ID] - if imp == nil { - // (includes package "C" when DisableCgo) - importErr = fmt.Errorf("missing package: %q", ipkg.ID) - } else if imp.color == grey { - importErr = fmt.Errorf("import cycle: %s", stack) + if lpkg.color == white { + lpkg.color = grey + stack = append(stack, lpkg) // push + stubs := lpkg.Imports // the structure form has only stubs with the ID in the Imports + lpkg.Imports = make(map[string]*Package, len(stubs)) + for importPath, ipkg := range stubs { + var importErr error + imp := ld.pkgs[ipkg.ID] + if imp == nil { + // (includes package "C" when DisableCgo) + importErr = fmt.Errorf("missing package: %q", ipkg.ID) + } else if imp.color == grey { + importErr = fmt.Errorf("import cycle: %s", stack) + } + if importErr != nil { + if lpkg.importErrors == nil { + lpkg.importErrors = make(map[string]error) + } + lpkg.importErrors[importPath] = importErr + continue + } + + if visit(lpkg, imp) { + lpkg.needsrc = true + } + lpkg.Imports[importPath] = imp.Package } - if importErr != nil { - if lpkg.importErrors == nil { - lpkg.importErrors = make(map[string]error) + + // -- postorder -- + + // Complete type information is required for the + // immediate dependencies of each source package. + if lpkg.needsrc && ld.Mode&NeedTypes != 0 { + for _, ipkg := range lpkg.Imports { + ld.pkgs[ipkg.ID].needtypes = true } - lpkg.importErrors[importPath] = importErr - continue } - if visit(imp) { - lpkg.needsrc = true + // NeedTypeSizes causes TypeSizes to be set even + // on packages for which types aren't needed. + if ld.Mode&NeedTypesSizes != 0 { + lpkg.TypesSizes = ld.sizes } - lpkg.Imports[importPath] = imp.Package - } - // Complete type information is required for the - // immediate dependencies of each source package. - if lpkg.needsrc && ld.Mode&NeedTypes != 0 { - for _, ipkg := range lpkg.Imports { - ld.pkgs[ipkg.ID].needtypes = true + // Add packages with no imports directly to the queue of leaves. + if len(lpkg.Imports) == 0 { + leaves = append(leaves, lpkg) } + + stack = stack[:len(stack)-1] // pop + lpkg.color = black } - // NeedTypeSizes causes TypeSizes to be set even - // on packages for which types aren't needed. - if ld.Mode&NeedTypesSizes != 0 { - lpkg.TypesSizes = ld.sizes + // Add edge from predecessor. + if from != nil { + from.unfinishedSuccs.Add(+1) // incref + lpkg.preds = append(lpkg.preds, from) } - stack = stack[:len(stack)-1] // pop - lpkg.color = black return lpkg.needsrc } // For each initial package, create its import DAG. for _, lpkg := range initial { - visit(lpkg) + visit(nil, lpkg) } } else { @@ -921,16 +924,45 @@ func (ld *loader) refine(response *DriverResponse) ([]*Package, error) { // Load type data and syntax if needed, starting at // the initial packages (roots of the import DAG). - if ld.Mode&NeedTypes != 0 || ld.Mode&NeedSyntax != 0 { - var wg sync.WaitGroup - for _, lpkg := range initial { - wg.Add(1) - go func(lpkg *loaderPackage) { - ld.loadRecursive(lpkg) - wg.Done() - }(lpkg) + if ld.Mode&(NeedSyntax|NeedTypes|NeedTypesInfo) != 0 { + + // We avoid using g.SetLimit to limit concurrency as + // it makes g.Go stop accepting work, which prevents + // workers from enqeuing, and thus finishing, and thus + // allowing the group to make progress: deadlock. + // + // Instead we use the ioLimit and cpuLimit semaphores. + g, _ := errgroup.WithContext(ld.Context) + + // enqueues adds a package to the type-checking queue. + // It must have no unfinished successors. + var enqueue func(*loaderPackage) + enqueue = func(lpkg *loaderPackage) { + g.Go(func() error { + // Parse and type-check. + ld.loadPackage(lpkg) + + // Notify each waiting predecessor, + // and enqueue it when it becomes a leaf. + for _, pred := range lpkg.preds { + if pred.unfinishedSuccs.Add(-1) == 0 { // decref + enqueue(pred) + } + } + + return nil + }) + } + + // Load leaves first, adding new packages + // to the queue as they become leaves. + for _, leaf := range leaves { + enqueue(leaf) + } + + if err := g.Wait(); err != nil { + return nil, err // cancelled } - wg.Wait() } // If the context is done, return its error and @@ -977,7 +1009,7 @@ func (ld *loader) refine(response *DriverResponse) ([]*Package, error) { if ld.requestedMode&NeedSyntax == 0 { ld.pkgs[i].Syntax = nil } - if ld.requestedMode&NeedTypes == 0 && ld.requestedMode&NeedSyntax == 0 { + if ld.requestedMode&(NeedSyntax|NeedTypes|NeedTypesInfo) == 0 { ld.pkgs[i].Fset = nil } if ld.requestedMode&NeedTypesInfo == 0 { @@ -994,31 +1026,10 @@ func (ld *loader) refine(response *DriverResponse) ([]*Package, error) { return result, nil } -// loadRecursive loads the specified package and its dependencies, -// recursively, in parallel, in topological order. -// It is atomic and idempotent. -// Precondition: ld.Mode&NeedTypes. -func (ld *loader) loadRecursive(lpkg *loaderPackage) { - lpkg.loadOnce.Do(func() { - // Load the direct dependencies, in parallel. - var wg sync.WaitGroup - for _, ipkg := range lpkg.Imports { - imp := ld.pkgs[ipkg.ID] - wg.Add(1) - go func(imp *loaderPackage) { - ld.loadRecursive(imp) - wg.Done() - }(imp) - } - wg.Wait() - ld.loadPackage(lpkg) - }) -} - -// loadPackage loads the specified package. +// loadPackage loads/parses/typechecks the specified package. // It must be called only once per Package, // after immediate dependencies are loaded. -// Precondition: ld.Mode & NeedTypes. +// Precondition: ld.Mode&(NeedSyntax|NeedTypes|NeedTypesInfo) != 0. func (ld *loader) loadPackage(lpkg *loaderPackage) { if lpkg.PkgPath == "unsafe" { // Fill in the blanks to avoid surprises. @@ -1054,6 +1065,10 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) { if !lpkg.needtypes && !lpkg.needsrc { return } + + // TODO(adonovan): this condition looks wrong: + // I think it should be lpkg.needtypes && !lpg.needsrc, + // so that NeedSyntax without NeedTypes can be satisfied by export data. if !lpkg.needsrc { if err := ld.loadFromExportData(lpkg); err != nil { lpkg.Errors = append(lpkg.Errors, Error{ @@ -1159,7 +1174,7 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) { } lpkg.Syntax = files - if ld.Config.Mode&NeedTypes == 0 { + if ld.Config.Mode&(NeedTypes|NeedTypesInfo) == 0 { return } @@ -1170,16 +1185,20 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) { return } - lpkg.TypesInfo = &types.Info{ - Types: make(map[ast.Expr]types.TypeAndValue), - Defs: make(map[*ast.Ident]types.Object), - Uses: make(map[*ast.Ident]types.Object), - Implicits: make(map[ast.Node]types.Object), - Instances: make(map[*ast.Ident]types.Instance), - Scopes: make(map[ast.Node]*types.Scope), - Selections: make(map[*ast.SelectorExpr]*types.Selection), + // Populate TypesInfo only if needed, as it + // causes the type checker to work much harder. + if ld.Config.Mode&NeedTypesInfo != 0 { + lpkg.TypesInfo = &types.Info{ + Types: make(map[ast.Expr]types.TypeAndValue), + Defs: make(map[*ast.Ident]types.Object), + Uses: make(map[*ast.Ident]types.Object), + Implicits: make(map[ast.Node]types.Object), + Instances: make(map[*ast.Ident]types.Instance), + Scopes: make(map[ast.Node]*types.Scope), + Selections: make(map[*ast.SelectorExpr]*types.Selection), + FileVersions: make(map[*ast.File]string), + } } - versions.InitFileVersions(lpkg.TypesInfo) lpkg.TypesSizes = ld.sizes importer := importerFunc(func(path string) (*types.Package, error) { @@ -1232,6 +1251,10 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) { } } + // Type-checking is CPU intensive. + cpuLimit <- unit{} // acquire a token + defer func() { <-cpuLimit }() // release a token + typErr := types.NewChecker(tc, ld.Fset, lpkg.Types, lpkg.TypesInfo).Files(lpkg.Syntax) lpkg.importErrors = nil // no longer needed @@ -1296,8 +1319,11 @@ type importerFunc func(path string) (*types.Package, error) func (f importerFunc) Import(path string) (*types.Package, error) { return f(path) } // We use a counting semaphore to limit -// the number of parallel I/O calls per process. -var ioLimit = make(chan bool, 20) +// the number of parallel I/O calls or CPU threads per process. +var ( + ioLimit = make(chan unit, 20) + cpuLimit = make(chan unit, runtime.GOMAXPROCS(0)) +) func (ld *loader) parseFile(filename string) (*ast.File, error) { ld.parseCacheMu.Lock() @@ -1314,20 +1340,28 @@ func (ld *loader) parseFile(filename string) (*ast.File, error) { var src []byte for f, contents := range ld.Config.Overlay { + // TODO(adonovan): Inefficient for large overlays. + // Do an exact name-based map lookup + // (for nonexistent files) followed by a + // FileID-based map lookup (for existing ones). if sameFile(f, filename) { src = contents + break } } var err error if src == nil { - ioLimit <- true // wait + ioLimit <- unit{} // acquire a token src, err = os.ReadFile(filename) - <-ioLimit // signal + <-ioLimit // release a token } if err != nil { v.err = err } else { + // Parsing is CPU intensive. + cpuLimit <- unit{} // acquire a token v.f, v.err = ld.ParseFile(ld.Fset, filename, src) + <-cpuLimit // release a token } close(v.ready) @@ -1342,18 +1376,21 @@ func (ld *loader) parseFile(filename string) (*ast.File, error) { // Because files are scanned in parallel, the token.Pos // positions of the resulting ast.Files are not ordered. func (ld *loader) parseFiles(filenames []string) ([]*ast.File, []error) { - var wg sync.WaitGroup - n := len(filenames) - parsed := make([]*ast.File, n) - errors := make([]error, n) - for i, file := range filenames { - wg.Add(1) - go func(i int, filename string) { + var ( + n = len(filenames) + parsed = make([]*ast.File, n) + errors = make([]error, n) + ) + var g errgroup.Group + for i, filename := range filenames { + // This creates goroutines unnecessarily in the + // cache-hit case, but that case is uncommon. + g.Go(func() error { parsed[i], errors[i] = ld.parseFile(filename) - wg.Done() - }(i, file) + return nil + }) } - wg.Wait() + g.Wait() // Eliminate nils, preserving order. var o int @@ -1524,4 +1561,4 @@ func usesExportData(cfg *Config) bool { return cfg.Mode&NeedExportFile != 0 || cfg.Mode&NeedTypes != 0 && cfg.Mode&NeedDeps == 0 } -var _ interface{} = io.Discard // assert build toolchain is go1.16 or later +type unit struct{} diff --git a/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go b/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go index a70b727f2c..16ed3c1780 100644 --- a/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go +++ b/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go @@ -281,25 +281,25 @@ func (enc *Encoder) For(obj types.Object) (Path, error) { T := o.Type() if alias, ok := T.(*types.Alias); ok { - if r := findTypeParam(obj, aliases.TypeParams(alias), path, opTypeParam, nil); r != nil { + if r := findTypeParam(obj, aliases.TypeParams(alias), path, opTypeParam); r != nil { return Path(r), nil } - if r := find(obj, aliases.Rhs(alias), append(path, opRhs), nil); r != nil { + if r := find(obj, aliases.Rhs(alias), append(path, opRhs)); r != nil { return Path(r), nil } } else if tname.IsAlias() { // legacy alias - if r := find(obj, T, path, nil); r != nil { + if r := find(obj, T, path); r != nil { return Path(r), nil } } else if named, ok := T.(*types.Named); ok { // defined (named) type - if r := findTypeParam(obj, named.TypeParams(), path, opTypeParam, nil); r != nil { + if r := findTypeParam(obj, named.TypeParams(), path, opTypeParam); r != nil { return Path(r), nil } - if r := find(obj, named.Underlying(), append(path, opUnderlying), nil); r != nil { + if r := find(obj, named.Underlying(), append(path, opUnderlying)); r != nil { return Path(r), nil } } @@ -312,7 +312,7 @@ func (enc *Encoder) For(obj types.Object) (Path, error) { if _, ok := o.(*types.TypeName); !ok { if o.Exported() { // exported non-type (const, var, func) - if r := find(obj, o.Type(), append(path, opType), nil); r != nil { + if r := find(obj, o.Type(), append(path, opType)); r != nil { return Path(r), nil } } @@ -332,7 +332,7 @@ func (enc *Encoder) For(obj types.Object) (Path, error) { if m == obj { return Path(path2), nil // found declared method } - if r := find(obj, m.Type(), append(path2, opType), nil); r != nil { + if r := find(obj, m.Type(), append(path2, opType)); r != nil { return Path(r), nil } } @@ -447,46 +447,64 @@ func (enc *Encoder) concreteMethod(meth *types.Func) (Path, bool) { // // The seen map is used to short circuit cycles through type parameters. If // nil, it will be allocated as necessary. -func find(obj types.Object, T types.Type, path []byte, seen map[*types.TypeName]bool) []byte { +// +// The seenMethods map is used internally to short circuit cycles through +// interface methods, such as occur in the following example: +// +// type I interface { f() interface{I} } +// +// See golang/go#68046 for details. +func find(obj types.Object, T types.Type, path []byte) []byte { + return (&finder{obj: obj}).find(T, path) +} + +// finder closes over search state for a call to find. +type finder struct { + obj types.Object // the sought object + seenTParamNames map[*types.TypeName]bool // for cycle breaking through type parameters + seenMethods map[*types.Func]bool // for cycle breaking through recursive interfaces +} + +func (f *finder) find(T types.Type, path []byte) []byte { switch T := T.(type) { case *types.Alias: - return find(obj, types.Unalias(T), path, seen) + return f.find(types.Unalias(T), path) case *types.Basic, *types.Named: // Named types belonging to pkg were handled already, // so T must belong to another package. No path. return nil case *types.Pointer: - return find(obj, T.Elem(), append(path, opElem), seen) + return f.find(T.Elem(), append(path, opElem)) case *types.Slice: - return find(obj, T.Elem(), append(path, opElem), seen) + return f.find(T.Elem(), append(path, opElem)) case *types.Array: - return find(obj, T.Elem(), append(path, opElem), seen) + return f.find(T.Elem(), append(path, opElem)) case *types.Chan: - return find(obj, T.Elem(), append(path, opElem), seen) + return f.find(T.Elem(), append(path, opElem)) case *types.Map: - if r := find(obj, T.Key(), append(path, opKey), seen); r != nil { + if r := f.find(T.Key(), append(path, opKey)); r != nil { return r } - return find(obj, T.Elem(), append(path, opElem), seen) + return f.find(T.Elem(), append(path, opElem)) case *types.Signature: - if r := findTypeParam(obj, T.RecvTypeParams(), path, opRecvTypeParam, nil); r != nil { + if r := f.findTypeParam(T.RecvTypeParams(), path, opRecvTypeParam); r != nil { return r } - if r := findTypeParam(obj, T.TypeParams(), path, opTypeParam, seen); r != nil { + if r := f.findTypeParam(T.TypeParams(), path, opTypeParam); r != nil { return r } - if r := find(obj, T.Params(), append(path, opParams), seen); r != nil { + if r := f.find(T.Params(), append(path, opParams)); r != nil { return r } - return find(obj, T.Results(), append(path, opResults), seen) + return f.find(T.Results(), append(path, opResults)) case *types.Struct: for i := 0; i < T.NumFields(); i++ { fld := T.Field(i) path2 := appendOpArg(path, opField, i) - if fld == obj { + if fld == f.obj { return path2 // found field var } - if r := find(obj, fld.Type(), append(path2, opType), seen); r != nil { + if r := f.find(fld.Type(), append(path2, opType)); r != nil { return r } } @@ -495,10 +513,10 @@ func find(obj types.Object, T types.Type, path []byte, seen map[*types.TypeName] for i := 0; i < T.Len(); i++ { v := T.At(i) path2 := appendOpArg(path, opAt, i) - if v == obj { + if v == f.obj { return path2 // found param/result var } - if r := find(obj, v.Type(), append(path2, opType), seen); r != nil { + if r := f.find(v.Type(), append(path2, opType)); r != nil { return r } } @@ -506,28 +524,35 @@ func find(obj types.Object, T types.Type, path []byte, seen map[*types.TypeName] case *types.Interface: for i := 0; i < T.NumMethods(); i++ { m := T.Method(i) + if f.seenMethods[m] { + return nil + } path2 := appendOpArg(path, opMethod, i) - if m == obj { + if m == f.obj { return path2 // found interface method } - if r := find(obj, m.Type(), append(path2, opType), seen); r != nil { + if f.seenMethods == nil { + f.seenMethods = make(map[*types.Func]bool) + } + f.seenMethods[m] = true + if r := f.find(m.Type(), append(path2, opType)); r != nil { return r } } return nil case *types.TypeParam: name := T.Obj() - if name == obj { - return append(path, opObj) - } - if seen[name] { + if f.seenTParamNames[name] { return nil } - if seen == nil { - seen = make(map[*types.TypeName]bool) + if name == f.obj { + return append(path, opObj) } - seen[name] = true - if r := find(obj, T.Constraint(), append(path, opConstraint), seen); r != nil { + if f.seenTParamNames == nil { + f.seenTParamNames = make(map[*types.TypeName]bool) + } + f.seenTParamNames[name] = true + if r := f.find(T.Constraint(), append(path, opConstraint)); r != nil { return r } return nil @@ -535,11 +560,15 @@ func find(obj types.Object, T types.Type, path []byte, seen map[*types.TypeName] panic(T) } -func findTypeParam(obj types.Object, list *types.TypeParamList, path []byte, op byte, seen map[*types.TypeName]bool) []byte { +func findTypeParam(obj types.Object, list *types.TypeParamList, path []byte, op byte) []byte { + return (&finder{obj: obj}).findTypeParam(list, path, op) +} + +func (f *finder) findTypeParam(list *types.TypeParamList, path []byte, op byte) []byte { for i := 0; i < list.Len(); i++ { tparam := list.At(i) path2 := appendOpArg(path, op, i) - if r := find(obj, tparam, path2, seen); r != nil { + if r := f.find(tparam, path2); r != nil { return r } } diff --git a/vendor/golang.org/x/tools/internal/gcimporter/exportdata.go b/vendor/golang.org/x/tools/internal/gcimporter/exportdata.go index f6437feb1c..6f5d8a2139 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/exportdata.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/exportdata.go @@ -39,12 +39,15 @@ func readGopackHeader(r *bufio.Reader) (name string, size int64, err error) { } // FindExportData positions the reader r at the beginning of the -// export data section of an underlying GC-created object/archive +// export data section of an underlying cmd/compile created archive // file by reading from it. The reader must be positioned at the -// start of the file before calling this function. The hdr result -// is the string before the export data, either "$$" or "$$B". -// The size result is the length of the export data in bytes, or -1 if not known. -func FindExportData(r *bufio.Reader) (hdr string, size int64, err error) { +// start of the file before calling this function. +// The size result is the length of the export data in bytes. +// +// This function is needed by [gcexportdata.Read], which must +// accept inputs produced by the last two releases of cmd/compile, +// plus tip. +func FindExportData(r *bufio.Reader) (size int64, err error) { // Read first line to make sure this is an object file. line, err := r.ReadSlice('\n') if err != nil { @@ -52,27 +55,32 @@ func FindExportData(r *bufio.Reader) (hdr string, size int64, err error) { return } - if string(line) == "!\n" { - // Archive file. Scan to __.PKGDEF. - var name string - if name, size, err = readGopackHeader(r); err != nil { - return - } + // Is the first line an archive file signature? + if string(line) != "!\n" { + err = fmt.Errorf("not the start of an archive file (%q)", line) + return + } - // First entry should be __.PKGDEF. - if name != "__.PKGDEF" { - err = fmt.Errorf("go archive is missing __.PKGDEF") - return - } + // Archive file. Scan to __.PKGDEF. + var name string + if name, size, err = readGopackHeader(r); err != nil { + return + } + arsize := size - // Read first line of __.PKGDEF data, so that line - // is once again the first line of the input. - if line, err = r.ReadSlice('\n'); err != nil { - err = fmt.Errorf("can't find export data (%v)", err) - return - } - size -= int64(len(line)) + // First entry should be __.PKGDEF. + if name != "__.PKGDEF" { + err = fmt.Errorf("go archive is missing __.PKGDEF") + return + } + + // Read first line of __.PKGDEF data, so that line + // is once again the first line of the input. + if line, err = r.ReadSlice('\n'); err != nil { + err = fmt.Errorf("can't find export data (%v)", err) + return } + size -= int64(len(line)) // Now at __.PKGDEF in archive or still at beginning of file. // Either way, line should begin with "go object ". @@ -81,8 +89,8 @@ func FindExportData(r *bufio.Reader) (hdr string, size int64, err error) { return } - // Skip over object header to export data. - // Begins after first line starting with $$. + // Skip over object headers to get to the export data section header "$$B\n". + // Object headers are lines that do not start with '$'. for line[0] != '$' { if line, err = r.ReadSlice('\n'); err != nil { err = fmt.Errorf("can't find export data (%v)", err) @@ -90,9 +98,18 @@ func FindExportData(r *bufio.Reader) (hdr string, size int64, err error) { } size -= int64(len(line)) } - hdr = string(line) + + // Check for the binary export data section header "$$B\n". + hdr := string(line) + if hdr != "$$B\n" { + err = fmt.Errorf("unknown export data header: %q", hdr) + return + } + // TODO(taking): Remove end-of-section marker "\n$$\n" from size. + if size < 0 { - size = -1 + err = fmt.Errorf("invalid size (%d) in the archive file: %d bytes remain without section headers (recompile package)", arsize, size) + return } return diff --git a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go index e6c5d51f8e..dbbca86043 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go @@ -161,6 +161,8 @@ func FindPkg(path, srcDir string) (filename, id string) { // Import imports a gc-generated package given its import path and srcDir, adds // the corresponding package object to the packages map, and returns the object. // The packages map must contain all packages already imported. +// +// TODO(taking): Import is only used in tests. Move to gcimporter_test. func Import(packages map[string]*types.Package, path, srcDir string, lookup func(path string) (io.ReadCloser, error)) (pkg *types.Package, err error) { var rc io.ReadCloser var filename, id string @@ -210,58 +212,50 @@ func Import(packages map[string]*types.Package, path, srcDir string, lookup func } defer rc.Close() - var hdr string var size int64 buf := bufio.NewReader(rc) - if hdr, size, err = FindExportData(buf); err != nil { + if size, err = FindExportData(buf); err != nil { return } - switch hdr { - case "$$B\n": - var data []byte - data, err = io.ReadAll(buf) - if err != nil { - break - } + var data []byte + data, err = io.ReadAll(buf) + if err != nil { + return + } + if len(data) == 0 { + return nil, fmt.Errorf("no data to load a package from for path %s", id) + } - // TODO(gri): allow clients of go/importer to provide a FileSet. - // Or, define a new standard go/types/gcexportdata package. - fset := token.NewFileSet() - - // Select appropriate importer. - if len(data) > 0 { - switch data[0] { - case 'v', 'c', 'd': - // binary: emitted by cmd/compile till go1.10; obsolete. - return nil, fmt.Errorf("binary (%c) import format is no longer supported", data[0]) - - case 'i': - // indexed: emitted by cmd/compile till go1.19; - // now used only for serializing go/types. - // See https://github.com/golang/go/issues/69491. - _, pkg, err := IImportData(fset, packages, data[1:], id) - return pkg, err - - case 'u': - // unified: emitted by cmd/compile since go1.20. - _, pkg, err := UImportData(fset, packages, data[1:size], id) - return pkg, err - - default: - l := len(data) - if l > 10 { - l = 10 - } - return nil, fmt.Errorf("unexpected export data with prefix %q for path %s", string(data[:l]), id) - } - } + // TODO(gri): allow clients of go/importer to provide a FileSet. + // Or, define a new standard go/types/gcexportdata package. + fset := token.NewFileSet() + + // Select appropriate importer. + switch data[0] { + case 'v', 'c', 'd': + // binary: emitted by cmd/compile till go1.10; obsolete. + return nil, fmt.Errorf("binary (%c) import format is no longer supported", data[0]) + + case 'i': + // indexed: emitted by cmd/compile till go1.19; + // now used only for serializing go/types. + // See https://github.com/golang/go/issues/69491. + _, pkg, err := IImportData(fset, packages, data[1:], id) + return pkg, err + + case 'u': + // unified: emitted by cmd/compile since go1.20. + _, pkg, err := UImportData(fset, packages, data[1:size], id) + return pkg, err default: - err = fmt.Errorf("unknown export data header: %q", hdr) + l := len(data) + if l > 10 { + l = 10 + } + return nil, fmt.Errorf("unexpected export data with prefix %q for path %s", string(data[:l]), id) } - - return } type byPath []*types.Package diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iexport.go b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go index 1e19fbed8e..7dfc31a37d 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/iexport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go @@ -246,6 +246,26 @@ import ( // IExportShallow encodes "shallow" export data for the specified package. // +// For types, we use "shallow" export data. Historically, the Go +// compiler always produced a summary of the types for a given package +// that included types from other packages that it indirectly +// referenced: "deep" export data. This had the advantage that the +// compiler (and analogous tools such as gopls) need only load one +// file per direct import. However, it meant that the files tended to +// get larger based on the level of the package in the import +// graph. For example, higher-level packages in the kubernetes module +// have over 1MB of "deep" export data, even when they have almost no +// content of their own, merely because they mention a major type that +// references many others. In pathological cases the export data was +// 300x larger than the source for a package due to this quadratic +// growth. +// +// "Shallow" export data means that the serialized types describe only +// a single package. If those types mention types from other packages, +// the type checker may need to request additional packages beyond +// just the direct imports. Type information for the entire transitive +// closure of imports is provided (lazily) by the DAG. +// // No promises are made about the encoding other than that it can be decoded by // the same version of IIExportShallow. If you plan to save export data in the // file system, be sure to include a cryptographic digest of the executable in @@ -268,8 +288,8 @@ func IExportShallow(fset *token.FileSet, pkg *types.Package, reportf ReportFunc) } // IImportShallow decodes "shallow" types.Package data encoded by -// IExportShallow in the same executable. This function cannot import data from -// cmd/compile or gcexportdata.Write. +// [IExportShallow] in the same executable. This function cannot import data +// from cmd/compile or gcexportdata.Write. // // The importer calls getPackages to obtain package symbols for all // packages mentioned in the export data, including the one being diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iimport.go b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go index 21908a158b..e260c0e8db 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/iimport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go @@ -558,6 +558,14 @@ type importReader struct { prevColumn int64 } +// markBlack is redefined in iimport_go123.go, to work around golang/go#69912. +// +// If TypeNames are not marked black (in the sense of go/types cycle +// detection), they may be mutated when dot-imported. Fix this by punching a +// hole through the type, when compiling with Go 1.23. (The bug has been fixed +// for 1.24, but the fix was not worth back-porting). +var markBlack = func(name *types.TypeName) {} + func (r *importReader) obj(name string) { tag := r.byte() pos := r.pos() @@ -570,6 +578,7 @@ func (r *importReader) obj(name string) { } typ := r.typ() obj := aliases.NewAlias(r.p.aliases, pos, r.currPkg, name, typ, tparams) + markBlack(obj) // workaround for golang/go#69912 r.declare(obj) case constTag: @@ -590,6 +599,9 @@ func (r *importReader) obj(name string) { // declaration before recursing. obj := types.NewTypeName(pos, r.currPkg, name, nil) named := types.NewNamed(obj, nil, nil) + + markBlack(obj) // workaround for golang/go#69912 + // Declare obj before calling r.tparamList, so the new type name is recognized // if used in the constraint of one of its own typeparams (see #48280). r.declare(obj) diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iimport_go122.go b/vendor/golang.org/x/tools/internal/gcimporter/iimport_go122.go new file mode 100644 index 0000000000..7586bfaca6 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/gcimporter/iimport_go122.go @@ -0,0 +1,53 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.22 && !go1.24 + +package gcimporter + +import ( + "go/token" + "go/types" + "unsafe" +) + +// TODO(rfindley): delete this workaround once go1.24 is assured. + +func init() { + // Update markBlack so that it correctly sets the color + // of imported TypeNames. + // + // See the doc comment for markBlack for details. + + type color uint32 + const ( + white color = iota + black + grey + ) + type object struct { + _ *types.Scope + _ token.Pos + _ *types.Package + _ string + _ types.Type + _ uint32 + color_ color + _ token.Pos + } + type typeName struct { + object + } + + // If the size of types.TypeName changes, this will fail to compile. + const delta = int64(unsafe.Sizeof(typeName{})) - int64(unsafe.Sizeof(types.TypeName{})) + var _ [-delta * delta]int + + markBlack = func(obj *types.TypeName) { + type uP = unsafe.Pointer + var ptr *typeName + *(*uP)(uP(&ptr)) = uP(obj) + ptr.color_ = black + } +} diff --git a/vendor/golang.org/x/tools/internal/imports/fix.go b/vendor/golang.org/x/tools/internal/imports/fix.go index c15108178a..5ae576977a 100644 --- a/vendor/golang.org/x/tools/internal/imports/fix.go +++ b/vendor/golang.org/x/tools/internal/imports/fix.go @@ -27,7 +27,6 @@ import ( "unicode" "unicode/utf8" - "golang.org/x/sync/errgroup" "golang.org/x/tools/go/ast/astutil" "golang.org/x/tools/internal/event" "golang.org/x/tools/internal/gocommand" @@ -91,18 +90,6 @@ type ImportFix struct { Relevance float64 // see pkg } -// An ImportInfo represents a single import statement. -type ImportInfo struct { - ImportPath string // import path, e.g. "crypto/rand". - Name string // import name, e.g. "crand", or "" if none. -} - -// A packageInfo represents what's known about a package. -type packageInfo struct { - name string // real package name, if known. - exports map[string]bool // known exports. -} - // parseOtherFiles parses all the Go files in srcDir except filename, including // test files if filename looks like a test. // @@ -162,8 +149,8 @@ func addGlobals(f *ast.File, globals map[string]bool) { // collectReferences builds a map of selector expressions, from // left hand side (X) to a set of right hand sides (Sel). -func collectReferences(f *ast.File) references { - refs := references{} +func collectReferences(f *ast.File) References { + refs := References{} var visitor visitFn visitor = func(node ast.Node) ast.Visitor { @@ -233,7 +220,7 @@ func (p *pass) findMissingImport(pkg string, syms map[string]bool) *ImportInfo { allFound := true for right := range syms { - if !pkgInfo.exports[right] { + if !pkgInfo.Exports[right] { allFound = false break } @@ -246,11 +233,6 @@ func (p *pass) findMissingImport(pkg string, syms map[string]bool) *ImportInfo { return nil } -// references is set of references found in a Go file. The first map key is the -// left hand side of a selector expression, the second key is the right hand -// side, and the value should always be true. -type references map[string]map[string]bool - // A pass contains all the inputs and state necessary to fix a file's imports. // It can be modified in some ways during use; see comments below. type pass struct { @@ -258,27 +240,29 @@ type pass struct { fset *token.FileSet // fset used to parse f and its siblings. f *ast.File // the file being fixed. srcDir string // the directory containing f. - env *ProcessEnv // the environment to use for go commands, etc. - loadRealPackageNames bool // if true, load package names from disk rather than guessing them. - otherFiles []*ast.File // sibling files. + logf func(string, ...any) + source Source // the environment to use for go commands, etc. + loadRealPackageNames bool // if true, load package names from disk rather than guessing them. + otherFiles []*ast.File // sibling files. + goroot string // Intermediate state, generated by load. existingImports map[string][]*ImportInfo - allRefs references - missingRefs references + allRefs References + missingRefs References // Inputs to fix. These can be augmented between successive fix calls. lastTry bool // indicates that this is the last call and fix should clean up as best it can. candidates []*ImportInfo // candidate imports in priority order. - knownPackages map[string]*packageInfo // information about all known packages. + knownPackages map[string]*PackageInfo // information about all known packages. } // loadPackageNames saves the package names for everything referenced by imports. -func (p *pass) loadPackageNames(imports []*ImportInfo) error { - if p.env.Logf != nil { - p.env.Logf("loading package names for %v packages", len(imports)) +func (p *pass) loadPackageNames(ctx context.Context, imports []*ImportInfo) error { + if p.logf != nil { + p.logf("loading package names for %v packages", len(imports)) defer func() { - p.env.Logf("done loading package names for %v packages", len(imports)) + p.logf("done loading package names for %v packages", len(imports)) }() } var unknown []string @@ -289,20 +273,17 @@ func (p *pass) loadPackageNames(imports []*ImportInfo) error { unknown = append(unknown, imp.ImportPath) } - resolver, err := p.env.GetResolver() - if err != nil { - return err - } - - names, err := resolver.loadPackageNames(unknown, p.srcDir) + names, err := p.source.LoadPackageNames(ctx, p.srcDir, unknown) if err != nil { return err } + // TODO(rfindley): revisit this. Why do we need to store known packages with + // no exports? The inconsistent data is confusing. for path, name := range names { - p.knownPackages[path] = &packageInfo{ - name: name, - exports: map[string]bool{}, + p.knownPackages[path] = &PackageInfo{ + Name: name, + Exports: map[string]bool{}, } } return nil @@ -330,8 +311,8 @@ func (p *pass) importIdentifier(imp *ImportInfo) string { return imp.Name } known := p.knownPackages[imp.ImportPath] - if known != nil && known.name != "" { - return withoutVersion(known.name) + if known != nil && known.Name != "" { + return withoutVersion(known.Name) } return ImportPathToAssumedName(imp.ImportPath) } @@ -339,9 +320,9 @@ func (p *pass) importIdentifier(imp *ImportInfo) string { // load reads in everything necessary to run a pass, and reports whether the // file already has all the imports it needs. It fills in p.missingRefs with the // file's missing symbols, if any, or removes unused imports if not. -func (p *pass) load() ([]*ImportFix, bool) { - p.knownPackages = map[string]*packageInfo{} - p.missingRefs = references{} +func (p *pass) load(ctx context.Context) ([]*ImportFix, bool) { + p.knownPackages = map[string]*PackageInfo{} + p.missingRefs = References{} p.existingImports = map[string][]*ImportInfo{} // Load basic information about the file in question. @@ -364,9 +345,11 @@ func (p *pass) load() ([]*ImportFix, bool) { // f's imports by the identifier they introduce. imports := collectImports(p.f) if p.loadRealPackageNames { - err := p.loadPackageNames(append(imports, p.candidates...)) + err := p.loadPackageNames(ctx, append(imports, p.candidates...)) if err != nil { - p.env.logf("loading package names: %v", err) + if p.logf != nil { + p.logf("loading package names: %v", err) + } return nil, false } } @@ -535,9 +518,10 @@ func (p *pass) assumeSiblingImportsValid() { // We have the stdlib in memory; no need to guess. rights = symbolNameSet(m) } - p.addCandidate(imp, &packageInfo{ + // TODO(rfindley): we should set package name here, for consistency. + p.addCandidate(imp, &PackageInfo{ // no name; we already know it. - exports: rights, + Exports: rights, }) } } @@ -546,14 +530,14 @@ func (p *pass) assumeSiblingImportsValid() { // addCandidate adds a candidate import to p, and merges in the information // in pkg. -func (p *pass) addCandidate(imp *ImportInfo, pkg *packageInfo) { +func (p *pass) addCandidate(imp *ImportInfo, pkg *PackageInfo) { p.candidates = append(p.candidates, imp) if existing, ok := p.knownPackages[imp.ImportPath]; ok { - if existing.name == "" { - existing.name = pkg.name + if existing.Name == "" { + existing.Name = pkg.Name } - for export := range pkg.exports { - existing.exports[export] = true + for export := range pkg.Exports { + existing.Exports[export] = true } } else { p.knownPackages[imp.ImportPath] = pkg @@ -581,19 +565,42 @@ func fixImportsDefault(fset *token.FileSet, f *ast.File, filename string, env *P // getFixes gets the import fixes that need to be made to f in order to fix the imports. // It does not modify the ast. func getFixes(ctx context.Context, fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) ([]*ImportFix, error) { + source, err := NewProcessEnvSource(env, filename, f.Name.Name) + if err != nil { + return nil, err + } + goEnv, err := env.goEnv() + if err != nil { + return nil, err + } + return getFixesWithSource(ctx, fset, f, filename, goEnv["GOROOT"], env.logf, source) +} + +func getFixesWithSource(ctx context.Context, fset *token.FileSet, f *ast.File, filename string, goroot string, logf func(string, ...any), source Source) ([]*ImportFix, error) { + // This logic is defensively duplicated from getFixes. abs, err := filepath.Abs(filename) if err != nil { return nil, err } srcDir := filepath.Dir(abs) - env.logf("fixImports(filename=%q), abs=%q, srcDir=%q ...", filename, abs, srcDir) + + if logf != nil { + logf("fixImports(filename=%q), srcDir=%q ...", filename, abs, srcDir) + } // First pass: looking only at f, and using the naive algorithm to // derive package names from import paths, see if the file is already // complete. We can't add any imports yet, because we don't know // if missing references are actually package vars. - p := &pass{fset: fset, f: f, srcDir: srcDir, env: env} - if fixes, done := p.load(); done { + p := &pass{ + fset: fset, + f: f, + srcDir: srcDir, + logf: logf, + goroot: goroot, + source: source, + } + if fixes, done := p.load(ctx); done { return fixes, nil } @@ -605,7 +612,7 @@ func getFixes(ctx context.Context, fset *token.FileSet, f *ast.File, filename st // Second pass: add information from other files in the same package, // like their package vars and imports. p.otherFiles = otherFiles - if fixes, done := p.load(); done { + if fixes, done := p.load(ctx); done { return fixes, nil } @@ -618,10 +625,17 @@ func getFixes(ctx context.Context, fset *token.FileSet, f *ast.File, filename st // Third pass: get real package names where we had previously used // the naive algorithm. - p = &pass{fset: fset, f: f, srcDir: srcDir, env: env} + p = &pass{ + fset: fset, + f: f, + srcDir: srcDir, + logf: logf, + goroot: goroot, + source: p.source, // safe to reuse, as it's just a wrapper around env + } p.loadRealPackageNames = true p.otherFiles = otherFiles - if fixes, done := p.load(); done { + if fixes, done := p.load(ctx); done { return fixes, nil } @@ -835,7 +849,7 @@ func GetPackageExports(ctx context.Context, wrapped func(PackageExport), searchP return true }, dirFound: func(pkg *pkg) bool { - return pkgIsCandidate(filename, references{searchPkg: nil}, pkg) + return pkgIsCandidate(filename, References{searchPkg: nil}, pkg) }, packageNameLoaded: func(pkg *pkg) bool { return pkg.packageName == searchPkg @@ -1086,11 +1100,7 @@ func (e *ProcessEnv) invokeGo(ctx context.Context, verb string, args ...string) return e.GocmdRunner.Run(ctx, inv) } -func addStdlibCandidates(pass *pass, refs references) error { - goenv, err := pass.env.goEnv() - if err != nil { - return err - } +func addStdlibCandidates(pass *pass, refs References) error { localbase := func(nm string) string { ans := path.Base(nm) if ans[0] == 'v' { @@ -1105,13 +1115,13 @@ func addStdlibCandidates(pass *pass, refs references) error { } add := func(pkg string) { // Prevent self-imports. - if path.Base(pkg) == pass.f.Name.Name && filepath.Join(goenv["GOROOT"], "src", pkg) == pass.srcDir { + if path.Base(pkg) == pass.f.Name.Name && filepath.Join(pass.goroot, "src", pkg) == pass.srcDir { return } exports := symbolNameSet(stdlib.PackageSymbols[pkg]) pass.addCandidate( &ImportInfo{ImportPath: pkg}, - &packageInfo{name: localbase(pkg), exports: exports}) + &PackageInfo{Name: localbase(pkg), Exports: exports}) } for left := range refs { if left == "rand" { @@ -1175,91 +1185,14 @@ type scanCallback struct { exportsLoaded func(pkg *pkg, exports []stdlib.Symbol) } -func addExternalCandidates(ctx context.Context, pass *pass, refs references, filename string) error { +func addExternalCandidates(ctx context.Context, pass *pass, refs References, filename string) error { ctx, done := event.Start(ctx, "imports.addExternalCandidates") defer done() - var mu sync.Mutex - found := make(map[string][]pkgDistance) - callback := &scanCallback{ - rootFound: func(gopathwalk.Root) bool { - return true // We want everything. - }, - dirFound: func(pkg *pkg) bool { - return pkgIsCandidate(filename, refs, pkg) - }, - packageNameLoaded: func(pkg *pkg) bool { - if _, want := refs[pkg.packageName]; !want { - return false - } - if pkg.dir == pass.srcDir && pass.f.Name.Name == pkg.packageName { - // The candidate is in the same directory and has the - // same package name. Don't try to import ourselves. - return false - } - if !canUse(filename, pkg.dir) { - return false - } - mu.Lock() - defer mu.Unlock() - found[pkg.packageName] = append(found[pkg.packageName], pkgDistance{pkg, distance(pass.srcDir, pkg.dir)}) - return false // We'll do our own loading after we sort. - }, - } - resolver, err := pass.env.GetResolver() + results, err := pass.source.ResolveReferences(ctx, filename, refs) if err != nil { return err } - if err = resolver.scan(ctx, callback); err != nil { - return err - } - - // Search for imports matching potential package references. - type result struct { - imp *ImportInfo - pkg *packageInfo - } - results := make([]*result, len(refs)) - - g, ctx := errgroup.WithContext(ctx) - - searcher := symbolSearcher{ - logf: pass.env.logf, - srcDir: pass.srcDir, - xtest: strings.HasSuffix(pass.f.Name.Name, "_test"), - loadExports: resolver.loadExports, - } - - i := 0 - for pkgName, symbols := range refs { - index := i // claim an index in results - i++ - pkgName := pkgName - symbols := symbols - - g.Go(func() error { - found, err := searcher.search(ctx, found[pkgName], pkgName, symbols) - if err != nil { - return err - } - if found == nil { - return nil // No matching package. - } - - imp := &ImportInfo{ - ImportPath: found.importPathShort, - } - pkg := &packageInfo{ - name: pkgName, - exports: symbols, - } - results[index] = &result{imp, pkg} - return nil - }) - } - if err := g.Wait(); err != nil { - return err - } for _, result := range results { if result == nil { @@ -1267,7 +1200,7 @@ func addExternalCandidates(ctx context.Context, pass *pass, refs references, fil } // Don't offer completions that would shadow predeclared // names, such as github.com/coreos/etcd/error. - if types.Universe.Lookup(result.pkg.name) != nil { // predeclared + if types.Universe.Lookup(result.Package.Name) != nil { // predeclared // Ideally we would skip this candidate only // if the predeclared name is actually // referenced by the file, but that's a lot @@ -1276,7 +1209,7 @@ func addExternalCandidates(ctx context.Context, pass *pass, refs references, fil // user before long. continue } - pass.addCandidate(result.imp, result.pkg) + pass.addCandidate(result.Import, result.Package) } return nil } @@ -1801,7 +1734,7 @@ func (s *symbolSearcher) searchOne(ctx context.Context, c pkgDistance, symbols m // filename is the file being formatted. // pkgIdent is the package being searched for, like "client" (if // searching for "client.New") -func pkgIsCandidate(filename string, refs references, pkg *pkg) bool { +func pkgIsCandidate(filename string, refs References, pkg *pkg) bool { // Check "internal" and "vendor" visibility: if !canUse(filename, pkg.dir) { return false diff --git a/vendor/golang.org/x/tools/internal/imports/imports.go b/vendor/golang.org/x/tools/internal/imports/imports.go index ff6b59a58a..2215a12880 100644 --- a/vendor/golang.org/x/tools/internal/imports/imports.go +++ b/vendor/golang.org/x/tools/internal/imports/imports.go @@ -47,7 +47,14 @@ type Options struct { // Process implements golang.org/x/tools/imports.Process with explicit context in opt.Env. func Process(filename string, src []byte, opt *Options) (formatted []byte, err error) { fileSet := token.NewFileSet() - file, adjust, err := parse(fileSet, filename, src, opt) + var parserMode parser.Mode + if opt.Comments { + parserMode |= parser.ParseComments + } + if opt.AllErrors { + parserMode |= parser.AllErrors + } + file, adjust, err := parse(fileSet, filename, src, parserMode, opt.Fragment) if err != nil { return nil, err } @@ -66,17 +73,19 @@ func Process(filename string, src []byte, opt *Options) (formatted []byte, err e // // Note that filename's directory influences which imports can be chosen, // so it is important that filename be accurate. -func FixImports(ctx context.Context, filename string, src []byte, opt *Options) (fixes []*ImportFix, err error) { +func FixImports(ctx context.Context, filename string, src []byte, goroot string, logf func(string, ...any), source Source) (fixes []*ImportFix, err error) { ctx, done := event.Start(ctx, "imports.FixImports") defer done() fileSet := token.NewFileSet() - file, _, err := parse(fileSet, filename, src, opt) + // TODO(rfindley): these default values for ParseComments and AllErrors were + // extracted from gopls, but are they even needed? + file, _, err := parse(fileSet, filename, src, parser.ParseComments|parser.AllErrors, true) if err != nil { return nil, err } - return getFixes(ctx, fileSet, file, filename, opt.Env) + return getFixesWithSource(ctx, fileSet, file, filename, goroot, logf, source) } // ApplyFixes applies all of the fixes to the file and formats it. extraMode @@ -114,7 +123,7 @@ func ApplyFixes(fixes []*ImportFix, filename string, src []byte, opt *Options, e // formatted file, and returns the postpocessed result. func formatFile(fset *token.FileSet, file *ast.File, src []byte, adjust func(orig []byte, src []byte) []byte, opt *Options) ([]byte, error) { mergeImports(file) - sortImports(opt.LocalPrefix, fset.File(file.Pos()), file) + sortImports(opt.LocalPrefix, fset.File(file.FileStart), file) var spacesBefore []string // import paths we need spaces before for _, impSection := range astutil.Imports(fset, file) { // Within each block of contiguous imports, see if any @@ -164,13 +173,9 @@ func formatFile(fset *token.FileSet, file *ast.File, src []byte, adjust func(ori // parse parses src, which was read from filename, // as a Go source file or statement list. -func parse(fset *token.FileSet, filename string, src []byte, opt *Options) (*ast.File, func(orig, src []byte) []byte, error) { - var parserMode parser.Mode // legacy ast.Object resolution is required here - if opt.Comments { - parserMode |= parser.ParseComments - } - if opt.AllErrors { - parserMode |= parser.AllErrors +func parse(fset *token.FileSet, filename string, src []byte, parserMode parser.Mode, fragment bool) (*ast.File, func(orig, src []byte) []byte, error) { + if parserMode&parser.SkipObjectResolution != 0 { + panic("legacy ast.Object resolution is required") } // Try as whole source file. @@ -181,7 +186,7 @@ func parse(fset *token.FileSet, filename string, src []byte, opt *Options) (*ast // If the error is that the source file didn't begin with a // package line and we accept fragmented input, fall through to // try as a source fragment. Stop and return on any other error. - if !opt.Fragment || !strings.Contains(err.Error(), "expected 'package'") { + if !fragment || !strings.Contains(err.Error(), "expected 'package'") { return nil, nil, err } diff --git a/vendor/golang.org/x/tools/internal/imports/source.go b/vendor/golang.org/x/tools/internal/imports/source.go new file mode 100644 index 0000000000..cbe4f3c5ba --- /dev/null +++ b/vendor/golang.org/x/tools/internal/imports/source.go @@ -0,0 +1,63 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package imports + +import "context" + +// These types document the APIs below. +// +// TODO(rfindley): consider making these defined types rather than aliases. +type ( + ImportPath = string + PackageName = string + Symbol = string + + // References is set of References found in a Go file. The first map key is the + // left hand side of a selector expression, the second key is the right hand + // side, and the value should always be true. + References = map[PackageName]map[Symbol]bool +) + +// A Result satisfies a missing import. +// +// The Import field describes the missing import spec, and the Package field +// summarizes the package exports. +type Result struct { + Import *ImportInfo + Package *PackageInfo +} + +// An ImportInfo represents a single import statement. +type ImportInfo struct { + ImportPath string // import path, e.g. "crypto/rand". + Name string // import name, e.g. "crand", or "" if none. +} + +// A PackageInfo represents what's known about a package. +type PackageInfo struct { + Name string // package name in the package declaration, if known + Exports map[string]bool // set of names of known package level sortSymbols +} + +// A Source provides imports to satisfy unresolved references in the file being +// fixed. +type Source interface { + // LoadPackageNames queries PackageName information for the requested import + // paths, when operating from the provided srcDir. + // + // TODO(rfindley): try to refactor to remove this operation. + LoadPackageNames(ctx context.Context, srcDir string, paths []ImportPath) (map[ImportPath]PackageName, error) + + // ResolveReferences asks the Source for the best package name to satisfy + // each of the missing references, in the context of fixing the given + // filename. + // + // Returns a map from package name to a [Result] for that package name that + // provides the required symbols. Keys may be omitted in the map if no + // candidates satisfy all missing references for that package name. It is up + // to each data source to select the best result for each entry in the + // missing map. + ResolveReferences(ctx context.Context, filename string, missing References) ([]*Result, error) +} diff --git a/vendor/golang.org/x/tools/internal/imports/source_env.go b/vendor/golang.org/x/tools/internal/imports/source_env.go new file mode 100644 index 0000000000..d14abaa319 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/imports/source_env.go @@ -0,0 +1,129 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package imports + +import ( + "context" + "path/filepath" + "strings" + "sync" + + "golang.org/x/sync/errgroup" + "golang.org/x/tools/internal/gopathwalk" +) + +// ProcessEnvSource implements the [Source] interface using the legacy +// [ProcessEnv] abstraction. +type ProcessEnvSource struct { + env *ProcessEnv + srcDir string + filename string + pkgName string +} + +// NewProcessEnvSource returns a [ProcessEnvSource] wrapping the given +// env, to be used for fixing imports in the file with name filename in package +// named pkgName. +func NewProcessEnvSource(env *ProcessEnv, filename, pkgName string) (*ProcessEnvSource, error) { + abs, err := filepath.Abs(filename) + if err != nil { + return nil, err + } + srcDir := filepath.Dir(abs) + return &ProcessEnvSource{ + env: env, + srcDir: srcDir, + filename: filename, + pkgName: pkgName, + }, nil +} + +func (s *ProcessEnvSource) LoadPackageNames(ctx context.Context, srcDir string, unknown []string) (map[string]string, error) { + r, err := s.env.GetResolver() + if err != nil { + return nil, err + } + return r.loadPackageNames(unknown, srcDir) +} + +func (s *ProcessEnvSource) ResolveReferences(ctx context.Context, filename string, refs map[string]map[string]bool) ([]*Result, error) { + var mu sync.Mutex + found := make(map[string][]pkgDistance) + callback := &scanCallback{ + rootFound: func(gopathwalk.Root) bool { + return true // We want everything. + }, + dirFound: func(pkg *pkg) bool { + return pkgIsCandidate(filename, refs, pkg) + }, + packageNameLoaded: func(pkg *pkg) bool { + if _, want := refs[pkg.packageName]; !want { + return false + } + if pkg.dir == s.srcDir && s.pkgName == pkg.packageName { + // The candidate is in the same directory and has the + // same package name. Don't try to import ourselves. + return false + } + if !canUse(filename, pkg.dir) { + return false + } + mu.Lock() + defer mu.Unlock() + found[pkg.packageName] = append(found[pkg.packageName], pkgDistance{pkg, distance(s.srcDir, pkg.dir)}) + return false // We'll do our own loading after we sort. + }, + } + resolver, err := s.env.GetResolver() + if err != nil { + return nil, err + } + if err := resolver.scan(ctx, callback); err != nil { + return nil, err + } + + g, ctx := errgroup.WithContext(ctx) + + searcher := symbolSearcher{ + logf: s.env.logf, + srcDir: s.srcDir, + xtest: strings.HasSuffix(s.pkgName, "_test"), + loadExports: resolver.loadExports, + } + + var resultMu sync.Mutex + results := make(map[string]*Result, len(refs)) + for pkgName, symbols := range refs { + g.Go(func() error { + found, err := searcher.search(ctx, found[pkgName], pkgName, symbols) + if err != nil { + return err + } + if found == nil { + return nil // No matching package. + } + + imp := &ImportInfo{ + ImportPath: found.importPathShort, + } + pkg := &PackageInfo{ + Name: pkgName, + Exports: symbols, + } + resultMu.Lock() + results[pkgName] = &Result{Import: imp, Package: pkg} + resultMu.Unlock() + return nil + }) + } + if err := g.Wait(); err != nil { + return nil, err + } + var ans []*Result + for _, x := range results { + ans = append(ans, x) + } + return ans, nil +} diff --git a/vendor/golang.org/x/tools/internal/imports/source_modindex.go b/vendor/golang.org/x/tools/internal/imports/source_modindex.go new file mode 100644 index 0000000000..05229f06ce --- /dev/null +++ b/vendor/golang.org/x/tools/internal/imports/source_modindex.go @@ -0,0 +1,103 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package imports + +import ( + "context" + "sync" + "time" + + "golang.org/x/tools/internal/modindex" +) + +// This code is here rather than in the modindex package +// to avoid import loops + +// implements Source using modindex, so only for module cache. +// +// this is perhaps over-engineered. A new Index is read at first use. +// And then Update is called after every 15 minutes, and a new Index +// is read if the index changed. It is not clear the Mutex is needed. +type IndexSource struct { + modcachedir string + mutex sync.Mutex + ix *modindex.Index + expires time.Time +} + +// create a new Source. Called from NewView in cache/session.go. +func NewIndexSource(cachedir string) *IndexSource { + return &IndexSource{modcachedir: cachedir} +} + +func (s *IndexSource) LoadPackageNames(ctx context.Context, srcDir string, paths []ImportPath) (map[ImportPath]PackageName, error) { + /// This is used by goimports to resolve the package names of imports of the + // current package, which is irrelevant for the module cache. + return nil, nil +} + +func (s *IndexSource) ResolveReferences(ctx context.Context, filename string, missing References) ([]*Result, error) { + if err := s.maybeReadIndex(); err != nil { + return nil, err + } + var cs []modindex.Candidate + for pkg, nms := range missing { + for nm := range nms { + x := s.ix.Lookup(pkg, nm, false) + cs = append(cs, x...) + } + } + found := make(map[string]*Result) + for _, c := range cs { + var x *Result + if x = found[c.ImportPath]; x == nil { + x = &Result{ + Import: &ImportInfo{ + ImportPath: c.ImportPath, + Name: "", + }, + Package: &PackageInfo{ + Name: c.PkgName, + Exports: make(map[string]bool), + }, + } + found[c.ImportPath] = x + } + x.Package.Exports[c.Name] = true + } + var ans []*Result + for _, x := range found { + ans = append(ans, x) + } + return ans, nil +} + +func (s *IndexSource) maybeReadIndex() error { + s.mutex.Lock() + defer s.mutex.Unlock() + + var readIndex bool + if time.Now().After(s.expires) { + ok, err := modindex.Update(s.modcachedir) + if err != nil { + return err + } + if ok { + readIndex = true + } + } + + if readIndex || s.ix == nil { + ix, err := modindex.ReadIndex(s.modcachedir) + if err != nil { + return err + } + s.ix = ix + // for now refresh every 15 minutes + s.expires = time.Now().Add(time.Minute * 15) + } + + return nil +} diff --git a/vendor/golang.org/x/tools/internal/modindex/directories.go b/vendor/golang.org/x/tools/internal/modindex/directories.go new file mode 100644 index 0000000000..1e1a02f239 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/modindex/directories.go @@ -0,0 +1,135 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package modindex + +import ( + "fmt" + "log" + "os" + "path/filepath" + "regexp" + "slices" + "strings" + "sync" + "time" + + "golang.org/x/mod/semver" + "golang.org/x/tools/internal/gopathwalk" +) + +type directory struct { + path Relpath + importPath string + version string // semantic version + syms []symbol +} + +// filterDirs groups the directories by import path, +// sorting the ones with the same import path by semantic version, +// most recent first. +func byImportPath(dirs []Relpath) (map[string][]*directory, error) { + ans := make(map[string][]*directory) // key is import path + for _, d := range dirs { + ip, sv, err := DirToImportPathVersion(d) + if err != nil { + return nil, err + } + ans[ip] = append(ans[ip], &directory{ + path: d, + importPath: ip, + version: sv, + }) + } + for k, v := range ans { + semanticSort(v) + ans[k] = v + } + return ans, nil +} + +// sort the directories by semantic version, latest first +func semanticSort(v []*directory) { + slices.SortFunc(v, func(l, r *directory) int { + if n := semver.Compare(l.version, r.version); n != 0 { + return -n // latest first + } + return strings.Compare(string(l.path), string(r.path)) + }) +} + +// modCacheRegexp splits a relpathpath into module, module version, and package. +var modCacheRegexp = regexp.MustCompile(`(.*)@([^/\\]*)(.*)`) + +// DirToImportPathVersion computes import path and semantic version +func DirToImportPathVersion(dir Relpath) (string, string, error) { + m := modCacheRegexp.FindStringSubmatch(string(dir)) + // m[1] is the module path + // m[2] is the version major.minor.patch(-

= 4 {
+					sig := strings.Split(flds[3], " ")
+					for i := 0; i < len(sig); i++ {
+						// $ cannot otherwise occur. removing the spaces
+						// almost works, but for chan struct{}, e.g.
+						sig[i] = strings.Replace(sig[i], "$", " ", -1)
+					}
+					px.Sig = toFields(sig)
+				}
+			}
+			ans = append(ans, px)
+		}
+	}
+	return ans
+}
+
+func toFields(sig []string) []Field {
+	ans := make([]Field, len(sig)/2)
+	for i := 0; i < len(ans); i++ {
+		ans[i] = Field{Arg: sig[2*i], Type: sig[2*i+1]}
+	}
+	return ans
+}
+
+// benchmarks show this is measurably better than strings.Split
+func fastSplit(x string) []string {
+	ans := make([]string, 0, 4)
+	nxt := 0
+	start := 0
+	for i := 0; i < len(x); i++ {
+		if x[i] != ' ' {
+			continue
+		}
+		ans = append(ans, x[start:i])
+		nxt++
+		start = i + 1
+		if nxt >= 3 {
+			break
+		}
+	}
+	ans = append(ans, x[start:])
+	return ans
+}
+
+func asLexType(c byte) LexType {
+	switch c {
+	case 'C':
+		return Const
+	case 'V':
+		return Var
+	case 'T':
+		return Type
+	case 'F':
+		return Func
+	}
+	return -1
+}
diff --git a/vendor/golang.org/x/tools/internal/modindex/modindex.go b/vendor/golang.org/x/tools/internal/modindex/modindex.go
new file mode 100644
index 0000000000..355a53e71a
--- /dev/null
+++ b/vendor/golang.org/x/tools/internal/modindex/modindex.go
@@ -0,0 +1,164 @@
+// Copyright 2024 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package modindex contains code for building and searching an index to
+// the Go module cache. The directory containing the index, returned by
+// IndexDir(), contains a file index-name- that contains the name
+// of the current index. We believe writing that short file is atomic.
+// ReadIndex reads that file to get the file name of the index.
+// WriteIndex writes an index with a unique name and then
+// writes that name into a new version of index-name-.
+// ( stands for the CurrentVersion of the index format.)
+package modindex
+
+import (
+	"path/filepath"
+	"slices"
+	"strings"
+	"time"
+
+	"golang.org/x/mod/semver"
+)
+
+// Create always creates a new index for the go module cache that is in cachedir.
+func Create(cachedir string) error {
+	_, err := indexModCache(cachedir, true)
+	return err
+}
+
+// Update the index for the go module cache that is in cachedir,
+// If there is no existing index it will build one.
+// If there are changed directories since the last index, it will
+// write a new one and return true. Otherwise it returns false.
+func Update(cachedir string) (bool, error) {
+	return indexModCache(cachedir, false)
+}
+
+// indexModCache writes an index current as of when it is called.
+// If clear is true the index is constructed from all of GOMODCACHE
+// otherwise the index is constructed from the last previous index
+// and the updates to the cache. It returns true if it wrote an index,
+// false otherwise.
+func indexModCache(cachedir string, clear bool) (bool, error) {
+	cachedir, err := filepath.Abs(cachedir)
+	if err != nil {
+		return false, err
+	}
+	cd := Abspath(cachedir)
+	future := time.Now().Add(24 * time.Hour) // safely in the future
+	ok, err := modindexTimed(future, cd, clear)
+	if err != nil {
+		return false, err
+	}
+	return ok, nil
+}
+
+// modindexTimed writes an index current as of onlyBefore.
+// If clear is true the index is constructed from all of GOMODCACHE
+// otherwise the index is constructed from the last previous index
+// and all the updates to the cache before onlyBefore.
+// It returns true if it wrote a new index, false if it wrote nothing.
+func modindexTimed(onlyBefore time.Time, cachedir Abspath, clear bool) (bool, error) {
+	var curIndex *Index
+	if !clear {
+		var err error
+		curIndex, err = ReadIndex(string(cachedir))
+		if clear && err != nil {
+			return false, err
+		}
+		// TODO(pjw): check that most of those directories still exist
+	}
+	cfg := &work{
+		onlyBefore: onlyBefore,
+		oldIndex:   curIndex,
+		cacheDir:   cachedir,
+	}
+	if curIndex != nil {
+		cfg.onlyAfter = curIndex.Changed
+	}
+	if err := cfg.buildIndex(); err != nil {
+		return false, err
+	}
+	if len(cfg.newIndex.Entries) == 0 && curIndex != nil {
+		// no changes from existing curIndex, don't write a new index
+		return false, nil
+	}
+	if err := cfg.writeIndex(); err != nil {
+		return false, err
+	}
+	return true, nil
+}
+
+type work struct {
+	onlyBefore time.Time // do not use directories later than this
+	onlyAfter  time.Time // only interested in directories after this
+	// directories from before onlyAfter come from oldIndex
+	oldIndex *Index
+	newIndex *Index
+	cacheDir Abspath
+}
+
+func (w *work) buildIndex() error {
+	// The effective date of the new index should be at least
+	// slightly earlier than when the directories are scanned
+	// so set it now.
+	w.newIndex = &Index{Changed: time.Now(), Cachedir: w.cacheDir}
+	dirs := findDirs(string(w.cacheDir), w.onlyAfter, w.onlyBefore)
+	if len(dirs) == 0 {
+		return nil
+	}
+	newdirs, err := byImportPath(dirs)
+	if err != nil {
+		return err
+	}
+	// for each import path it might occur only in newdirs,
+	// only in w.oldIndex, or in both.
+	// If it occurs in both, use the semantically later one
+	if w.oldIndex != nil {
+		for _, e := range w.oldIndex.Entries {
+			found, ok := newdirs[e.ImportPath]
+			if !ok {
+				w.newIndex.Entries = append(w.newIndex.Entries, e)
+				continue // use this one, there is no new one
+			}
+			if semver.Compare(found[0].version, e.Version) > 0 {
+				// use the new one
+			} else {
+				// use the old one, forget the new one
+				w.newIndex.Entries = append(w.newIndex.Entries, e)
+				delete(newdirs, e.ImportPath)
+			}
+		}
+	}
+	// get symbol information for all the new diredtories
+	getSymbols(w.cacheDir, newdirs)
+	// assemble the new index entries
+	for k, v := range newdirs {
+		d := v[0]
+		pkg, names := processSyms(d.syms)
+		if pkg == "" {
+			continue // PJW: does this ever happen?
+		}
+		entry := Entry{
+			PkgName:    pkg,
+			Dir:        d.path,
+			ImportPath: k,
+			Version:    d.version,
+			Names:      names,
+		}
+		w.newIndex.Entries = append(w.newIndex.Entries, entry)
+	}
+	// sort the entries in the new index
+	slices.SortFunc(w.newIndex.Entries, func(l, r Entry) int {
+		if n := strings.Compare(l.PkgName, r.PkgName); n != 0 {
+			return n
+		}
+		return strings.Compare(l.ImportPath, r.ImportPath)
+	})
+	return nil
+}
+
+func (w *work) writeIndex() error {
+	return writeIndex(w.cacheDir, w.newIndex)
+}
diff --git a/vendor/golang.org/x/tools/internal/modindex/symbols.go b/vendor/golang.org/x/tools/internal/modindex/symbols.go
new file mode 100644
index 0000000000..2e285ed996
--- /dev/null
+++ b/vendor/golang.org/x/tools/internal/modindex/symbols.go
@@ -0,0 +1,189 @@
+// Copyright 2024 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package modindex
+
+import (
+	"fmt"
+	"go/ast"
+	"go/parser"
+	"go/token"
+	"go/types"
+	"os"
+	"path/filepath"
+	"slices"
+	"strings"
+
+	"golang.org/x/sync/errgroup"
+)
+
+// The name of a symbol contains information about the symbol:
+//  T for types
+//  C for consts
+//  V for vars
+// and for funcs:  F  ( )*
+// any spaces in  are replaced by $s so that the fields
+// of the name are space separated
+type symbol struct {
+	pkg  string // name of the symbols's package
+	name string // declared name
+	kind string // T, C, V, or F
+	sig  string // signature information, for F
+}
+
+// find the symbols for the best directories
+func getSymbols(cd Abspath, dirs map[string][]*directory) {
+	var g errgroup.Group
+	g.SetLimit(-1) // maybe throttle this some day
+	for _, vv := range dirs {
+		// throttling some day?
+		d := vv[0]
+		g.Go(func() error {
+			thedir := filepath.Join(string(cd), string(d.path))
+			mode := parser.SkipObjectResolution
+
+			fi, err := os.ReadDir(thedir)
+			if err != nil {
+				return nil // log this someday?
+			}
+			for _, fx := range fi {
+				if !strings.HasSuffix(fx.Name(), ".go") || strings.HasSuffix(fx.Name(), "_test.go") {
+					continue
+				}
+				fname := filepath.Join(thedir, fx.Name())
+				tr, err := parser.ParseFile(token.NewFileSet(), fname, nil, mode)
+				if err != nil {
+					continue // ignore errors, someday log them?
+				}
+				d.syms = append(d.syms, getFileExports(tr)...)
+			}
+			return nil
+		})
+	}
+	g.Wait()
+}
+
+func getFileExports(f *ast.File) []symbol {
+	pkg := f.Name.Name
+	if pkg == "main" {
+		return nil
+	}
+	var ans []symbol
+	// should we look for //go:build ignore?
+	for _, decl := range f.Decls {
+		switch decl := decl.(type) {
+		case *ast.FuncDecl:
+			if decl.Recv != nil {
+				// ignore methods, as we are completing package selections
+				continue
+			}
+			name := decl.Name.Name
+			dtype := decl.Type
+			// not looking at dtype.TypeParams. That is, treating
+			// generic functions just like non-generic ones.
+			sig := dtype.Params
+			kind := "F"
+			result := []string{fmt.Sprintf("%d", dtype.Results.NumFields())}
+			for _, x := range sig.List {
+				// This code creates a string representing the type.
+				// TODO(pjw): it may be fragile:
+				// 1. x.Type could be nil, perhaps in ill-formed code
+				// 2. ExprString might someday change incompatibly to
+				//    include struct tags, which can be arbitrary strings
+				if x.Type == nil {
+					// Can this happen without a parse error? (Files with parse
+					// errors are ignored in getSymbols)
+					continue // maybe report this someday
+				}
+				tp := types.ExprString(x.Type)
+				if len(tp) == 0 {
+					// Can this happen?
+					continue // maybe report this someday
+				}
+				// This is only safe if ExprString never returns anything with a $
+				// The only place a $ can occur seems to be in a struct tag, which
+				// can be an arbitrary string literal, and ExprString does not presently
+				// print struct tags. So for this to happen the type of a formal parameter
+				// has to be a explict struct, e.g. foo(x struct{a int "$"}) and ExprString
+				// would have to show the struct tag. Even testing for this case seems
+				// a waste of effort, but let's not ignore such pathologies
+				if strings.Contains(tp, "$") {
+					continue
+				}
+				tp = strings.Replace(tp, " ", "$", -1)
+				if len(x.Names) == 0 {
+					result = append(result, "_")
+					result = append(result, tp)
+				} else {
+					for _, y := range x.Names {
+						result = append(result, y.Name)
+						result = append(result, tp)
+					}
+				}
+			}
+			sigs := strings.Join(result, " ")
+			if s := newsym(pkg, name, kind, sigs); s != nil {
+				ans = append(ans, *s)
+			}
+		case *ast.GenDecl:
+			switch decl.Tok {
+			case token.CONST, token.VAR:
+				tp := "V"
+				if decl.Tok == token.CONST {
+					tp = "C"
+				}
+				for _, sp := range decl.Specs {
+					for _, x := range sp.(*ast.ValueSpec).Names {
+						if s := newsym(pkg, x.Name, tp, ""); s != nil {
+							ans = append(ans, *s)
+						}
+					}
+				}
+			case token.TYPE:
+				for _, sp := range decl.Specs {
+					if s := newsym(pkg, sp.(*ast.TypeSpec).Name.Name, "T", ""); s != nil {
+						ans = append(ans, *s)
+					}
+				}
+			}
+		}
+	}
+	return ans
+}
+
+func newsym(pkg, name, kind, sig string) *symbol {
+	if len(name) == 0 || !ast.IsExported(name) {
+		return nil
+	}
+	sym := symbol{pkg: pkg, name: name, kind: kind, sig: sig}
+	return &sym
+}
+
+// return the package name and the value for the symbols.
+// if there are multiple packages, choose one arbitrarily
+// the returned slice is sorted lexicographically
+func processSyms(syms []symbol) (string, []string) {
+	if len(syms) == 0 {
+		return "", nil
+	}
+	slices.SortFunc(syms, func(l, r symbol) int {
+		return strings.Compare(l.name, r.name)
+	})
+	pkg := syms[0].pkg
+	var names []string
+	for _, s := range syms {
+		var nx string
+		if s.pkg == pkg {
+			if s.sig != "" {
+				nx = fmt.Sprintf("%s %s %s", s.name, s.kind, s.sig)
+			} else {
+				nx = fmt.Sprintf("%s %s", s.name, s.kind)
+			}
+			names = append(names, nx)
+		} else {
+			continue // PJW: do we want to keep track of these?
+		}
+	}
+	return pkg, names
+}
diff --git a/vendor/golang.org/x/tools/internal/modindex/types.go b/vendor/golang.org/x/tools/internal/modindex/types.go
new file mode 100644
index 0000000000..ece4488630
--- /dev/null
+++ b/vendor/golang.org/x/tools/internal/modindex/types.go
@@ -0,0 +1,25 @@
+// Copyright 2024 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package modindex
+
+import (
+	"strings"
+)
+
+// some special types to avoid confusions
+
+// distinguish various types of directory names. It's easy to get confused.
+type Abspath string // absolute paths
+type Relpath string // paths with GOMODCACHE prefix removed
+
+func toRelpath(cachedir Abspath, s string) Relpath {
+	if strings.HasPrefix(s, string(cachedir)) {
+		if s == string(cachedir) {
+			return Relpath("")
+		}
+		return Relpath(s[len(cachedir)+1:])
+	}
+	return Relpath(s)
+}
diff --git a/vendor/golang.org/x/tools/internal/packagesinternal/packages.go b/vendor/golang.org/x/tools/internal/packagesinternal/packages.go
index 44719de173..66e69b4389 100644
--- a/vendor/golang.org/x/tools/internal/packagesinternal/packages.go
+++ b/vendor/golang.org/x/tools/internal/packagesinternal/packages.go
@@ -5,7 +5,6 @@
 // Package packagesinternal exposes internal-only fields from go/packages.
 package packagesinternal
 
-var GetForTest = func(p interface{}) string { return "" }
 var GetDepsErrors = func(p interface{}) []*PackageError { return nil }
 
 type PackageError struct {
@@ -16,7 +15,6 @@ type PackageError struct {
 
 var TypecheckCgo int
 var DepsErrors int // must be set as a LoadMode to call GetDepsErrors
-var ForTest int    // must be set as a LoadMode to call GetForTest
 
 var SetModFlag = func(config interface{}, value string) {}
 var SetModFile = func(config interface{}, value string) {}
diff --git a/vendor/golang.org/x/tools/internal/typeparams/free.go b/vendor/golang.org/x/tools/internal/typeparams/free.go
index 358108268b..0ade5c2949 100644
--- a/vendor/golang.org/x/tools/internal/typeparams/free.go
+++ b/vendor/golang.org/x/tools/internal/typeparams/free.go
@@ -6,6 +6,8 @@ package typeparams
 
 import (
 	"go/types"
+
+	"golang.org/x/tools/internal/aliases"
 )
 
 // Free is a memoization of the set of free type parameters within a
@@ -36,6 +38,18 @@ func (w *Free) Has(typ types.Type) (res bool) {
 		break
 
 	case *types.Alias:
+		if aliases.TypeParams(t).Len() > aliases.TypeArgs(t).Len() {
+			return true // This is an uninstantiated Alias.
+		}
+		// The expansion of an alias can have free type parameters,
+		// whether or not the alias itself has type parameters:
+		//
+		//   func _[K comparable]() {
+		//     type Set      = map[K]bool // free(Set)      = {K}
+		//     type MapTo[V] = map[K]V    // free(Map[foo]) = {V}
+		//   }
+		//
+		// So, we must Unalias.
 		return w.Has(types.Unalias(t))
 
 	case *types.Array:
@@ -96,9 +110,8 @@ func (w *Free) Has(typ types.Type) (res bool) {
 
 	case *types.Named:
 		args := t.TypeArgs()
-		// TODO(taking): this does not match go/types/infer.go. Check with rfindley.
 		if params := t.TypeParams(); params.Len() > args.Len() {
-			return true
+			return true // this is an uninstantiated named type.
 		}
 		for i, n := 0, args.Len(); i < n; i++ {
 			if w.Has(args.At(i)) {
diff --git a/vendor/golang.org/x/tools/internal/typesinternal/types.go b/vendor/golang.org/x/tools/internal/typesinternal/types.go
index 8392328612..df3ea52125 100644
--- a/vendor/golang.org/x/tools/internal/typesinternal/types.go
+++ b/vendor/golang.org/x/tools/internal/typesinternal/types.go
@@ -11,6 +11,8 @@ import (
 	"go/types"
 	"reflect"
 	"unsafe"
+
+	"golang.org/x/tools/internal/aliases"
 )
 
 func SetUsesCgo(conf *types.Config) bool {
@@ -63,3 +65,57 @@ func NameRelativeTo(pkg *types.Package) types.Qualifier {
 		return other.Name()
 	}
 }
+
+// A NamedOrAlias is a [types.Type] that is named (as
+// defined by the spec) and capable of bearing type parameters: it
+// abstracts aliases ([types.Alias]) and defined types
+// ([types.Named]).
+//
+// Every type declared by an explicit "type" declaration is a
+// NamedOrAlias. (Built-in type symbols may additionally
+// have type [types.Basic], which is not a NamedOrAlias,
+// though the spec regards them as "named".)
+//
+// NamedOrAlias cannot expose the Origin method, because
+// [types.Alias.Origin] and [types.Named.Origin] have different
+// (covariant) result types; use [Origin] instead.
+type NamedOrAlias interface {
+	types.Type
+	Obj() *types.TypeName
+}
+
+// TypeParams is a light shim around t.TypeParams().
+// (go/types.Alias).TypeParams requires >= 1.23.
+func TypeParams(t NamedOrAlias) *types.TypeParamList {
+	switch t := t.(type) {
+	case *types.Alias:
+		return aliases.TypeParams(t)
+	case *types.Named:
+		return t.TypeParams()
+	}
+	return nil
+}
+
+// TypeArgs is a light shim around t.TypeArgs().
+// (go/types.Alias).TypeArgs requires >= 1.23.
+func TypeArgs(t NamedOrAlias) *types.TypeList {
+	switch t := t.(type) {
+	case *types.Alias:
+		return aliases.TypeArgs(t)
+	case *types.Named:
+		return t.TypeArgs()
+	}
+	return nil
+}
+
+// Origin returns the generic type of the Named or Alias type t if it
+// is instantiated, otherwise it returns t.
+func Origin(t NamedOrAlias) NamedOrAlias {
+	switch t := t.(type) {
+	case *types.Alias:
+		return aliases.Origin(t)
+	case *types.Named:
+		return t.Origin()
+	}
+	return t
+}
diff --git a/vendor/golang.org/x/tools/internal/typesinternal/zerovalue.go b/vendor/golang.org/x/tools/internal/typesinternal/zerovalue.go
new file mode 100644
index 0000000000..1066980649
--- /dev/null
+++ b/vendor/golang.org/x/tools/internal/typesinternal/zerovalue.go
@@ -0,0 +1,282 @@
+// Copyright 2024 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package typesinternal
+
+import (
+	"fmt"
+	"go/ast"
+	"go/token"
+	"go/types"
+	"strconv"
+	"strings"
+)
+
+// ZeroString returns the string representation of the "zero" value of the type t.
+// This string can be used on the right-hand side of an assignment where the
+// left-hand side has that explicit type.
+// Exception: This does not apply to tuples. Their string representation is
+// informational only and cannot be used in an assignment.
+// When assigning to a wider type (such as 'any'), it's the caller's
+// responsibility to handle any necessary type conversions.
+// See [ZeroExpr] for a variant that returns an [ast.Expr].
+func ZeroString(t types.Type, qf types.Qualifier) string {
+	switch t := t.(type) {
+	case *types.Basic:
+		switch {
+		case t.Info()&types.IsBoolean != 0:
+			return "false"
+		case t.Info()&types.IsNumeric != 0:
+			return "0"
+		case t.Info()&types.IsString != 0:
+			return `""`
+		case t.Kind() == types.UnsafePointer:
+			fallthrough
+		case t.Kind() == types.UntypedNil:
+			return "nil"
+		default:
+			panic(fmt.Sprint("ZeroString for unexpected type:", t))
+		}
+
+	case *types.Pointer, *types.Slice, *types.Interface, *types.Chan, *types.Map, *types.Signature:
+		return "nil"
+
+	case *types.Named, *types.Alias:
+		switch under := t.Underlying().(type) {
+		case *types.Struct, *types.Array:
+			return types.TypeString(t, qf) + "{}"
+		default:
+			return ZeroString(under, qf)
+		}
+
+	case *types.Array, *types.Struct:
+		return types.TypeString(t, qf) + "{}"
+
+	case *types.TypeParam:
+		// Assumes func new is not shadowed.
+		return "*new(" + types.TypeString(t, qf) + ")"
+
+	case *types.Tuple:
+		// Tuples are not normal values.
+		// We are currently format as "(t[0], ..., t[n])". Could be something else.
+		components := make([]string, t.Len())
+		for i := 0; i < t.Len(); i++ {
+			components[i] = ZeroString(t.At(i).Type(), qf)
+		}
+		return "(" + strings.Join(components, ", ") + ")"
+
+	case *types.Union:
+		// Variables of these types cannot be created, so it makes
+		// no sense to ask for their zero value.
+		panic(fmt.Sprintf("invalid type for a variable: %v", t))
+
+	default:
+		panic(t) // unreachable.
+	}
+}
+
+// ZeroExpr returns the ast.Expr representation of the "zero" value of the type t.
+// ZeroExpr is defined for types that are suitable for variables.
+// It may panic for other types such as Tuple or Union.
+// See [ZeroString] for a variant that returns a string.
+func ZeroExpr(f *ast.File, pkg *types.Package, typ types.Type) ast.Expr {
+	switch t := typ.(type) {
+	case *types.Basic:
+		switch {
+		case t.Info()&types.IsBoolean != 0:
+			return &ast.Ident{Name: "false"}
+		case t.Info()&types.IsNumeric != 0:
+			return &ast.BasicLit{Kind: token.INT, Value: "0"}
+		case t.Info()&types.IsString != 0:
+			return &ast.BasicLit{Kind: token.STRING, Value: `""`}
+		case t.Kind() == types.UnsafePointer:
+			fallthrough
+		case t.Kind() == types.UntypedNil:
+			return ast.NewIdent("nil")
+		default:
+			panic(fmt.Sprint("ZeroExpr for unexpected type:", t))
+		}
+
+	case *types.Pointer, *types.Slice, *types.Interface, *types.Chan, *types.Map, *types.Signature:
+		return ast.NewIdent("nil")
+
+	case *types.Named, *types.Alias:
+		switch under := t.Underlying().(type) {
+		case *types.Struct, *types.Array:
+			return &ast.CompositeLit{
+				Type: TypeExpr(f, pkg, typ),
+			}
+		default:
+			return ZeroExpr(f, pkg, under)
+		}
+
+	case *types.Array, *types.Struct:
+		return &ast.CompositeLit{
+			Type: TypeExpr(f, pkg, typ),
+		}
+
+	case *types.TypeParam:
+		return &ast.StarExpr{ // *new(T)
+			X: &ast.CallExpr{
+				// Assumes func new is not shadowed.
+				Fun: ast.NewIdent("new"),
+				Args: []ast.Expr{
+					ast.NewIdent(t.Obj().Name()),
+				},
+			},
+		}
+
+	case *types.Tuple:
+		// Unlike ZeroString, there is no ast.Expr can express tuple by
+		// "(t[0], ..., t[n])".
+		panic(fmt.Sprintf("invalid type for a variable: %v", t))
+
+	case *types.Union:
+		// Variables of these types cannot be created, so it makes
+		// no sense to ask for their zero value.
+		panic(fmt.Sprintf("invalid type for a variable: %v", t))
+
+	default:
+		panic(t) // unreachable.
+	}
+}
+
+// IsZeroExpr uses simple syntactic heuristics to report whether expr
+// is a obvious zero value, such as 0, "", nil, or false.
+// It cannot do better without type information.
+func IsZeroExpr(expr ast.Expr) bool {
+	switch e := expr.(type) {
+	case *ast.BasicLit:
+		return e.Value == "0" || e.Value == `""`
+	case *ast.Ident:
+		return e.Name == "nil" || e.Name == "false"
+	default:
+		return false
+	}
+}
+
+// TypeExpr returns syntax for the specified type. References to named types
+// from packages other than pkg are qualified by an appropriate package name, as
+// defined by the import environment of file.
+// It may panic for types such as Tuple or Union.
+func TypeExpr(f *ast.File, pkg *types.Package, typ types.Type) ast.Expr {
+	switch t := typ.(type) {
+	case *types.Basic:
+		switch t.Kind() {
+		case types.UnsafePointer:
+			// TODO(hxjiang): replace the implementation with types.Qualifier.
+			return &ast.SelectorExpr{X: ast.NewIdent("unsafe"), Sel: ast.NewIdent("Pointer")}
+		default:
+			return ast.NewIdent(t.Name())
+		}
+
+	case *types.Pointer:
+		return &ast.UnaryExpr{
+			Op: token.MUL,
+			X:  TypeExpr(f, pkg, t.Elem()),
+		}
+
+	case *types.Array:
+		return &ast.ArrayType{
+			Len: &ast.BasicLit{
+				Kind:  token.INT,
+				Value: fmt.Sprintf("%d", t.Len()),
+			},
+			Elt: TypeExpr(f, pkg, t.Elem()),
+		}
+
+	case *types.Slice:
+		return &ast.ArrayType{
+			Elt: TypeExpr(f, pkg, t.Elem()),
+		}
+
+	case *types.Map:
+		return &ast.MapType{
+			Key:   TypeExpr(f, pkg, t.Key()),
+			Value: TypeExpr(f, pkg, t.Elem()),
+		}
+
+	case *types.Chan:
+		dir := ast.ChanDir(t.Dir())
+		if t.Dir() == types.SendRecv {
+			dir = ast.SEND | ast.RECV
+		}
+		return &ast.ChanType{
+			Dir:   dir,
+			Value: TypeExpr(f, pkg, t.Elem()),
+		}
+
+	case *types.Signature:
+		var params []*ast.Field
+		for i := 0; i < t.Params().Len(); i++ {
+			params = append(params, &ast.Field{
+				Type: TypeExpr(f, pkg, t.Params().At(i).Type()),
+				Names: []*ast.Ident{
+					{
+						Name: t.Params().At(i).Name(),
+					},
+				},
+			})
+		}
+		if t.Variadic() {
+			last := params[len(params)-1]
+			last.Type = &ast.Ellipsis{Elt: last.Type.(*ast.ArrayType).Elt}
+		}
+		var returns []*ast.Field
+		for i := 0; i < t.Results().Len(); i++ {
+			returns = append(returns, &ast.Field{
+				Type: TypeExpr(f, pkg, t.Results().At(i).Type()),
+			})
+		}
+		return &ast.FuncType{
+			Params: &ast.FieldList{
+				List: params,
+			},
+			Results: &ast.FieldList{
+				List: returns,
+			},
+		}
+
+	case interface{ Obj() *types.TypeName }: // *types.{Alias,Named,TypeParam}
+		switch t.Obj().Pkg() {
+		case pkg, nil:
+			return ast.NewIdent(t.Obj().Name())
+		}
+		pkgName := t.Obj().Pkg().Name()
+
+		// TODO(hxjiang): replace the implementation with types.Qualifier.
+		// If the file already imports the package under another name, use that.
+		for _, cand := range f.Imports {
+			if path, _ := strconv.Unquote(cand.Path.Value); path == t.Obj().Pkg().Path() {
+				if cand.Name != nil && cand.Name.Name != "" {
+					pkgName = cand.Name.Name
+				}
+			}
+		}
+		if pkgName == "." {
+			return ast.NewIdent(t.Obj().Name())
+		}
+		return &ast.SelectorExpr{
+			X:   ast.NewIdent(pkgName),
+			Sel: ast.NewIdent(t.Obj().Name()),
+		}
+
+	case *types.Struct:
+		return ast.NewIdent(t.String())
+
+	case *types.Interface:
+		return ast.NewIdent(t.String())
+
+	case *types.Union:
+		// TODO(hxjiang): handle the union through syntax (~A | ... | ~Z).
+		// Remove nil check when calling typesinternal.TypeExpr.
+		return nil
+
+	case *types.Tuple:
+		panic("invalid input type types.Tuple")
+
+	default:
+		panic("unreachable")
+	}
+}
diff --git a/vendor/golang.org/x/tools/internal/versions/constraint.go b/vendor/golang.org/x/tools/internal/versions/constraint.go
deleted file mode 100644
index 179063d484..0000000000
--- a/vendor/golang.org/x/tools/internal/versions/constraint.go
+++ /dev/null
@@ -1,13 +0,0 @@
-// Copyright 2024 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package versions
-
-import "go/build/constraint"
-
-// ConstraintGoVersion is constraint.GoVersion (if built with go1.21+).
-// Otherwise nil.
-//
-// Deprecate once x/tools is after go1.21.
-var ConstraintGoVersion func(x constraint.Expr) string
diff --git a/vendor/golang.org/x/tools/internal/versions/types.go b/vendor/golang.org/x/tools/internal/versions/types.go
index f0bb0d15f0..0fc10ce4eb 100644
--- a/vendor/golang.org/x/tools/internal/versions/types.go
+++ b/vendor/golang.org/x/tools/internal/versions/types.go
@@ -31,8 +31,3 @@ func FileVersion(info *types.Info, file *ast.File) string {
 	// This would act as a max version on what a tool can support.
 	return Future
 }
-
-// InitFileVersions initializes info to record Go versions for Go files.
-func InitFileVersions(info *types.Info) {
-	info.FileVersions = make(map[*ast.File]string)
-}
diff --git a/vendor/gorm.io/driver/postgres/migrator.go b/vendor/gorm.io/driver/postgres/migrator.go
index df18db1b3e..2293a7cf18 100644
--- a/vendor/gorm.io/driver/postgres/migrator.go
+++ b/vendor/gorm.io/driver/postgres/migrator.go
@@ -142,6 +142,10 @@ func (m Migrator) CreateIndex(value interface{}, name string) error {
 					createIndexSQL += " ?"
 				}
 
+				if idx.Option != "" {
+					createIndexSQL += " " + idx.Option
+				}
+
 				if idx.Where != "" {
 					createIndexSQL += " WHERE " + idx.Where
 				}
@@ -385,10 +389,16 @@ func (m Migrator) AlterColumn(value interface{}, field string) error {
 								return err
 							}
 						} else {
-							if err := m.DB.Exec("ALTER TABLE ? ALTER COLUMN ? DROP DEFAULT", m.CurrentTable(stmt), clause.Column{Name: field.DBName}, clause.Expr{SQL: field.DefaultValue}).Error; err != nil {
+							if err := m.DB.Exec("ALTER TABLE ? ALTER COLUMN ? DROP DEFAULT", m.CurrentTable(stmt), clause.Column{Name: field.DBName}).Error; err != nil {
 								return err
 							}
 						}
+					} else if !field.HasDefaultValue {
+						// case - as-is column has default value and to-be column has no default value
+						// need to drop default
+						if err := m.DB.Exec("ALTER TABLE ? ALTER COLUMN ? DROP DEFAULT", m.CurrentTable(stmt), clause.Column{Name: field.DBName}).Error; err != nil {
+							return err
+						}
 					}
 				}
 				return nil
diff --git a/vendor/modules.txt b/vendor/modules.txt
index 2837e4e69a..1d01f3d496 100644
--- a/vendor/modules.txt
+++ b/vendor/modules.txt
@@ -208,11 +208,7 @@ github.com/gin-gonic/gin/binding
 github.com/gin-gonic/gin/internal/bytesconv
 github.com/gin-gonic/gin/internal/json
 github.com/gin-gonic/gin/render
-# github.com/go-chi/chi v4.1.2+incompatible
-## explicit
-github.com/go-chi/chi
-github.com/go-chi/chi/middleware
-# github.com/go-chi/chi/v5 v5.1.0
+# github.com/go-chi/chi/v5 v5.2.0
 ## explicit; go 1.14
 github.com/go-chi/chi/v5
 github.com/go-chi/chi/v5/middleware
@@ -284,7 +280,7 @@ github.com/gomarkdown/markdown
 github.com/gomarkdown/markdown/ast
 github.com/gomarkdown/markdown/html
 github.com/gomarkdown/markdown/parser
-# github.com/google/pprof v0.0.0-20241017200806-017d972448fc
+# github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad
 ## explicit; go 1.22
 github.com/google/pprof/profile
 # github.com/google/uuid v1.6.0
@@ -391,8 +387,8 @@ github.com/jinzhu/now
 # github.com/json-iterator/go v1.1.12
 ## explicit; go 1.12
 github.com/json-iterator/go
-# github.com/klauspost/cpuid/v2 v2.2.8
-## explicit; go 1.15
+# github.com/klauspost/cpuid/v2 v2.2.9
+## explicit; go 1.20
 github.com/klauspost/cpuid/v2
 # github.com/klauspost/reedsolomon v1.12.4
 ## explicit; go 1.21
@@ -442,8 +438,8 @@ github.com/modern-go/concurrent
 # github.com/modern-go/reflect2 v1.0.2
 ## explicit; go 1.12
 github.com/modern-go/reflect2
-# github.com/onsi/ginkgo/v2 v2.20.2
-## explicit; go 1.22
+# github.com/onsi/ginkgo/v2 v2.22.0
+## explicit; go 1.22.0
 github.com/onsi/ginkgo/v2/config
 github.com/onsi/ginkgo/v2/formatter
 github.com/onsi/ginkgo/v2/ginkgo
@@ -484,7 +480,7 @@ github.com/pmezard/go-difflib/difflib
 github.com/pterm/pterm
 github.com/pterm/pterm/internal
 github.com/pterm/pterm/putils
-# github.com/quic-go/quic-go v0.48.0
+# github.com/quic-go/quic-go v0.48.2
 ## explicit; go 1.22
 github.com/quic-go/quic-go
 github.com/quic-go/quic-go/internal/ackhandler
@@ -523,7 +519,7 @@ github.com/shopspring/decimal
 ## explicit; go 1.13
 github.com/sirupsen/logrus
 github.com/sirupsen/logrus/hooks/syslog
-# github.com/skycoin/dmsg v1.3.29-0.20241217193208-d32ec623e670
+# github.com/skycoin/dmsg v1.3.29-0.20241218010226-56d92f2ef624
 ## explicit; go 1.23
 github.com/skycoin/dmsg/cmd/dmsg-discovery/commands
 github.com/skycoin/dmsg/cmd/dmsg-server/commands
@@ -617,14 +613,14 @@ github.com/skycoin/skycoin/src/wallet/bip44wallet
 github.com/skycoin/skycoin/src/wallet/collection
 github.com/skycoin/skycoin/src/wallet/deterministic
 github.com/skycoin/skycoin/src/wallet/xpubwallet
-# github.com/skycoin/skycoin-service-discovery v1.3.29-0.20241217194518-634b05d94b2e
+# github.com/skycoin/skycoin-service-discovery v1.3.29-0.20241218011239-6f6be8edf287
 ## explicit; go 1.23
 github.com/skycoin/skycoin-service-discovery/cmd/service-discovery/commands
 github.com/skycoin/skycoin-service-discovery/internal/pg
 github.com/skycoin/skycoin-service-discovery/internal/sdmetrics
 github.com/skycoin/skycoin-service-discovery/pkg/service-discovery/api
 github.com/skycoin/skycoin-service-discovery/pkg/service-discovery/store
-# github.com/skycoin/skywire-services v1.3.29-0.20241217194941-6269f3c618c3
+# github.com/skycoin/skywire-services v1.3.29-0.20241218011810-0e3f3a797af4
 ## explicit; go 1.23
 github.com/skycoin/skywire-services/cmd/address-resolver/commands
 github.com/skycoin/skywire-services/cmd/config-bootstrapper/commands
@@ -694,9 +690,10 @@ github.com/spf13/viper/internal/features
 # github.com/stretchr/objx v0.5.2
 ## explicit; go 1.20
 github.com/stretchr/objx
-# github.com/stretchr/testify v1.9.0
+# github.com/stretchr/testify v1.10.0
 ## explicit; go 1.17
 github.com/stretchr/testify/assert
+github.com/stretchr/testify/assert/yaml
 github.com/stretchr/testify/mock
 github.com/stretchr/testify/require
 # github.com/subosito/gotenv v1.6.0
@@ -784,7 +781,7 @@ go.uber.org/multierr
 # golang.org/x/arch v0.11.0
 ## explicit; go 1.18
 golang.org/x/arch/x86/x86asm
-# golang.org/x/crypto v0.28.0
+# golang.org/x/crypto v0.31.0
 ## explicit; go 1.20
 golang.org/x/crypto/blake2b
 golang.org/x/crypto/blake2s
@@ -804,9 +801,8 @@ golang.org/x/crypto/ssh/terminal
 golang.org/x/crypto/tea
 golang.org/x/crypto/twofish
 golang.org/x/crypto/xtea
-# golang.org/x/exp v0.0.0-20241009180824-f66d83c29e7c
+# golang.org/x/exp v0.0.0-20241217172543-b2144cdd0a67
 ## explicit; go 1.22.0
-golang.org/x/exp/constraints
 golang.org/x/exp/rand
 golang.org/x/exp/slices
 golang.org/x/exp/slog
@@ -822,13 +818,13 @@ golang.org/x/image/tiff/lzw
 golang.org/x/image/vp8
 golang.org/x/image/vp8l
 golang.org/x/image/webp
-# golang.org/x/mod v0.21.0
+# golang.org/x/mod v0.22.0
 ## explicit; go 1.22.0
 golang.org/x/mod/internal/lazyregexp
 golang.org/x/mod/modfile
 golang.org/x/mod/module
 golang.org/x/mod/semver
-# golang.org/x/net v0.30.0
+# golang.org/x/net v0.32.0
 ## explicit; go 1.18
 golang.org/x/net/bpf
 golang.org/x/net/context
@@ -846,21 +842,21 @@ golang.org/x/net/ipv4
 golang.org/x/net/ipv6
 golang.org/x/net/nettest
 golang.org/x/net/proxy
-# golang.org/x/sync v0.8.0
+# golang.org/x/sync v0.10.0
 ## explicit; go 1.18
 golang.org/x/sync/errgroup
 golang.org/x/sync/semaphore
-# golang.org/x/sys v0.26.0
+# golang.org/x/sys v0.28.0
 ## explicit; go 1.18
 golang.org/x/sys/cpu
 golang.org/x/sys/plan9
 golang.org/x/sys/unix
 golang.org/x/sys/windows
 golang.org/x/sys/windows/registry
-# golang.org/x/term v0.25.0
+# golang.org/x/term v0.27.0
 ## explicit; go 1.18
 golang.org/x/term
-# golang.org/x/text v0.19.0
+# golang.org/x/text v0.21.0
 ## explicit; go 1.18
 golang.org/x/text/cases
 golang.org/x/text/encoding
@@ -880,7 +876,7 @@ golang.org/x/text/transform
 golang.org/x/text/unicode/bidi
 golang.org/x/text/unicode/norm
 golang.org/x/text/width
-# golang.org/x/tools v0.26.0
+# golang.org/x/tools v0.28.0
 ## explicit; go 1.22.0
 golang.org/x/tools/cover
 golang.org/x/tools/go/ast/astutil
@@ -899,6 +895,7 @@ golang.org/x/tools/internal/gcimporter
 golang.org/x/tools/internal/gocommand
 golang.org/x/tools/internal/gopathwalk
 golang.org/x/tools/internal/imports
+golang.org/x/tools/internal/modindex
 golang.org/x/tools/internal/packagesinternal
 golang.org/x/tools/internal/pkgbits
 golang.org/x/tools/internal/stdlib
@@ -941,7 +938,7 @@ gopkg.in/telebot.v3
 # gopkg.in/yaml.v3 v3.0.1
 ## explicit
 gopkg.in/yaml.v3
-# gorm.io/driver/postgres v1.5.9
+# gorm.io/driver/postgres v1.5.11
 ## explicit; go 1.19
 gorm.io/driver/postgres
 # gorm.io/gorm v1.25.12