IEDB API Tools Python SDK

Python SDK for Immune Epitope Database (IEDB) Analysis Tools API. Includes support for the following prediction tools:

• MHC-I peptide binding:
  • Determine sequence's ability to bind to MHC class I molecule
• MHC-II peptide binding:
  • Determine sequence's ability to bind to MHC class II molecule
• T-cell epitope prediction:
  • Use predictors to determine peptide's potential of being a T-cell epitope
• MHC-Natural Peptide:
  • Assess probability that peptide is naturally processed by the MHC
• Antibody epitope prediction:
  • Predict B-cell epitopes from protein sequence(s)

View the web application

Installation

Run the following to install:

pip install iedb

Usage

import iedb

# Send POST request to MHC class I peptide binding prediction tool:
mhci_res = iedb.query_mhci_binding(method="recommended", sequence="ARFTGIKTA", allele="HLA-A*02:01", length=8)

# Send POST request to MHC class II peptide binding prediction tool:
mhcii_res = iedb.query_mhcii_binding(method="nn_align", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-DRB1*01:01", length=None)

# Send POST request to T-cell epitope prediction tool:
tcell_res = iedb.query_tcell_epitope(method="smm", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-A*01:01", length=9, proteasome='immuno')

# Send POST request to peptide prediction tool:
pep_res = iedb.query_peptide_prediction(method="mhcnp", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-A*02:01", length=9)

# Send POST request to B-cell epitope prediction tool:
bcell_res = iedb.query_bcell_epitope(method="Emini", sequence="VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTE", window_size=9)