Skip to content

Commit

Permalink
Merge pull request #137 from jjavier-bm/master
Browse files Browse the repository at this point in the history
version update
  • Loading branch information
jjavier-bm authored May 3, 2023
2 parents 3afa47d + 1e705e3 commit 5a79ebb
Show file tree
Hide file tree
Showing 2 changed files with 2 additions and 2 deletions.
2 changes: 1 addition & 1 deletion crops/__init__.py
Original file line number Diff line number Diff line change
Expand Up @@ -10,5 +10,5 @@
__date__ = "Jul 2020"
__copyright__ = '2020-{}, University of Liverpool'.format(datetime.datetime.now().year)

__version_info__ = (1, 0, 1)
__version_info__ = (1, 0, 2)
__version__ = ".".join(map(str, __version_info__))
2 changes: 1 addition & 1 deletion crops/core/tests/test_ops.py
Original file line number Diff line number Diff line change
Expand Up @@ -17678,7 +17678,7 @@

_SEQUENCE_7 = "SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK"
_HEADER_7 = ">1D5N_1|Chains A, B, C, D|PROTEIN (MANGANESE SUPEROXIDE DISMUTASE)|Escherichia coli (562)"
_FASTA_SEQUENCE_7 = _HEADER_6 + os.linesep + _SEQUENCE_6
_FASTA_SEQUENCE_7 = _HEADER_7 + os.linesep + _SEQUENCE_7

class TestCropsOps(unittest.TestCase):
def test_renumber_pdb_needleman_1(self):
Expand Down

0 comments on commit 5a79ebb

Please sign in to comment.